2K7PA

Filamin a ig-like domains 16-17
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
188
structure length
188
Chain Sequence
GAMAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic structures of two novel immunoglobulin-like domain pairs in the actin cross-linking protein filamin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Filamin-A
total genus 32
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k7pA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k7pA01
3BE1L 3CZFB 3PHSA 4ORZC 4GAGH 2A1WH 4P5TC 4HZLB 1R0AL 4LAQH 4LIQE 1RZJL 2EDKA 2W9DH 3Q3GA 2APTA 3B6SA 5B39A 1HIMH 3TN0C 3G6DH 2VLME 5C7XH 1S7TB 4UIKH 1CDGA 1VENA 3BO8A 5E6IC 4X6DE 4LPCA 1U8JB 2WUBH 3U0WH 1MRFH 4P57B 2OTUB 3QP3A 3S36X 2DIBA 3GSXA 5IFHL 4ELKA 3KPQA 3HMWH 1MWAL 3GIZH 5GZND 2EYRB 3P9MA 5EN2B 1B0RB 3R1GH 2FATL 4KJQC 4P23B 5DFWH 2NR6C 1MAKA 4NQDA 1SBBA 5DJ0A 4LVOC 1J87A 3H7BA 3MLUH 3FN9A 1BVLA 3NAAH 1IGTA 4L3EB 5LCVL 4QHKJ 3HC3L 3WS3B 3O41B 5F89B 5GSRA 5JOEA 3TO4C 5HYJB 3STLB 1G6VK 3TYFA 4NJ9H 3J7HA 2JJUA 1V7MH 1OT2A 1AQDA 3PWVA 5E8OA 5DWUL 2YPLD 3KDMA 4U2YA 3UXFA 1LEIA 2X4PA 5SWSB 5LCVH 1E27B 3OJVC 5JXEC 5F96L 4L8BA 3FQWB 1T89C 3PWPE 3T3MF 3CSBA 4Y4HA 3MODL 1IEHA 5CINL 5F21B 3U9PL 4MDJB 4YHPB 1XCQA 1H8NA 4FZEL 2BXYA 1T2XA 1GCFA 2WQ8A 2COQA 4Y5VA 1ORSA 2VDKH 1F45A 4QWWD 4XBGB 1O7VA 4HMDA 2H2PC 3SJVA 3WHXB 1CT8A 3ZE0E 2DYPD 4JFOB 4S10A 1HHKA 4DVBA 4JANB 3G6DL 3RP1A 1P6AB 1OTUD 4UOW0 4V2BA 2EH7H 2J3SA 1DDHB 2DQCL 2W9DL 1CU4L 4HIHB 3G6JB 1HH6A 4RGMC 3P11L 4NYLB 4KK6D 3VGFA 3BE1H 1HHKB 3OMZA 1K9TA 4J12A 2X6MA 2RQ8A 1MCIA 5MERA 1ZAGA 1DL7L 4PV8B 1EAPB 4R7NB 3QO0A 5GISH 1OAKH 3LCYA 1LEKA 3MUHL 1A3RL 4OLYL 1R5IA 4PGCB 5E8DH 5CJXA 1I8LA 1MAMH 2AKRA 2C3GA 2MHAB 1X5IA 4Y4FC 4G9FB 2D3VA 4ZUWB 5KW9L 3STBA 4MD5A 4IRJC 3U46B 2SEBA 5F7HA 5EBWA 4YHYC 3MFFA 2AXJA 3QISA 3WNLA 1CI5A 3QUZD 2R4RL 4PJ8A 1YPZE 4X4YB 1F11A 5JNYA 2CUIA 4NRYA 2W92A 3TYFB 2WWKO 3GMNB 4BK4A 4W68A 4M1DH 4N68A 5CJ5A 5I1CL 1CZ8L 1IGTB 4L3EA 1T83C 1BVLB 3BW9A 2O93L 4JFYB 1G0XA 3K0WA 4K9EC 3ZE1E 5GXBB 3MV8A 4J8RB 4Z77A 4NQDB 5DJ0B 5FKPB 1G84A 4TNWF 3GO1L 2D7MA 3D87B 3LKQB 3FOMB 2BFVL 4DEPB 1B0RA 1GSMA 3PP3H 5EN2A 4WW2F 4E5XB 5KSBA 1HHIB 1U8HB 3N50A 3GJEA 2EDTA 3LEYH 1OWWA 2D2OA 4F80A 1U8JA 5BRZB 2A6JB 5FYKL 1MQKH 4LRIA 1RZIA 3HCVB 3QDMB 4ZTOH 4EUPB 5DRNB 1FFNB 1S7TA 1A7RL 3WFCH 5I1LA 3RL2B 1P84K 4EQ3A 1RZFH 1VEPA 3HFMH 3Q3GB 5BZWA 2IFFH 4WFFE 4DKFH 4F7MB 1CCZA 1T2JA 1MIEH 1C5CH 1LK3L 3CZFA 3HA0A 3TH3T 1GGIH 4OZGE 1IKNA 1S5IL 1XGTA 3LN4A 4QNPF 5DD5L 4LSRL 3NABH 3UZEA 2CXKA 2I60H 5GGUA 3O3UN 5HHQB 3RJQB 4PY7A 1X5HA 3EJJX 4TUOB 1WTGT 3EYSL 3OX8B 4BH7A 4Z76B 3VXRD 3IDUA 2J8OA 1XCTB 1JPSL 3RTQC 3LPWA 1BBJB 2HT3D 4LLWB 1BOYA 4YGAB 4E42B 4GG8A 5JHDA 3BPCB 1K4CB 4JY5H 5IV2B 1N5YL 5IHUL 5CWSA 1V3JA 2VC2H 3DI2B 1BP3B 4Z7UB 1QBBA 4PRAA 4QHUB 2Y23A 4CJ0A 4NNXB 5F3BA 4JHWH 1DSFH 1NBVH 4K7FB 1X4YA 1CDUA 2MCPL 2FH8A 4PJIB 2ZUVA 3ARDB 4QHMB 1YYML 1JE6A 2Y36L 4X4MA 3ARFA 1RJZB 3GUTA 1FNGA 2OCFD 5BVPL 2NW3A 5F7EH 1INQA 3ZTNH 1HZHH 3M45A 5C09B 5EFIA 1NBQA 3PDDA 4O2FA 4QXGH 1CDJA 4QRUA 1UZ6F 2VXUL 4ZUVA 1DBBL 4IJ3B 2FEEI 3RUGE 2DD8H 1KFAL 5EZJB 5MENA 3D85D 4GQ9H 3TA3D 1VGEH 4BUHA 2NTFA 2BC4A 4X6CA 4Z7UF 4FA8A 1OGAB 2GTWA 1CFTA 2Z4QA 5BZDA 5B8CB 5L9DL 1CE1H 2XA3A 1ED3B 1VACB 3VXUA 5J13C 3IDXL 5CS7A 1M7XA 3DGGB 2VDNL 4QCIB 4LHJB 3MUY1 1LP9E 4QRTA 4LCUA 1S9WB 3WIIH 2DBLH 2GKIA 3UTSE 4XXDA 4MJ5B 2X1WL 3KPTA 2EDOA 2LFGA 2FO4A 2WIMA 2LU3A 3EYVB 3GJFH 3KYKH 4ZS7H 5IVXB 1UM6H 3MV8E 1OAUH 4WI7A 3X17A 1B6DA 2QL1A 4P5KA 2C1PB 1JWUA 5A40E 5CBEB 1WAAE 2NY3B 2E8YA 4Z5RB 4U7MA 5CZVH 2E9BA 1P69B 1HINH 3GSVA 1R3JA 5DMYA 1FJ1B 1BLNA 1JGVL 4HFWB 3MACH 4GH7B 3RWGB 5CD5C 2QQKH 1P2CA 4C56D 4GRWH 2GK0B 4JO3L 1G7PA 1YEIH 3OKEA 5I66A 3VH8A 4HWZB 1A9EA 4O00A 3LEVL 5FA4A 4U1HB 1B3JA 3V52L 5IW1A 5DA0B 4JM2F 2PXYD 5FO9A 1DBAH 2W60A 1MHCA 2WIIB 3UZVB 4JR9L 4KMQA 4LSDA 1GXEA 2OL3H 4WVRA 1CS6A 4HJJH 5EZLA 1P4LB 3VI4F 5INDB 3MREA 4Y4KA 1FN4B 4KZDH 1AR1C 1NC2B 5E70A 3PL6A 5C0JA 3FO2A 5D9SA 3UTSB 1IGFH 3QIWA 4PJDB 4PP2A 3O9WD 5C8JB 3H3PL 5JQ6L 3MA7A 4JHBA 4YDLC 3BIBX 4TULL 2B7DT 4MA3B 2CDEB 2GSIA 3ALWA 3CAFA 4FN0A 3INUH 3X14A 2DS4A 4MNGE 1GGCH 2EDNA 5E08L 2VH5H 4JO1H 4EEEA 1U8IB 3H8NA 5I1EL 3SGEI 5JPNB 2CIKA 1SMOA 2M2DA 1IC4L 2XFXB 3GSOA 2E7LC 4ODVL 5A2JH 2A0LC 3FQRB 2X5PA 1Q9KA 3JV4B 5FHAL 1YY8B 4XPFL 2X4OB 1UJ3C 2DQUL 3LSOB 2UY7A 5F9DC 3VXUD 4KJWD 4OKDA 2VXVH 3KPRD 4HS6A 5IVZA 4DUXA 2MQ0A 5M95B 1CK0L 4JZNA 1NANH 3CUPA 3QIWC 4Y1AB 3CK0L 2AQ1A 2B5IC 2AP2A 1IM9A 3X13B 1FVCB 4I2XA 4Q74A 4OIIL 2CLVB 1S9KC 1XIWD 2BNRE 1OCWL 1RD6A 3G5VA 3MBEB 3CXDH 1FRGH 2YK1H 2R29L 1I1YB 1HHGA 2X89A 2CR6A 4QT5B 3HI1A 4I3RL 4XNXH 2CH8A 4F37K 3DX8B 3RZCC 1A4JA 4HKZA 4HC1A 1YEIL 4JO3H 1J05B 3V4PH 4GG6B 1EMTL 1TITA 2F58H 3DXAA 2I24N 4PRPE 3RVXC 5IBTL 4QKXB 3V8CA 2MKWA 4KMTH 5BRZE 2GJ6D 3FB8A 4RAUB 2WUCL 3MACL 3VD3A 3O2VH 5C0IA 1QPPA 3GBLA 4X4ME 2JJSA 3STZA 1FFQA 5K59E 3LKNB 1Y18B 1EERB 3RWFA 3D39A 4EDXB 1AD0B 5EZOL 1UXSB 1KCUH 3ZYZA 4FQHA 4PRIA 3SKMB 4JZJC 1EFXD 2P5WD 1BAFH 3BP6B 1QBLL 3O2WL 3W0WB 2GTZB 5FDWB 2PYEB 1WCBB 3EYQD 3WNPA 4P4KB 2AEIT 2BVYA 4WI3A 3NIGF 1ZANL 1S9XB 2DBLL 1OAYH 4WV1B 5ACLA 1PKQE 4IDJH 3BPLC 4I4WB 1G9MH 4LGPB 4MX7A 3MLSH 1AXIB 2YRPA 1F4YL 4OZIA 1TJHH 4FABL 1WLHA 3S5LA 3IFNL 1T03H 3IDXH 5SX5H 3GNML 2XTJB 4G8GE 3RVVD 1RUPH 3FB6A 1RHHB 4Y2DC 1T1ZB 5IB4A 4XNYH 4F37F 5DHVA 5AZEH 1F4XH 1QOKA 2WWMC 2V9RA 3B83A 2P7TA 1OGAE 4LAJH 4L8CA 5IB5B 3S8WA 4AG4L 3CFKA 3W9DA 2VNCA 3LB6D 1A1NA 4IS6A 5JXAH 3TA3A 2Z35B 3NIFE 4GQ9L 1G6RB 4KDTC 4KK9C 4P2OA 4U1LA 3BYTA 4GKSA 1SYSB 1NL0H 1DBBH 2JJVA 1QVOA 2VXUH 3H0TA 1AD9B 1OTSC 4JFPB 2QR0A 2Z8RA 1T22A 1A6ZB 3V6FB 5BXFB 5JOFA 2XNAA 3KPNA 5JDSB 3UO1H 1GOHA 1N8ZB 2VQ1B 1DQMH 3HMXH 1Q1JL 4BSVB 2XTJE 4I3SH 2EC9T 5CJQL 3VE0A 4ZFOA 1FL5B 3PNWA 3QHFH 4FFYL 2J6EL 2DJSA 4UDTB 3MGTA 4NQVB 5DEFB 2ADIA 1ETZB 3OB0H 1SYVB 4HFUH 1NBVL 3RAJH 3VD9A 3VFWB 2VERN 2ADJB 2QHRL 4W6YB 4PJ8D 4XCCL 1PBYA 3OWEA 5DHYA 3AU1A 2ICWB 2XZQL 2DKUA 2JIXA 2NZ9C 2JB5H 1QSFB 1C1EH 3HPJB 4KTEL 2ZSVA 3UTZB 2CXGA 3THML 5F93C 4NFCA 5DHXB 3VI3F 1SJEB 5CP3A 3K1KC 3QI9B 4TSAL 3VCLB 2I07B 1YUHB 3IFOB 4FXGA 1KCSL 5ANMB 1HEZB 2K9UA 5F7YC 3WL9B 3MA9L 2HFGH 1EZVX 2NY4B 4HXAH 4XMLL 1FG2B 1UEYA 3EZJB 4ZUTB 1FNEB 4DKAA 4X5XA 3AS2A 4G7VH 1IC1A 4Y4HC 4ELMF 1JRHI 3SGJC 1N5AB 1XT5A 5F9JB 4UNUA 3P2TA 4L9LA 1YECH 2DYPB 3QNYB 2X4NB 3GMPB 1T5XB 4NQED 5D7KE 5ACMA 3A6CH 3JV6A 3G04B 2A0LD 4L4TA 5HI3D 4WFHE 5GJSH 4L9LB 2YWZA 1T4KA 2P5ED 4NQXB 2NXZB 1HK6A 1D9KB 2EDLA 5DJXA 4RMQA 1N5AA 3AM8C 4DZ8B 5ERWB 1F4WL 5GGSA 3NZ8B 4M03A 5B38B 4XBEL 1KOAA 3C9NA 5DQDH 2F8OA 3ARDC 3WEXB 1CICC 5GQBA 5T1LD 5ITFB 1BZ9A 5FGCB 1JNLL 1TQCB 3P73A 2NY7H 5C09E 3N85L 4V2CB 2JCCF 4Z78B 1RUAH 4XWGH 3OKOB 3SPVB 1HWHB 3LN9A 4TVPE 5CIPA 1AGEB 2ZG2A 4ZFOL 5FUCC 3ARBB 4DGVL 2WMPA 1NC4D 1EJOH 2R0WL 1C7SA 4IRJA 3AU1B 5LAXB 3BP7B 2NY6B 3P4MB 4ZFFB 5CEZL 2EO9A 4OB5L 1GGTA 1VFBA 3HE6D 4OZGA 5IHZB 5B3JE 3L3OB 5E4EB 1TETL 2D7TL 3QNZA 3B9KB 3H3KA 1CF8L 1MFEH 4ALAL 3VJ6A 5CD5D 5IK3B 2IEPA 3P40A 1N59A 1UZ6E 3QB7C 5EO0A 3BYYA 1TTGA 3HMXA 4HCRA 3RGVB 3OXSB 5E6ZA 1C08B 1VFUA 3ZL4L 1MCDA 3PWLA 2GK2A 5ICZA 2YD7A 4I5BB 1U95B 2HFEB 1A7QL 4ZO9A 4F3FB 5SV3A 4IRSC 4IIQC 1A6ZA 4JRXE 1T22B 4LRNL 4P46C 4R96A 5EUOA 1K2DA 3QXAB 2QKIA 5DURD 2H32A 5IWLC 1E4KA 2NY3C 2NNAB 1U2HA 1H3WM 4WTWA 3U2SA 4AYFA 4X4XA 2L0DA 5DHVB 4K9EH 4LSVL 4N90E 5JIHA 2YD1A 5JUEL 3L5IA 5HD8D 1CXLA 2F8XC 3VXMD 3WE6B 3DHMA 4Z7NE 5CINH 4ZSOA 3MJ9H 4NFDA 3O0RH 4KK5D 1L7IL 2A6IB 2BVTA 1JZ2A 2CPCA 5C0CA 3T4YA 2I9TA 4YBHA 3ULVL 4EN3D 3QCUH 3IAPA 4MA8L 4WWKB 5HPMA 4HULB 4JN2A 2CRIA 1S5HA 4ZQKB 3GJFB 4ZODA 4GMTH 3AREC 1SBSL 5HGGS 1F3DJ 3EBAA 1AXSB 2ZPKH 3KYMA 2A6KB 2DI9A 1HHHA 5IFAH 4OCRH 3N1MC 4U3HA 4KQ4L 5FCUH 5CBAB 5J89A 3DWTA 5I0ZA 3CFBA 2FNBA 1AGDB 4BH8A 3OGCA 3STZB 3SBWA 3LZFH 3GBMH 4PJDE 5F7KC 4OQ1A 3R8QA 2E3VA 3ZZ1A 5DT1L 5DJZB 3I2CH 4FQQB 4GRMB 5IESH 4FXLA 4R4FL 5L2JB 2PCPB 35C8L 1J05A 4GG6A 4HKZB 1JZ8A 1MCCA 3OKDB 1XGRB 4KI1A 5I2IA 4XVUC 4LLVA 4RA3A 4WNQA 2CMRH 1ND0A 1HKFA 2Q76B 4JY6B 4XRCA 1K6QH 1IGMH 2PN5A 4PRIE 4HIEB 3MBEA 3OKLB 1ZLWH 1BVZA 5LVEA 2PETA 5F9OH 4ZFGH 2EYTB 1FVCA 5B3NA 3O3AA 5E95B 1IM9B 1VGKB 3L3DA 2VMFA 3B9AA 1NFIA 3CD4A 3RU8L 3X13A 1E6OH 4FFVD 5D2NC 2F19H 5KSAB 5E2TH 1JHLL 1XZ0B 3RWIB 4JZNB 3TGXA 5EPMA 5IGXL 4HS6B 4LVHC 1LMKA 1N3NA 4MNQD 4W6XB 5JW5A 2CKBL 5I6XB 5HXMA 3LSOA 5DA4A 2B5IB 1RAMA 2D7NA 3DIFB 4ONGL 4JG0L 2H8PA 4JPVH 3IXAA 4ELME 5JZ7C 2IG2H 5EUOF 1U8PA 5DK3A 3R4DA 2VLJD 4N0YL 2E7CA 3OKMB 4MS8D 3ABZA 3ARYA 1U8IA 4ZXBD 4HJGB 3TNMB 1NPUA 4YXLL 1JPGA 1I75A 1OHQA 2AJZA 1E4XH 1HI6B 5HGAB 3E2HC 5L6YL 2CRYA 1MFBL 5C8JA 2WLYA 3V0WH 4PJDA 4EDWH 4U1NA 5I8KL 3S35H 3VFUB 2GT9A 1MI5B 3CSPA 3MMEB 4PJ5E 2X9YA 5F8QC 1ZK9A 1KCRH 2VDQH 4HZAA 2VITB 2ESVD 5JXEA 1V7NL 2VZTA 1R3IH 4NT6A 3GGWB 2Z91B 4A6YH 4M62H 3QXUA 3L7EB 2GJ6A 1V3LA 4P2OC 1JHKL 4Q0XL 4X6DF 4RA0C 3BP4B 1A9EB 4OZHE 5IQ7H 3L5HA 3PABB 1SMAA 3DBXA 5DK2B 4A6YL 1E28B 1WVZA 4PR5B 3RZCA 4M5ZH 4X0KB 5BCAA 1EAJA 1JGEB 1R3JB 4G8EA 4LVOB 2ZOKB 4U0RC 5FGRA 3O6MH 3QEUB 5FYLL 3GSNH 4WHDA 1MCOL 3T2NL 5HGDA 1XF3B 3ES6A 1RPQA 1S7SB 4MCZA 4NNPH 4XI5C 1JWUB 4QRPB 4ZOEA 4RISL 4P2RA 1Y0LA 2RR3A 2ZUXA 4HC1H 1QG3A 4FFWC 4JZJA 5EIQA 4P46A 1IMHC 1F3RB 4DKEL 4JVWA 4KRMB 3IRZA 4MJ5A 1DE4B 3GHBH 2AABH 3QUML 4GUPB 1KJMB 4H88L 5DUPL 3KWWB 1IKFL 3O4LD 3DXAE 2OTPA 1MCPL 4FQ1H 3QDGE 4HLZH 4X7TB 3TO2A 4HAFA 4LLMB 4XHJC 1CFQB 3O8XB 5HGDB 4JFQB 5KS9F 1HH9A 1XGUB 1NCWH 1PY4A 2VWEE 3T09A 1T20B 4MXWH 1A3QA 4XPHL 5J11B 6FABH 4MJ2A 2ZOKA 1FO0H 1ZTXH 1UH4A 1ZHNA 4RGOL 4H0GA 3HUJE 4K71C 4XT1C 4LHUD 4IOFC 3U4BH 3LH2H 1K6QL 3DVGB 4MA1B 2OI9B 1CGWA 1I1FB 5C09A 2A83A 4OQTH 5IT2L 4Y1AE 5DTFB 1I7RB 3PWNB 1AFVH 1FNGB 2V17H 4U6VL 4UQ3B 4OLVL 3ZTJH 3SGDI 3EJYC 1FDLL 3L7EA 5CLTA 3ARDA 1IGYB 1OQOA 2BVOB 4P99A 3FMGL 1O5DT 4NNXA 4PRAB 3DO7B 2VITA 4KQ4H 4UILL 5F1OB 4UT6L 3NACL 1I1CA 3BMWA 1MI5A 3BH8B 3I84A 3EZ8A 5GS0C 5GZOC 4J1UA 1KEGH 3A67H 2Q6WB 3UPCA 4LFHG 3FOLB 1U3ZA 5DVKA 3EDKA 3PE9A 3JTSB 1XCTA 1UKTA 4Z6AT 4CDHA 2VAJA 4QO1A 3NZHH 3V5HB 5C6TL 5FXCH 2NXZC 1J1OH 1MHPL 3FTGA 4QRSA 4H1LH 5CJBA 4LIQH 1L7IH 3JWDC 5ABDE 4XPTH 1AHWB 4LEOB 4Y5XB 1BWMA 4WFED 2H8PB 3T0ED 3BGAA 4F7MA 5C0NC 5JUEH 2JB6B 3O3DA 1KXQE 3BKYH 1KPRA 5JOPE 1CGSH 1ZOXA 3CSYA 3VXSE 4WEBL 3W9EA 3RHWF 3VXTA 1FVEB 1QHOA 3RPIB 4NHCL 3U4EB 4UT7L 1FFNA 3RWIA 5C2UB 4PJXE 5CJ8A 2IQ9H 1RZIB 3WHE1 1K3IA 4Z0BH 3O3AB 1A14L 2EYTA 5EDXA 1U8HA 4XP9L 5EOCJ 4F7EA 1ZT4B 1F42A 4OV5A 4HIEA 1NFDF 4N8VG 3S3SA 4YXKH 4KKAD 3BPLB 3PIQA 2CLRB 3KXFE 3MV8B 4D9LH 1S7WB 2FLRT 5I17B 2HN7A 1CF8H 1MFEL 1X5KA 3FCTA 1TETH 2D7TH 3D39E 1B0GA 4R2GD 4RMWA 3QHTC 2Q1EA 1LQSR 3ARFD 1QBMH 3BKCL 1JZ3A 2RJMA 4Y5YC 3KHOA 1LHZA 1IM3B 2EEAA 1KB9J 1EZVY 5HHMD 3W11C 1K4DB 4S1DD 4PJ8B 4ONFL 4X4YA 1EJOL 2R0WH 5HVGB 2BHUA 3I50H 1I9JH 3LKRA 3EHBC 1SJHA 2DLTA 3NCFB 1KJ2B 2YUZA 2OMNA 3HUJA 1BFVH 1VADB 2F54D 4G42A 5CHNA 5FF6A 1HCFX 1HHHB 1QBAA 3KYMB 3T0EA 5AWNL 3UJTL 1B2WL 1AE6H 4S1QH 5T1KA 1FG9C 4IRZL 5CAYB 1BJ1J 5HHXH 3LS5L 3V6ZB 3S3JA 4X8JB 3P77A 4P4RA 4R7NA 5GJTH 4I0PD 3MLZH 5DRZA 5GS2D 2F53A 5DQDL 2AI0L 2HT2C 2ZG1A 2UVEA 3ZKXC 4D0CB 3R06A 4XBEH 1WCQA 4NUGH 5BS0E 4K3DL 1KB9K 3WE6A 1HCVA 4BZ2H 2D0HA 3O6KH 1HH6B 1W72B 1AP2B 4NIKB 3QUYB 1GJIA 2VLRA 1NUGA 3DRQA 5IMMA 4FZ8H 5DUML 4AJ0A 4JANA 2IPUK 4J3WA 1ZMYA 5BMFH 5I71C 1BM3L 3TEUA 4EIZC 2XXCB 3BDBA 3VXQB 1VESA 1KEMH 1JVKA 2NXZD 3MRNB 2EDBA 1FNFA 2GCYB 4L5FH 3L3IB 1LNUB 1U8MA 3DSFH 5MEPA 2YOCA 3QEHA 4HS8L 1TNMA 2XRAH 5I9QB 3ILPB 5E99H 3MRIB 5KSUA 4Y4HB 3VMOA 2P4AB 4FQLL 3GSQA 1EUUA 3SJVD 1P7HL 1LGVA 4L8BB 2EE2A 1HSBB 1KTRL 2Q7NA 4S11A 4TSAH 2VZVA 2NY2D 2DAVA 4DK6A 5C9KA 3HHRB 3QDGD 4KH2A 4XCYA 1AQDB 2F53D 3D25A 1W8NA 2M26A 5HI4D 2R9HC 3WUWA 3IJSA 4V1DD 1C1EL 3D69B 4KXZI 3GKZA 4LSUL 3H7LA 1AI1H 4F7TB 3P9LB 1UH3A 1QSEB 5GGRY 4HFUL 1RY7B 1M1SA 3DARA 4NRZA 1UADC 2BXZA 4F7CA 3MV9E 4EVNA 1IAII 1T1YA 4Y16D 5ITFA 1E4WL 3H42H 3DVFA 3QQ9C 3QT2A 3WFBH 4ELKB 1KTDA 1A2YA 4R4BA 5M7QA 1TQCC 2VQTA 2X70A 1H3TA 3UBXG 3QPXH 3WN5A 4O51A 3C9NB 4KY1H 3H6JA 4Z7WB 3GZKA 1D6EA 3QEGH 4JREB 3UAJD 4PP1D 3BD3A 4PB9H 3RIAF 1D9KA 5DJXB 1NL0L 1OGTB 2BVUA 3NCMA 3FB7A 5I8OL 3B6SB 5B39B 1JPST 1FL3B 1H15A 5LGKA 3Q48A 4D3CL 2I5YL 4CU6A 4KMLB 4QOKB 2G75B 4ODTL 1CR9H 3QFJB 4Q58C 4Q97A 1MQ8A 3QRGH 4IDLA 3KS0J 4LLDB 3OKYA 3SBWC 3WDJA 1TJHL 1F4YH 4PRHD 1TJGH 2H6PA 3S37H 1NGQL 1EGJH 4S2SB 4LKXA 5D71L 1XH3B 1D5ZB 3IDIA 3DPBA 3CDCA 5DQ9B 3IFPA 3ZKMC 4L4VB 3VXPA 1INDH 4Z7WF 4EI6A 3VRIA 2EE3A 3H9SA 1HEZA 4GRLA 4NKOB 4QXWA 4CN1A 3QI9A 3SGJA 4FRWA 1Y6KR 5E8PB 4MJIA 1QBLH 4PLJD 5A2LH 4JPIA 4BFIB 5JR1H 4GBXA 1K3ZA 2CLZA 5IJKA 1U2CA 1INEL 4CMHC 4GMSL 3UJIL 1NLBH 3KPMB 2YSSB 3MV9B 3RDTD 3DMMA 3RY5A 5EU3B 4QRRA 3OQ3B 3JBG7 1RK1A 2Y25A 2YRZA 4U0RB 1CE6A 4P2QA 1KYOK 5D2NA 3X11A 4OGYH 4BKLB 4JPKL 3PL6D 5D5MB 1OB1A 3MGTB 4NQVA 4UDTA 5DEFA 2V7HA 5I75C 4Y2DA 3WFHB 1FL5A 2ARJB 3V4PL 3BEWA 5J06A 3EDJA 5D6DC 4NKIL 4KRPC 4I3RH 4XNXL 1XF5A 3D5OF 5C0EB 4I0CC 2ENYA 2J5LC 4GG6E 3L3GA 3CXDL 3KPNB 3BWAA 3P9WB 2QR0B 3QHZH 1D5XA 1AIFB 1WISA 5JIIA 3BN9C 1FYTE 5HVHB 2IGFL 2HWZH 3CK0H 1G6RA 2JF1A 4JFED 5EWIL 4XVTH 4IS6B 3WFZA 4ZO6A 2F5BH 4WCYH 2PXYB 1T89A 3G5XA 3QNXA 4XNZC 2DOCA 4YBLB 1IVLA 4JRYA 4UU9B 5FHAH 3HAEG 1J5OH 3D3VD 4XCNB 5HYQA 2ITCA 3ZKSD 4ODVH 1BQHB 3TV3L 1A6VH 1S78C 4DW2L 3BRGC 4JO1L 2GAZA 2ATKA 2BY3A 1FZMB 1LK2B 3W5MA 3Q6GH 3LOWA 5BS0B 2OZ4H 2IANB 1DP0A 3DTXA 4JGMA 1PY9A 2FB4H 4PYHA 1QP1A 3GMQB 5FDWA 1A7BA 2H26A 2V5YA 5ITBL 4M7ZB 5HHOE 1BFOA 3KYNB 3MRJB 4NHUB 4NO3B 5DJCB 4AM0A 4X6DA 2CSPA 4PRIB 4PJDF 3U82B 3DMMD 3BRFA 4QWWC 5KVGH 3CX5J 3V6OC 3B2UC 4N1HB 3B5GA 3NIFF 3SN6N 4CADA 1Q0YL 4M7JL 4N0FA 4HGKC 5HYIA 1NKOA 5F70A 5HGBA 1WZKA 3GSNB 5F3HB 4ODHH 1I1AB 1GL4B 3FB8B 4HCRL 1NCCL 1KENL 3CFCH 3ULUE 1EUTA 1I8KB 3LEVH 4PRNB 4O4YL 5HDOA 1SEQL 4HLZG 1ZVSB 1NJ9B 1KF9B 5IB3A 3IETB 1QYGH 2QQKL 2B4CH 5GGQH 1B9ZA 1MRCH 1JF1A 2DQJH 3FFCB 4YX2H 4E41A 3X3GL 4YPGA 1N2RA 3QEQE 4PJHE 1T21A 4MJ6B 4PJ9B 4YGVB 1P4IH 2KQMA 4JM4H 5MENE 3I75B 4OSUL 2GJJA 3GSUB 5F1SA 4DN4L 4YDLB 5E2VL 3SDCB 4X6FA 5C2BL 5JO5A 4JDVA 3GBNL 5DS8A 1HQRB 2PNDA 4OI9A 1N4XL 2H1PH 5T3ZE 2C3VB 3SDAB 2IQAA 4RFEB 4M1CC 5C0ND 25C8L 3D9AL 5JHDD 3GK8H 5J3HD 5ISZB 3UBXB 4W70A 1FFPA 4XHJD 1FIGH 1J0JA 3FONB 2XKUA 3WFDH 2AJ3A 2NY3D 1UJ3B 4LPXA 3BT2L 3L5JA 4PGBA 4MD4A 1OSZB 1UWGL 4U6YA 1V8HA 4JFZH 4P3CH 5B39G 4KTYA 1WUNT 4G8IA 4YFLF 5CSZA 1QSEE 5D9SB 3UTSA 4XHQA 4Z0XB 5HJ3B 4GAYB 1NC2A 4KUCF 5IIEB 3MBXH 1DN0A 1I7UA 3WNMA 5GGTH 5C0CE 1P4LA 3LIZH 3VWJA 3PJSB 2FGWL 4ZPVA 4OD2B 4J4PA 4LU5L 5EULV 4GRLD 4WW2B 4LOUC 2Y07L 2EO1A 1ROWA 4RX4A 3KPSB 1WWWX 4QXGL 4XAWH 5B21A 5I19H 3D48R 2CIIB 1CQYA 2CK0H 1WZ1H 3HNVH 1TJIH 1HQ4B 3I85A 4LLYB 4BFBD 1D9KC 4J3XA 1EVUA 3TA3C 3HNTL 4Y16C 4X5WB 1HOCB 1LVEA 1Z9MA 4KI5C 3L95B 5DVNA 3LHPL 1DANU 1YYMH 2PF6A 4H25B 3RWGA 3X12A 2MMXA 4DTGH 1F13A 1QLFB 1IILE 3CIQA 1L7TL 3FZUD 3GSVB 3MV11 4WJ5A 3MLXL 5DQJB 5IG7A 4JY5L 1AO7A 3PP3K 1D6VL 1PG7H 1QQDB 3SDAC 3RRQA 4Z5RA 3JV5A 3MRCA 3WIHL 1FLRH 1IQWL 3ZT7A 3EYSH 4HWBL 3DETD 3LQZA 2HYMA 3V6OE 3I6LD 1JBJA 4OD1L 2NX5E 3K4AA 3EYFB 2DBJA 3K81A 4WW1B 2DQEL 1R3KB 2N1KA 3B9KC 4OF3A 1C5CL 1LK3H 2ID5A 4QRTB 3JVGA 5ILTL 4YDVB 1CLOL 4U7KA 5KTEH 3X3FH 4FFWD 1A9BA 2VJXA 4BFGA 1GIGL 1P6FA 3C60D 3LV3B 2GY5A 4KJPC 2XQBH 4MDIB 4PP1C 1KC5H 4OGAC 1CFTB 2OSLB 5I30H 4PJGA 3NPSC 4G9DA 2HH0L 4X6CB 1MQKL 1PG7W 2VXTH 3D0VB 3RVVC 2NTFB 3O45B 4PRHA 1DBKH 3JWDH 4Q6YA 1P7KB 5L2KA 3ARGC 1N0XL 2BNRA 3P0GB 5E5RB 2NLJB 3DRTA 1YEHL 3T04D 4AH2B 1BFSA 5EFIB 5C0FB 3QQ4A 4NQEB 4M6MH 5EO9B 3L7FB 5HSFA 5EU7C 3LRGA 1TVHB 4Y5XC 5KVEH 3PWUA 2XI9A 5FUCE 4OKVA 4J6RH 2Q87A 3ARFB 5I1AA 4XZUB 1D9KD 2E6PA 4P2OD 1YEGH 1MI5E 3UPRB 4XVUD 1P9MC 1NBYB 5GRXG 2QQQA 3K80A 5D7SH 4LSTH 4I9WD 2PYED 3GI9L 4KWUA 4IEFB 4PGEB 4U3XA 4S1DC 3LD8B 2VWEC 2VIRB 3E8UH 4POUB 2EDJA 1BQSA 4X9HA 1BBDL 4PJ5D 4E42A 2AJVL 1LDPH 1M7DB 5E8DL 3AGVA 1UEMA 4WFFD 4IRJD 2UWEF 3P30L 3WLWD 5DZLA 2ZKHH 4J2XA 2YD8A 3OXRA 1WWBX 5CJOL 1HSAA 4Z76A 5JW3L 2EKSB 3OX8A 3G6JF 4JM2C 3ZSTA 1U41A 2ICEA 1I8LC 4PY7B 4LCWB 4R0LC 3WV0A 4YAQA 3GDBA 4NQTA 5I16A 4ZXBC 1M05B 1FPTL 2XWTB 3CX5K 1XGTB 3OF6A 2YUXA 4JDZA 1DJSA 1EPFA 2EDXA 4ODBD 5EB9A 4MB4A 4P49A 3BVNA 3UYRH 3K4DA 3W2DH 4XH2A 5E2JA 5DRNA 4YK4B 3HLAB 1YEEL 1NDGA 1GPOH 4GJTB 2OBGA 4RGNE 4KK6C 5D7LA 5ESVA 2X05A 3UZQA 2X9XA 3T0EC 1QSVA 5IUSA 2FX9L 4F58L 2R1YA 1JNHA 3TJHD 5DJDA 3VFNA 1P7QB 3HZVB 4E5XA 3JTTA 5KSBB 4FZEH 1WSST 3HPLA 4WUUA 1KJ2H 1QKZH 4LMQI 3LKQA 2YUWA 5LGHL 5EZIL 4YNYA 1WICA 3ULUD 4RGND 3CCHB 3QO1B 2IALA 1FHGA 3GB7B 3V4VH 2QTEA 4IRSD 3SKOB 5E5MB 3L6FA 4RWYL 2UVFA 1IC7L 3WN5C 4YDIL 5A3ID 2BNQB 1SY6A 5E7FA 1NEUA 5JNYB 2AXGA 3CH1A 3RVTC 3RKDD 4YQXL 3TT1L 4NJ9L 4KVNL 4DFHA 1OF2A 2OL3A 4KHXH 3AXLB 3U46A 4NM4H 4ZUWA 2EEDA 3HC3H 4M9PA 4PY8J 3P4OB 5C9JB 3MLRL 4JAMA 1S7RB 4WWKD 4KHTH 4GW4B 4N8VA 5I9QC 2PXYC 2F74A 4XC3H 2UUDK 2FATH 1YQ2A 1ZSDB 3C5SB 4M5YL 5H37H 1LEKB 4H20H 1WITA 2BJML 1MFDL 4TRPL 2A38A 4X83A 3U0WL 4YDJA 4NDMA 2NR6D 4XGZB 4P2RD 3K46A 4YWGL 4LFHD 5C7XL 1RIVL 2VZUA 2GUOB 3QULA 3ARDD 4PGJA 2XIDA 2MOVA 1UB5B 4GXUM 4OT1L 1F5WA 4NJAL 2A1WL 1YMMB 4DVBB 4KJPD 4AMKL 1ORQA 2J88H 1NDMB 3F7PC 2HFFA 2D03H 1I8MB 1KNOA 4LASL 4YUEH 4CU7A 2ZSWA 5C09D 5IM7B 3IFLH 4PD4K 3C8HA 4LLQB 1YEFH 4Y5VB 3PG2A 4GLRH 5CEXA 4K3JH 1OTTC 4YHPA 1J88A 1NGPH 4ODXA 2ARWA 3O9WC 2Y5EA 1T5WB 3L3HB 5IJVA 4OLXH 2DTML 2FX7H 5D70L 5DRWA 3MO1A 1OWRM 1UB6B 2ED8A 3ZKQD 5KAQG 3ETBF 3FRUB 2C5DC 1OOAA 2QSCL 1FZJB 4G80A 4HD9A 5SWSA 2P5EE 1LEIB 4HEPG 5E00B 5HHNB 4YR6A 5IOPA 3KDMB 3WCYA 1FE8L 1YEKH 4TSBL 3VWJD 5GIRA 4KPHL 3Q1SL 3TBTA 3MV9D 3RDTB 5J6GB 1S7XA 4TNVF 4BQBA 3ARGA 3SDXB 4G7YH 3STLA 5HYJA 5KN5B 4I48A 3TN0A 2AK1H 1E6JL 1RJLA 3WS3A 4CVZA 5EU6E 2A9NL 1NCAL 3RVWC 5EH1A 5CZXD 3VFPB 4FTVB 3O4LA 4TQEH 2FZ3A 3RX7A 4MNGA 3NVQA 2IBGA 3KXFA 1G0YR 2C4FT 1J10A 1VPOL 3RGVD 3WXVL 4XC1L 1Q9LA 4I48B 3TN0B 1HXYA 4B53A 4ZXBA 2EYRA 2XA8H 3P9MB 4JFDB 2EKJA 4UNVA 5DK0B 3MGOA 5BO1H 5MP6H 1MI5D 4Q9QL 4QRRE 2OTUA 4ZSOE 5GPRA 5JPMB 1LO4H 4HEME 1NMBH 5IOPB 2X40A 3IU4H 4P0DA 5ALCH 3SY0A 1VCAA 5I1DB 1BGXH 3DXAD 2FX8H 5E1AB 5ID1A 2GSGB 4K8RL 3MRKA 3QIBD 2OR7A 5L2KE 1JGUH 1Z3GL 3MO1B 5FDYA 5LXGL 4LSQL 5HI3C 2X7LA 2AV1A 2GEEA 5EA0L 2MCG1 4MCYB 4XMPL 2LVCA 5CEXB 5H37G 2JCCB 1P9MA 1KIRB 4GXUN 5E6IA 1CYGA 2VUOA 3WBDA 2X4QA 4PTUA 3EYUL 3K7UA 4QY8B 2ZSWB 4IOIA 1R3HB 3L5XH 5B4MD 1CBVL 2BVPB 1MVUB 2P8PB 3D2UB 3TNNA 5FIEA 3KPLA 5I1IH 3GMOA 3OTTA 1JGUL 1Z3GH 5LXGH 1ZEAL 2Z8SA 5DLMH 4K2UH 4U1IB 1UCBH 5GS1B 1R24B 3ZKNC 4UNTA 1CFVL 4NO0A 4MNQE 1F58L 3IU4L 5J12C 3BGMA 1I9IL 2IF7A 3GHEH 4PRHE 3RBGA 5DD0H 3TT3H 4FFVC 3M17B 4F9PC 3LRSA 5HVWA 2EIDA 1M7IB 4QGTA 1LD9A 1KLUB 4JFDE 2K1MA 4MQTB 1BD2A 2FCBA 4CGTA 1AGBA 1UWEH 4O9HH 2XY1A 1H0DB 2G60L 2KQNA 1LE5B 5AUMA 1NBZA 1RUKH 2F9BT 4XWOC 1R5WA 5AYUL 5T3XD 3AY4A 5B3JF 3WIFA 1BIIB 1YEDA 4ZTPL 2VAAA 4JKPL 4U0QB 1S7RA 3VXSA 2CDFB 1QFWH 5C9JA 4HKBB 3C5JB 2HJKA 4M7LH 1ZLVK 3KPRB 2HKFH 3AVEA 2VB5A 4PYGA 1AJ7H 3Q5OA 2OL3B 1OP3K 2UYLA 4WI6A 5IR1B 5K9OA 3MRHB 4PB0L 2ZCHL 2BNQA 3M07A 4CL7A 3KLSA 1DR9A 1H3XA 1ZHKA 4M7ZC 4R2GC 3QDJB 5DR5L 1OTTD 4JCMA 4GRWB 4OF0A 3RTQD 4JRYD 3T3ME 4KROC 5FECA 4G6ML 2AJYH 4LEXL 1ADQA 4ZYKB 1T66C 3QG7L 1II4E 3CCHA 5D6CB 3RI5F 1G0DA 2APBA 4XXCA 5DJAB 1XGPB 2V2TA 1A6WH 4WTZA 2XN9B 1MNUH 5DJ8A 3VFNB 3SKJH 1H3VA 1TTFA 2FJFB 1MFAL 3CPLA 1NSNL 5AYQA 3IGAB 3CLEH 5D1XA 3VFMB 1Q94A 5GS0L 5TE7L 3AS0A 5BOPA 1RURH 5TDOA 4AMKH 1GYAA 3K3QA 1MLCB 1KB5L 4L3EE 3FHAA 5E8NB 4BELD 2P24B 1XGYL 4PTTB 5T5NF 4C83A 3VA6A 4ODUB 1HDMA 1NCBH 3QQ3B 3NCEB 2D7QA 4YHLL 2XPGB 2VDRH 4P23D 1FH5L 3OG4B 2E5EA 3IB4A 3MCG1 4WEUD 5GRYA 1FV1A 3IJHB 3IDNA 1CN4A 4PJCB 2DQFA 4Y8DC 3CFIC 5MEQB 4TRPH 3B2VH 4OFYD 3IYLW 4LLUA 3QEQB 4NKMA 1PX3A 5HHME 5C07E 5KBNC 4PJBB 3G5ZB 5C92A 1UVQA 4YO0A 7FABL 1F3JB 1UZ8A 5I71B 5F6IC 3VDAA 5FB8B 4G3YH 1U8LB 2YPLB 4A2LA 5C0GB 2A73A 5D7IA 5FKAB 1DQTA 1UM4H 2CGRH 1VFAA 2YN5A 5FGCE 4IIQA 4LSPL 1Q0XH 4XMKL 1MAJA 2HMIC 1IEBA 4G6JL 1DLHA 3ROLA 4IHOA 3QXDA 1FORH 2OR9L 4KVNH 3DROB 4C58B 4UTAH 3HAEB 3BKMH 4O58H 4G6AC 5DMGD 3SKNB 4NGHH 5T3ZL 5TH2A 2EXYD 2YD5A 3ZE1F 1N26A 4YEEA 4XPGH 5C07B 4PJ7F 2OK0L 1WFTA 1BD2E 1A21A 4D0BA 3VFRA 4FQCL 1H3PL 3PDOB 4TVPD 3VGAC 1MH5B 5JW4Q 5D72H 1TTUA 2H32H 4PG9A 1PSKH 2Q7YB 1P5UA 2YEZB 3T2PA 3K4ZA 1QKZL 3T1WA 4HBCH 1S78D 2RCSL 4KJWC 1A1MA 1ACZA 3VXOB 1RFDL 1PVHA 1MJJA 3QUZA 5ETUA 4HPYL 3QWOB 4MB3A 4B5EA 4OZIE 3RIAK 3EAKA 2ICCA 3D0VA 4PIRF 1QRNE 3NCJL 1QNZH 2EE9A 4PJGB 3M8OH 5EBMB 4N1EA 1QSFD 3PP4H 1A3LL 1C5BL 1YNLL 2BSRB 2DDQL 3T1FB 4OZ4B 4YH6A 2M8XA 1RZ8B 4FQXD 1T66D 4K7PX 2DF3A 1N6QH 1PZUB 2YC1B 3TPUA 3C2AH 1IGJB 1L0QA 4HUKB 1DQJB 2E7LA 5L0QC 4K07A 1QSZA 2PO6B 3OR7B 4MJ4A 1OLZA 3QWRA 1IAIL 2X44D 1DCLA 5CJOH 4FP8L 3GRWA 1I3RB 3VFOA 3NMEA 4N0UA 3GMRB 1KIQA 4U1KB 4WHTB 2AJVH 4DCQB 1AXTH 5B8CC 1GGBL 1OP9A 5IG7B 4WJ5B 3PGCA 1C8PA 3CVIH 4ORGA 4LSTL 4UV4L 2Y1VA 1PJ9A 4CVUA 1J1PL 4F2MA 2DQIL 4W6WB 4X98B 5I0DA 1QZ1A 5DJ6A 4FS0A 2D0GA 2ZUQB 4ORGB 1NLDH 1CTNA 1HOCA 1CD9B 1U36A 3SGKA 3VW3L 3BISA 3E3QC 1YJDH 3OAYH 1XR8B 4LLYA 2IPUG 3SE3A 1PKQA 4BFEA 1ITCA 2IADA 3JZ7A 4N0UB 2O5YL 5LQBH 5IKCA 1JWMB 5JHLH 3ARPA 5F1NB 1VFOA 3VWKD 2I27N 4RMVA 4GKNA 2J2ZA 4HIIA 5IB2B 1F2QA 1NC4A 5IMLA 4CUCA 4GAYA 1X4XA 3OF6D 2ZNWA 2AJXH 2W0LA 1DQJA 3RI5K 5I30L 3ULVF 2VR5A 3TYGL 3C87A 4P3WA 4I18B 3SHSA 4ZUSA 1M71B 4MD4B 3X3FL 1X5GA 4ODSH 2EYSB 1OD7A 5T3XH 3B5HA 4LQFH 2PO6C 1L6ZA 4WU7B 5D1XC 4RBPH 4QYOA 3TF7C 3AAZB 5I1GH 3UBXA 3B5TA 2YA1A 4GSDL 3T0VA 3BIKA 1DBML 1OAXH 4MAYB 5HI5C 5HVHC 4QXTB 2IQAB 4HT1H 1KN4L 1RZ7H 4KAQH 4WO4A 3U36B 3SDAA 4M93B 4HG4J 3VXOA 3FKUS 3EOTL 5KSVB 1EGJA 4X80L 1QRNA 1WBXB 1GHFH 3ET9F 4L1DA 3HI5L 3RWHB 4G43B 3K8MA 5IEHB 2V9QA 1YJDC 4K23L 3RL1A 2FBJL 4ZPTA 1PG7L 1D6VH 1RULL 3I75A 5T5NG 5HGHA 3MLXH 5EUKB 5C07A 1ES0A 4IRSB 5EU7E 2YMXL 4R8WL 1WK0A 4EXPX 1A22B 3C5ZD 3U0TA 3FT3B 3CFJA 1JWSA 2F54B 3S4SB 5H2BB 2R0KH 4NKDA 5IB3B 4GW1B 1A6TA 3BZ4B 3VXMB 3MSPA 3QCTH 5HHOB 3FHQA 1MIMH 1MCJA 3IKCA 4OZHA 1TJIL 3HNVL 1WBZB 1PGRB 3T0AA 3JWOL 5DD3H 1F3JA 1UZ8B 2WANA 4NUJA 1CL7I 1GAFL 4HXBL 3LS4L 4HUUA 3MRBB 2R2BB 5KAQF 4XAKD 2GI7A 3PGFL 4AIZA 1RZKL 4LLUB 4WEMB 1BIHA 3LN5B 2Z31B 3KPOB 1A02N 2IANE 4EJ1C 3MBEC 1CLZL 3U6RB 1EFXA 2P5WA 4QHNB 1CD1A 5GRVK 1SVZA 5I18H 1JYNA 4X6CF 2DQFB 5INCA 3IJHA 4WFEE 3T0EE 4O02H 4OLWH 3TWCH 1JCKA 1MJ7L 4NO0D 3GMQA 4M7LT 3HZKA 4K94L 2DM4A 4TTGA 4ZOCA 5FYKD 2IANA 4JFZL 4P3CL 1TZHA 4GO6B 1LO2H 1BQLL 4N8CL 1NAMB 1T1WB 3BP5B 4P2RE 1KXVC 3MRLA 1Z6JT 3BN3B 3HRZB 4D9QE 5CCKL 4LSSL 3D39D 4O2EB 1FIGL 4K8RC 5TDOB 5KOVC 1S7VA 2VSCA 4FG6D 3GK8L 1FGNH 3ESUF 5HD8C 1X3DA 1H5BC 3U1SL 2I25N 4C4KT 3CPLB 4NO2B 3BZFA 2XACC 2CRMA 4MNHB 1XIWA 2AJSL 3TBVA 5CSBA 1S3KH 4TVPH 4OGXH 3NN8B 3MLPA 4R7DA 4UTBL 3A6OA 5D8JL 1EEZB 5FECB 2KL6A 5I76B 1F90L 2V2WA 5F88A 4MD0B 3NIDF 5A2KH 4HWEH 1A4KB 1T0PB 1QYGL 5IR1A 5TDNA 3U7YL 2UWEB 1A7NL 5JXED 2G2RB 4Q9BA 2VOTA 3WFHA 3KPRA 4Y2DB 5C86A 4HHAB 5ICXA 5D5MA 5HTSA 5HHVL 5FO8B 4ZOBA 2R2EB 3O9WB 3UJJL 1NGXB 1VEMA 3WJLA 2YHGA 1QFUH 1Q0YH 4ZD3L 3KPSE 1MFCH 5BQ7A 4NCC1 2ZUUA 2F5AH 4P5MA 5EU3A 3N1QC 3CDFA 5CUSL 3KPMA 1NGZA 1LO0H 3MUGB 1I1RA 5CGMA 2CQVA 2VLKE 5KVMC 3O4LE 3ZDYE 2PYFB 3FFDA 2E6QA 5C0BB 3SCMD 4MB5A 1AH1A 3NH7L 5D8JH 4MNQA 4Y4KD 2KZ1B 4RNRA 4OGXL 1G1YA 5DYOA 3ULUF 4JCLA 1KIPB 4LKXB 4S2SA 2H6PB 4Y1AD 2Z92A 1YEJH 2KPNA 1DBJH 2X89D 4OFIA 1I3GH 4QY8A 3WNNA 4PTUB 2X4QB 4C54A 3OZ9L 4JM2D 3MCKB 4L4VD 4M6NL 4JFEE 1WAAF 2DQDL 2HVJA 2G75A 4EI5B 5T3XE 4RGMB 2F5BL 5L8LB 3DVIA 1FNAA 3RNKB 3U0PA 1XF2B 3QSKB 5EU5A 2GJZB 4R4NC 4UUJB 1WWAX 5CP7A 1IFHL 1KJ3L 3BAEH 2HJFB 2XQYG 4N0CC 4G5ZH 4XP5L 1X9QA 1QACA 4YPJA 4KKCD 2LV4A 2A9MH 4NBZB 2Q86B 4I77H 4Z7WA 1MCEA 2IH3B 4NZUL 3O6LH 1ZHBB 5E9DE 4HWBA 1P1ZA 1A2YB 2JELL 4DVRL 2VLKB 2X09A 1T1YB 4RAHA 4AEHL 3U9UB 2NY6C 1WTLA 1Z2KA 1BHGA 4PJAF 1T1XB 5TE4H 2HFTA 1RZKH 4NRZB 5LG1A 3KXFB 3PGFH 4H1LG 1EEQA 3O4LB 4HXBH 1GAFH 4QRQB 4PLJC 3JWOH 5DD3L 5DJ2A 1FZKB 5ESQB 2FJHB 3QH3B 4F7TA 5DVMA 4FQJL 4IOFD 1RVFL 2K7QA 1J8KA 4WHCA 3IJSB 3ARGB 5KVDL 3SDXA 5J8OA 1PLGH 3NCYS 3BGFC 2J1KA 3MOBL 3BPOC 1UQSB 3VXNB 4U7SA 1NLBL 5DSCB 4E0RB 3C6SA 5J12B 2VXQL 4YXHH 2H9GB 3MR9B 3MOAH 4UIMB 2R0KL 4TNVK 3RTQB 2HRPL 4G80B 2HJLB 2K7PA 2XTJD 1U9KA 3GKWL 2HLAB 2VN4A 3C5ZA 4R8WH 4XPBH 1Z0MA 4KKBD 3T08A 1WIOA 2X4TA 3MRIA 5DRWB 5KSUB 4UBDC 1Q9WB 5DHVH 3WSQL 1RULH 1IL1B 3MROA 3QEHB 1VB9A 5SX4H 3FQUA 1DQDL 1LNUA 3L3IA 1KACB 4ONOA 4X80H 3KNBA 2VXSH 5D7LD 3QRGL 3C6LA 2JE8A 4EBQH 4BZ1L 3BWUC 1KULA 1UB5A 5I1GL 3E1F1 1QLEL 4PRDB 4RAVA 3T77B 3F65A 4KROB 5CILH 4NC2B 3WXWH 5K9KB 3VFVA 4PJGF 3RGVC 5TPWH 3UC0L 4YDJB 4YE4L 3QPXL 1XGQA 4OI8A 3ORJA 3QPQD 5DD6A 4P4RB 3P77B 1A6AB 8FABB 1A64A 1XR9A 1QR4A 4OCSH 1MREH 3QEQD 3MRDB 4YHKH 4KTDL 4CNIB 1G7IA 2JJSC 2ZCKL 2FGZA 4Z7QE 5HY9B 4D0DB 4N8VB 3OKKA 3DV4B 2OJEA 3QUXA 3VD4A 3T0EB 4JAMB 4YHIA 5BW7C 1CD0A 1AY1H 5FF6B 4G42B 5DEGA 4OLUH 4OI7A 3MNZB 3SDDC 1AI1L 5C0CD 5LBSH 1UJTA 1YJDL 1W0YT 2BHYA 4UDUA 4ZS6D 2VL5A 1F02I 1OF2B 2VLJE 1X5JA 3EGSB 2RAMA 1JZ7A 3HS0A 1J1PH 4GKOA 1T0MB 1U92B 1XF4B 3FN0L 5KJRL 1OW0A 3L1OH 5AD0A 3V0VB 4OZHF 2LABA 4OLZH 3VMPA 1T3FB 2QSTA 1CXIA 4WO4D 1ODAA 1OPGH 3QXTA 2X1PA 1BPVA 4N9GA 2BNRD 2XRAL 4NN7B 3PWPA 3QRFM 1C12A 3KR3H 2N7BA 1JNHB 4XBPA 2NY4C 1LO3L 2ZUTA 1EHNA 4MMXC 1BM3H 2VDLH 1NUFA 2IMNA 5BMFL 2JK5A 2B8OT 3G6AA 5I1KH 4QXUL 3RPIA 5K9QI 3GEWB 4X9GA 2JB6A 3O3DB 3D3VE 5HHPA 2XZAL 1MRDH 4LEOA 2P47B 4Y5XA 4FXKB 3W39A 1UYWH 3S96B 1FNSL 5EBLA 3VFSB 4NUGL 3NFPA 2BSTA 2AEQH 4JB9L 4I2XE 15C8L 2DQTH 2O5XH 5BVJB 1M05A 3FAXA 3DYPA 2V5TA 4PJ5A 4AEIL 1Q8MA 1CGVA 1EO7A 1CTOA 2AXHA 4XNQB 4YAQB 1UA6L 2QLVB 3PV6A 3ARBD 4I0PB 4WY7H 2WBJD 3OXRB 3QIUA 2MPAL 3N9GH 1RFDH 4IRZH 1WC7A 3V5DB 3V7AG 1G7JB 4FQ2H 2RCSH 5DEZA 3DECA 3TJEL 1ZVYA 4OCYL 5KS9E 2HLFD 2BY1A 1F6LL 4M4PA 4PGEA 4JY4B 3ZKXB 1AR2A 3PWPD 3MJGX 2P43B 1Q9OB 1L4IA 3RQ3A 2OK0H 3HE6C 1EFQA 1ADQL 1QLRA 3AS1A 3SQOH 3UPRA 3F58H 5L0QB 4QNPE 1R3LB 2R0LL 2ZJSH 1JPFB 4UTAL 3LD8C 5MEOB 1RK0B 3PWUB 3TJHC 1TVHA 1FFOA 5TE6H 2YXFA 4D9RE 4JG1H 2P5WE 4M43H 2QQNL 4XB7A 4Y0GA 3DVGA 3VXUE 1RMFH 2EDYA 2O5ZH 3NGBB 2PW2A 2W9EL 3C60A 4YHMH 4OD3L 3S96A 3ZHKA 4Z0BL 2WNGA 1NAKL 2CKBA 4UINL 3SO5A 5DVLA 5CKGA 1MCQA 4JFQA 3ZSSA 4APQD 1J8HE 4GOSA 4X7TA 3LMJL 2RB8A 2PR4L 3MV7B 2WP3O 1TLKA 2BDNH 3KWWA 4POZD 3LEXA 4OD3H 1XGYH 2NX5D 4TUKH 1J8HA 3B43A 4WW1A 2OMBA 3EOBB 3MNWB 2HTKC 4JZJB 1NGYB 5AZ2L 4GAJH 4GQPH 5TE7H 3NZHL 5C6TH 4P2RB 4M43L 3U79A 4P9MH 2DRUA 1TPXC 3B4NA 4K7PY 2P44B 1ZA3A 1NSNH 4YIQB 3RVUC 2GITB 1T0MA 2VLLB 1EO8L 3HS0B 4JRXD 1UFUA 5IF0B 2VYRE 1AGFB 1TMCB 5DQJA 1OL0A 5J0BA 4WWKC 5FHBL 3Q5TA 3QG7H 4XPAL 2VL5B 4UT9L 2V7NA 4G6MH 3RZCB 5DZOA 4DN3H 1AO7E 3MNZA 4HQQH 4KK8D 5CFHA 3TIEB 4C59B 3CSGA 2BZDA 4JGJA 4J4PD 4OCYH 1J0IA 4J3VA 5D96C 5ECJE 3CMGA 1R5VB 3P4NB 2CKNA 4HUXA 5DFVC 4TSCL 5GZNC 3N9GL 1FL6A 5C08E 1GZQB 3UROR 4M7LL 5J13B 1A6AA 3GSRB 8FABA 4KV5E 1RUML 4POZC 43CAB 5KS9A 4Q7DA 3GIVB 4WW2A 5J11C 1I3UA 2ADFL 3FT2B 4AL8H 3VWJB 4OJFH 3BUYA 1IJ9A 1T6WA 4RGOH 4PJBF 2VLJB 1JNNL 3WD5H 5ICYB 3DX6A 2XZAH 4BSWA 3I9GH 3MFGB 2P49B 5CSZB 2QQLH 2Z93B 2ADGA 2AGJL 2OQJA 2FSEA 3P0VL 3MGAA 3FAWA 5FYJL 4PJHB 5GGVY 1RUQL 2IBZY 2JIXD 1I9IH 4F33B 1HI6A 4FQ1L 1NANI 5C0AE 2ORBH 2OX5A 3C6LB 3GI8L 2W9LA 4NQDD 4CU8A 2H2SD 5I15H 5C08B 4AENB 2FL5B 5ID0A 1HYSD 4XI5D 4NNYA 3PHQA 3FQUB 3KR3L 4W4OC 5ALBL 1PG7X 4JE4B 4HG4K 5GRUH 3QXVA 1KTLA 4HWUA 4GG6F 1KPVA 5I8EA 1OPGL 4GKZB 3OJMB 3HAEH 3QI9C 2LTQC 4P9HH 1XF1A 1M6OB 2VZSA 5JO5B 1NMCC 4JQIL 3ZYOA 5KJRH 3FN0H 4PV9B 3RTQA 1D5MB 3GSNL 4UIMA 3FO1B 1IAKB 5EA0H 3OBAA 4JFEB 4A6YA 4F7PA 1A5FL 1T21B 4NRXB 5BW7A 4KI5D 1DVFB 3QIBA 4E41B 3QUXC 5E9DD 4PJCF 4PJ8C 4OLUL 4YC2C 1C16A 4JY6A 5H94B 3IETA 3SOBH 4WNQB 1LO4L 1NJ9A 3BH9B 3D2UD 3PQYE 1VDGA 2PCPA 1T1XA 2B20A 3T2QA 4L9LC 3AREA 4JQXC 1J1XH 2PTTA 2Z0BA 3GSNA 5L8JB 5HGBB 3HR6A 1F4AA 2D4DA 2GYSA 4Q6IA 3RVXD 4BH8B 3UC0H 1DFBH 5CBAA 3O6FB 4C57C 2E27H 2VISB 2Q86A 5GGVL 1NMAH 4KGLA 4M00A 2XWJA 3RY6C 2ZZUT 4LCYB 3ZKND 4X6DB 1NEZG 1UCTA 4EDWL 4KPHH 3MQIA 1QLEH 4OM1H 4NSKB 2C3WA 2XWBB 1FE8H 1CLCA 5J3HC 5I1JL 3ZDXF 1E4XL 3ZTJG 5D1XD 4EQ2A 5C0BD 3LVEA 3SCMB 3QIWD 5BS0A 2QSCH 3SE3C 2VXSL 2KUTA 2ATKB 1WBYB 3MRQB 2AEPL 5F44A 1RV6X 1KIPA 5BV7C 2ITCB 4XCNA 4PJEE 1OVZA 3TCXA 3FQNB 4HS3B 1J0YA 4JRYB 1FVDB 1OTUC 2HVKA 2VABA 2ZOLA 3S36L 4Y19D 2RFXB 1G7QB 3GKWH 2D03L 5DUBB 4F9PA 2X4SB 3NCYP 3VWKC 2FJGA 1U8QB 3H3BC 4EXKA 5DVOA 2QKIB 5GS1C 1QR1A 4GW5B 4OT1H 3RNQB 3SDDD 2XN9D 5IEKA 2Y4SA 2DLEA 3IDJA 1PLGL 5T33L 4JQIH 3DUSB 4Q2ZA 1U95A 5D4QA 4PJ9C 3L3GB 1IGML 3OXSA 3BZDA 4X8XA 4J7RA 5IK3A 3QUMA 35C8H 4OZFA 5IESL 5ALBH 1MWAB 4HH9B 4L8SB 2E7HA 1FYTD 3KXFD 3V6OA 4MA1C 2MKLC 1WFNA 2EE6A 3IXTA 5I15L 1CE6B 1A4KA 3LKOA 5MI0C 4HUVA 2BY2A 1QEWA 4MD0A 4NZUH 4RZCA 5GS2H 4NM8H 4C56B 3MV9A 3QUKB 4OCRL 5F7NC 5E4EC 3M1BA 1JNNH 1UACH 3SKUD 3WD5L 5BV7L 1ZT7B 1ZVHA 1IFHH 1KJ3H 5E8PA 4R26H 4MJIE 5ENWA 4PJ7A 4ZNCD 4AL8L 1FZOB 4LVNC 2RFXA 1U58B 3BZFB 4MA8H 3H9SB 1MHHA 3QCUL 5SWZA 3VRIB 1P4BH 1YY9D 5DDHB 1ZWIA 1BEYH 4M6NH 4P5TA 3OZ9H 5TF1H 1DBJL 1GRWA 1B4RA 4J3OC 3O0RL 2BSSB 4TSCH 1DEDA 4KDTA 3EFFA 1S7VB 4K7PH 5D2NE 1X6LA 5ERWA 5FV2A 3F7RA 3BRDA 2DL2A 5D7IF 4LSVH 2VSDA 4Y4KC 4K9EL 4PJIF 4O2CB 3TP4A 4JVUA 3IKKA 4XPAH 2ZUSA 4OIAA 3GMPA 5CIPH 4PJFE 2EICA 1AHWC 5T5FL 3H2WA 1H15B 1MCWM 3K8KA 1U8KB 1OGTA 1YA5A 1CD1B 1D3CA 4QHNA 2R1XA 4XVSH 4XP1L 1I7ZB 1MJ8L 2Z31A 3MJ7A 1IAMA 3ARVA 1QFWM 1UH2A 2R15A 3NBNA 5D2LF 3T8XB 3T0BA 3UJJH 4R4BB 1H9VA 4GAJL 5AZ2H 2C7UA 2PTTB 5D1QA 3OAUH 5A2IH 1RIUL 4NWTH 1KBGH 1MCRA 2R39A 3GRWH 3IKCB 2NCMA 2ED9A 4U49A 1YUHA 3IFOA 1EHXA 4NC1C 3JUYA 4AT6B 1OM3H 4RFOH 1QSEA 4QLRA 2EIZA 3HC4L 3U7YH 2J8UE 3IU3A 3E0GA 1YNKH 3QQNA 1G9NC 5CMAB 3E8UL 4R4ND 3QDJD 5FYKE 2C9AA 5C0AB 3WUWB 4NRXA 5A3IC 2FIRT 3D25B 4KI5E 4A6YB 3B2UD 2R23A 1U8OB 4XWGL 3VFWA 1S3KL 1N64L 4DGYH 3RL1B 1ETZA 3ULUC 4DAGL 4ZO7A 3DI3B 3HE7D 4J23A 5DI8B 1KSRA 4KKNA 3PQYB 3RWHA 3WNKA 1GC1L 4WFGE 3IF1B 1CGYA 3GSQB 4CAGA 2W0KA 4WO4B 5E1HB 1KPVB 4JG1L 2VQ1A 4M6ML 1B6UA 4JHAL 3BIKB 1FGNL 3OV6A 5JOFB 2F53E 5BXFA 2JJWA 4QYOB 3RFZC 3PHQB 3TFKC 5CCKH 4PJHF 4P2OB 4U1LB 4AENA 5L2KD 4E9LA 2EYSA 5C70A 5C08A 3W0WD 1M71A 1TVBB 4ZUSB 4ERSH 3CFKB 3A6CL 5IB5A 2VXTL 4F57L 2GFBA 4JN1L 4P4KD 1CXKA 4PJXF 3CFDA 3DRQB 2VLRB 1OAQL 2ADGB 2OQJB 2Z93A 3RWJB 4EUPH 1AP2A 4GFTB 1YECL 4B7LA 3OR6B 1GIGH 2YPKB 4Y88A 2GW5A 4PUBL 3QQ9D 4U1SA 5IMLB 1ZGLB 2E9WA 3IU3B 3S5LB 4HMCA 1BX2A 2EIZB 4R6UA 3F7QA 3IT8D 2WZPD 8CGTA 1U6AL 2VDOH 3FT2A 2F53B 4AT6A 5DRZB 4WV1A 1QFHA 2DQEH 1KT2A 3DX9B 4DWHA 5D96B 1UA6H 4PJEB 1L0YA 1FL6B 2C7UB 5D1QB 1IGCH 2ERJB 3P4NA 5TFSL 4M1GL 1CDCA 4JJ5B 2J12B 4X98A 4KZEL 2DMKA 2NY2C 1KJ2A 1UXSA 1ZV5A 4JKWA 2GHWB 3B8SA 1SJHB 1EHAA 1EX0A 4QF1B 1AO7D 4G9FE 4G6KH 4XCCH 2VDLL 5C0DA 3CVHB 1A7OL 4FOMA 3ZE0F 1IM3A 3A0OA 2HT3C 4LP4A 4R0LA 2GITA 4K3EH 3LHPH 4FFYH 1X5YA 4R97C 3I02B 5CJQH 1S7WA 4KK9D 3HI1B 1Q1JH 4KAQL 1RZ7L 2NY0B 2PO6A 1IT9L 1I1YA 1WZ1L 1XFPA 3KYAA 3EOBA 1JZ4A 4F7EB 4OV5B 1L6XA 5FGBC 4P4KC 5FCSH 3BQUD 4RX4D 4WU5B 3LEXB 5JDJA 4CVXB 5JXAL 3QWRD 2P8LA 1VERA 3HNSL 3MYZA 1I1AC 3ZT6A 2BSRA 1RZGA 2XOTA 1F4XL 3QUKA 5AZEL 5EBMA 4U31A 1OAQH 1X5ZA 4XNYL 1AY1L 4RZCB 1PFCA 4JN1H 4PRBA 2X4RA 3Q6FB 3FQRA 2NY5L 1H5BA 3QWOA 3CLFL 4WUKH 3AB0B 3V9FA 3IXTB 5KZCD 3T3PF 4CRPA 4JLRA 4DUVA 5JHLL 3SGKC 5IMOA 4IDJL 4ZS6C 1IAOA 3UAJC 2YEZA 4PG9B 5FYLE 1ZANH 1MH5A 3IVKA 2UZXB 3PDOA 3HR5B 4QHKI 3NCCB 4ZNEE 4OF7A 1FFOB 2H1PL 3FOLA 2HKHH 4MXVE 1PAMA 1FYHB 3W11D 3OJDB 3PL6B 5C0JB 3WXWL 4X4ZA 1JIBA 4JRXB 2AK4B 4XNMB 1DANT 3NTCH 1FN4A 3T0DA 1N64H 1MEXH 3DO7A 4JM4L 1P4IL 4LL9A 3BJLA 4GW5A 1Q9OA 3RNQA 4KUZH 5F8RC 4EBQL 4OCWH 3RZCD 4XVJL 4M61A 1IGYA 4X7DC 3X3GH 1K8DA 3MXVH 1VFAB 5E7BA 4CMHB 5T1LB 4X7EC 4LHUA 1DLFH 1FVDA 1DQDH 2A77L 1OQXA 2FD6H 5CGTA 1WC7B 4AK1A 5HI5D 2BOBB 5DTFA 1KG0B 4RFOL 4EN3C 1JYVA 4WWID 1WBYA 1F6AB 5SWSE 1PD6A 2R29H 4OTXH 1W72H 2Z31C 3WO4B 2BSTB 3F7VB 5IVOA 5EBLB 2L7JA 2V5MA 4YXHL 2OJZL 4OFYA 3JWOC 1HH9B 1XGUA 2P24A 5EU6A 5KVDH 3BDYL 1A3LH 1C5BH 3K2UH 3TBWB 2R8SL 2JK5B 2DQUH 5IVXA 2CDGB 2FB4L 1QNZL 3L5WA 4LKCB 3EYVA 2XY2A 3CVHH 4XBPB 5JORB 2XXMB 1IC4H 4GUPA 5A2FA 5TE4L 1S9WA 4LVEA 3UTTD 4JFDD 5I1EH 3WYRA 3JV0A 3DGGA 3RUGB 1PSKL 3T65A 3BHBA 3TV3H 1W0VB 3INUL 4CMMB 4XNUL 3BH9A 3V0VA 5AD0B 2XT1B 1S7SA 3ES6B 5H94A 3KGRA 4IMKC 2V2XA 1P4BL 3ZHDA 1JK8B 4OUUB 4XP5H 1DVFA 3QIBB 4G6AD 1XMWA 2BCKA 4JFEA 4UDUB 4E41D 2YKLL 3CNKA 2W65B 2FYYB 1E28A 4PR5A 4QRUB 2HJKB 5F7DA 4O2FB 5J7CC 2CGRL 1UM4L 4EN3B 4YHIB 2OJEB 3DV4A 1YEJL 2YA0A 1NBZB 2R1WB 4PJ9D 3GSWB 4HH8A 3WUWG 4CNIA 1PQZB 4M9OA 2FR4A 4NNYB 2R69L 3UYOD 1XGQB 3GGWA 2FL5A 4B41A 2E9JA 4LNRA 5FA3B 1AQKL 1BMGA 1ZGLM 3O6FD 4ZFZB 1EV2E 4NO0B 3EOAB 5IV2A 3B3IA 3MXWH 3NCBB 2GT9B 3BDYH 3U30B 4B50A 5JHDB 1MY7A 3HUJF 1NCBL 3T77A 2BRQA 1ZKAA 5D5MF 3UJIH 1TZGL 1A6PA 2F5AL 5ICYA 4GBXD 5FM5O 1QFUL 3EOAA 3SE8H 1YC7A 2DI8A 1R3HA 1A47A 3TBSB 2WQRA 4OTXL 4HJGA 3SO3B 2ESVE 3GIVA 1GC1C 3S36H 2HG5A 1WZMA 2P45B 1INDL 1UWXK 4JQVA 2JCCA 4MZ3A 4TNWK 4MCYA 3GSWA 3S37L 1G7MA 1IEAA 3PHOA 4JFXA 2EXYC 1R5VA 3AUVA 4JFFB 2VR9A 4L3CB 5JW5B 3MBED 1N3NB 2X41A 4NN6B 2HLAA 1CE1L 3TIEA 5I1LB 3SY0B 1JF6A 4EUPA 2FYYA 3HCVA 2W65A 3QDMA 4OCWL 5KSAA 4UTBH 3MR9A 4U05A 5I1JH 5E03A 1VGKA 1MEXL 2ZCHH 4P48A 1GGYA 2EDWA 4KDWA 1FAIL 4OUUA 2DD8L 3OKLA 5DK0A 5EO1A 2YD3A 4JFDA 4ZXBB 1JK8A 1J18A 2VLLA 5ESQA 4HIXL 2HKHL 1ND0B 1ZA3B 4YIQA 3OKDA 5F7EL 3ZTNL 1ZT1B 5L2JA 1HE7A 1W0VA 3BHBB 5AYUH 1RUKL 1RJLB 4CVZB 4WW2C 4OZGF 1EEYA 5HYEA 3GMNA 3VDCA 4LARH 3TBTB 1BQLH 2NXYB 2HA1A 1JPTL 4X9IA 2ZCLL 2NY5H 3HG1E 5DD0L 2CDGA 3L5WB 4PRPD 5E00A 5HHNA 3BXNB 2VC2L 3ZDXE 1N5YH 5JTWA 5TQ0H 2AK4E 3HNSH 5ADPL 4ZQKA 1NFDE 3U0PB 4X6CE 1XF2A 1BVKA 1CICA 1CDHA 2ITDA 1T5WA 2X9WA 3L3HA 5H8DA 5IJVB 4XTRC 4PGCA 2IAMD 3LS4H 4LDOB 5JZ7D 5SWSD 2I9TB 3EDDA 2D0FA 1IT9H 4OCMC 2I60L 4P9HL 1YPZB 1I8MA 4ZAKD 1F6AA 2YD4A 3TFKD 1JRHL 1NDMA 1ORQB 1GGIL 4LNVA 4HS8H 1YMMA 4XMPH 4JKLA 3KLAB 2BOBA 4P2YA 2Y7QB 4LSQH 1LP9B 4MAYC 3DSFL 4L5FL 4UBDD 4HSQA 1JPFA 1AGCB 5D1QC 4IBLT 2EH8L 3P4LA 3DYMA 4YHOL 2ORBL 2VRAA 4XGZA 1WAAA 1CT8B 4O5LH 3AMKA 3MLVL 5DUMH 4FZ8L 3MUGA 4AY0A 3P0VH 2QQLL 4JY4A 1ORSB 2EC8A 2APWA 4JKKA 4CBPA 3CC5B 1G9MC 1MSPA 4MDJA 1NGXA 4KDVA 3IAGC 3QCVH 5EO0B 4Z7VA 3SEPA 3O3BA 1YDPA 3QUZC 3VJ6B 3QIUB 3HR5A 1BOGB 1JMZA 4MHHI 1E27A 4RFNB 4LCWE 1IAOB 5C3TA 4BM7A 5IMOB 3LS5H 2G2RA 2YS4A 5E2UH 2WLZA 4M1DL 3PWVB 4OZGB 4PJ5B 5TDNB 4X9FA 5HDQH 5GS3A 3VFSA 3QI9D 1AKJB 1JP5A 4HGWB 4PUBH 3Q6FA 2FHBA 4G9FD 5GSRB 3O41A 1JNJA 1N0LA 2AJXL 4R7DB 4UT9H 3MLWL 2YBRA 4IM8A 1HYSC 2PO6D 5AG9A 5FUOH 3TBVB 4CVXA 4U1JB 3HE7B 1NGPL 3HPLB 3RZWA 3S3PA 2P5EA 3QDHA 3EUUA 3KPQB 3GMLA 1C12B 3PWPB 4N9GB 3FQTA 4LASH 5D7LB 3WO3B 3BO8B 3HLAA 2AV7B 5HYJE 1Z0NA 4DZ8A 4LPYA 4NQXA 1T4KB 2Y5TA 1NAMA 1T1WA 4R0LB 4DAGH 2DQCH 1SQ2N 4HZLA 4RRPG 1T5XA 4UV4H 4HGMA 2VLRD 4S1SL 2PR4H 5KANG 2YRLA 4L3ED 5SWQB 4UINH 2BJMH 4H20L 2EKSA 3HC4H 3I6GA 3RVWD 2X4UA 3OKKB 1FNEA 1OM3L 3U9PH 4ZUTA 3Q5YA 4RFNC 4XC3L 3KLHC 3MODH 4MVBC 4PJEA 1RMFL 2VIRA 5DZNA 4YFEA 1KT2B 3DX9A 2I07A 5DD6B 4CN6A 4WFGD 2E7BA 3VXRB 4LPUA 3FT4B 4KC3B 4LF3B 5TE6L 5EOCH 5MHSD 1N6QL 4GW1A 1Z5LB 1NBYA 1V7ML 1MJ8H 4XP1H 3LDBC 4U1SB 2YPKA 3MRRB 4WGWB 1G6RH 3U0TB 5I1AB 4RAVB 4UT6H 4PRDA 4X99A 3NAAL 3CFDB 4PLKD 5DJYB 3V4VL 5HGHB 3FMGH 1JJUA 4AQ1B 4YBQD 4NQCD 4Q9RL 1BJ8A 4X7CC 3DV6A 4QTHB 4G43A 3KJ6L 2P46B 2BNRB 4POYA 5DXWA 5CGYD 5J4MA 3TJEH 1WBXA 3KJ6H 1OP5H 1AFVL 3VI4E 1YMMD 2K3TA 4FQCH 4OQTL 3F12A 5EORH 1T80A 5I74C 4G9DB 1BEYL 4P5TD 3AAZA 2OSLA 4JFPA 2PYEE 5T3ZH 3C5ZB 4NGHL 3W2DL 4KK5C 4AEIH 3UYRL 4O58L 3PQYA 2AEQL 2W07A 4JB9H 4BYHA 5DI8A 3TA3B 4R26L 1FNSH 43C9B 1UACL 4DFIA 3FB5A 1U8OA 2R23B 1FORL 4L1HA 1NCWL 1UQSA 3P0YH 3VXNA 1Q0XL 4N5UA 4EI5C 3FB6B 1I8IA 1ONQB 3EYFA 5CMAA 5DMGC 4R97B 5I1KL 1UKSA 5MHSE 4UOJA 4GKNB 4WGVB 2Z8VC 2WBJB 5JW3H 5FGSA 4H88H 2R2CA 2ZKHL 1LO3H 4X6BA 4JO4H 2OM5A 5IKCB 4I4WA 2XTLA 2IADB 1MCWW 3HG1B 1TFHA 1MUJB 5C71A 2YZ8A 1P1ZB 2E7MA 4S1SH 5K93A 4OLZL 2GTZA 4OBSA 1ZHBA 5C08D 2YPVH 2FH6A 3MJ7B 3L3KA 4Z7WE 1LE9B 5T33H 4YEFA 4H25A 1S9VB 5HYSB 2HRLA 1I7ZA 4QRPE 1L9NA 4K3HA 1Y6MR 2FHCA 5FYLH 3O6ML 3SDDA 2JLLA 5IMKB 3RWFB 4UUJA 2GJZA 3LKNA 5EU5B 5JHDE 3EJZD 5TDPA 1FO0A 4M5ZL 3ISWA 3IAQA 4JZOB 5SX5K 4DK3A 4PY8I 4O2CA 3LKPA 2CIIA 3RDTC 2Q8BL 3JXAA 4HDIA 3DXAB 3OHXA 4DJMA 3VFOB 1I3RA 3DO3A 2Z92B 1X5XA 2BRRL 2BSSA 2ZCKH 4ZAKA 5IIEA 3SGDH 3V0AC 3ZLQC 2G5BB 2HH0H 3NIDE 2AJYL 3G5VB 2HTLC 1T0NB 1IGJA 1MHHB 5SWZB 5DR5H 5C0BA 2XQBL 5FO7B 1QSED 1KLGA 3HI6H 3G08B 3V8OA 4LPTA 2EDRA 4I8DA 5ENWB 4PGDA 3V5KB 5HDQL 1OP3H 4PS4H 1MCFA 1NC2D 1UENA 5E2UL 1NGZB 5GGTA 3B9KD 1MFBH 2E27L 5L6YH 3RWEA 4PRPA 4U1GB 3DVNA 1T04A 2CRZA 4H26A 3O9WA 3QCVL 2BOCA 4YXLH 1EH9A 2OLDA 5FO8A 3F62A 3UTTB 1FLRL 3MJ6A 1IAIM 4L8SA 4HH9A 4PG2A 4H1LA 3SDCA 5CEZD 4BQCA 1CQKA 4OZFB 3HC0A 4QGYA 3GSUA 2CDEA 3QUMB 4RWHA 4D0BB 3KS0H 4D8PB 5DURB 3IDGB 3MA7B 4O5LL 2AJUL 3SOBL 3VU2A 3SDYH 5I8CA 1CD8A 1WQVT 4LDLB 1OARL 2EH8H 3VG9B 4Q2ZB 3DUSA 2HRPH 3VRJB 3QXWA 2XG4A 3ULVD 1JHLH 1MOEA 2XICA 2F19L 3MOAL 4Y4KB 3VRLE 3DROA 3NN8A 1MCNA 2E8ZA 3QXDB 2PW1B 1C5DA 1DLHB 3D85B 4JHZA 3P3YA 4ODWA 3AROA 2FEEL 1U8QA 3ARWA 3DURA 3H9ZA 4IIQB 5DC4B 4DGIL 2X4SA 3L5XL 5DUBA 4HX1A 4UAOC 1RVFH 4NO2A 3QG6A 1KB5B 4M8QB 2CMRL 5IW1B 4HUNB 4YO0B 3SDCC 4EI5D 3OKEB 3NFSL 1MPAH 5J1TC 4OIBA 1BWWA 5F7FA 2ESVA 4Z7OE 3LIZL 1G9NL 1G7HA 4OV6F 5ADPH 3VH8G 3MRLB 3VRLF 4PJCA 3IDMA 3IDNB 1JF5A 1BLNB 4OAWB 5HYSG 3VXSD 3O6LL 4JFHD 5HDBE 1OAZL 3DTXB 4IMLB 3NA4A 2XWBA 5FYJH 2ZCLH 4OAWA 1HDMB 1JPTH 5DD1H 4U6TA 4FQXC 3BT2H 3IDMB 1V3KA 2N4IA 4I18C 3BIAX 2XWJB 3MRGA 4GAFB 5IROC 1ZE3C 3O6FA 3IGAA 1RUMH 4NUJB 2AERT 1N4XH 2MFNA 3QG6B 1WBZA 5F9WC 4LCUB 4WHYH 3LKSA 2XN9A 3G5XB 3QNXB 3MJ9L 1SHMA 1FAIH 4WENB 4ODWB 1C5DB 1J11A 2PW1A 3D85A 4OSUH 5D6CA 1YEKL 3VXMA 3BZ4A 4I0PC 1A6TB 5KSAD 1C16B 5BZDB 5H2BA 1ZS8A 1CFNB 5DMJB 3HTLX 4DN3L 1ZLVH 3DYOA 3BWAB 3D3VB 5GRVL 3MZTA 4XCFH 3VG0H 5EUKA 3KLHD 3IDGA 2VKWA 4D8PA 5EZJA 5MENB 1VEOA 2VE6A 1IAKA 2ARJA 1D5MA 1EO8H 1OB1B 1YEFL 1NFDA 1E0OB 1NCCH 4DZBA 3UTTA 2IAND 4P9ML 2VAAB 2BOCB 2NW3B 3KG5A 4KJQD 2CK2A 5K33A 3N0PB 5AUMB 3SE8L 3ROOA 4MXQC 2Q3ZA 1WGOA 1KTLB 4OF5A 5ISZE 5F6IB 1F8TH 4Z9KB 2Y06H 1LD9B 1TZGH 3DMMB 4F8QA 4WU7A 4KKLD 4LP5A 5FYJD 2EZ0C 1BZQK 2BDNL 4Y4FA 3MXWL 3V5KA 3B9DA 4F33A 4YDKH 3LMJH 4QRRD 3OB8A 4NKOA 3F7YA 5D2LE 5C6WH 5GS1A 4TTDD 4PJHA 4RMRA 4S1RL 4ETYA 1XIWC 2R69H 1T0NA 1BBJA 1MFDH 4LVNB 3Q6GL 3UX9B 2G5BA 1NAKH 3DX6B 3MRPB 2VLJA 1WZLA 1MVUA 4YHML 1DQLH 1FCCA 2AJSH 5FUZL 3F8UB 3C8DA 1RQ5A 1JNLH 1T83A 3C08H 1KGCD 3VGAB 5GGUB 1J5OL 4U1MB 2J4WL 4F9LA 2NY4D 2BX5A 5DGRA 4V1DE 1KLFA 1GZQA 2YKLH 3NA9H 4KHXL 4TTDC 4I0KA 4HUXB 4L4JA 1FO0B 5TDPB 1F4WH 2ZJSL 5D93B 5IMKA 3SDDB 3VXRE 5E1AA 4P2QE 2X1QA 4N8CH 4YDIH 3SQOL 1IC7H 3QHZL 4G8GA 1D6EB 4LGRB 3S6CA 4OLEA 1BF8A 3WLWC 4O51B 5BRZA 5I1HL 4OLWL 4O02L 3TWCL 5EZIH 3GJEB 5LGHH 5F1IA 4F15C 3MYJB 4NKIH 1HHIA 4KRPD 1CDIA 4PJFB 3IJYB 1ZLWK 3GMRA 3VGEA 1CVRA 2DJUA 3FRPA 4N0UE 5FKPA 4D94A 3CVHL 4MNGB 4X6BB 2FZ3B 4YZFF 1J7VR 2WBJA 3QIUD 1JHTA 3DMMC 3BW9B 1PYWB 3SJVE 1D7FA 1GPOL 1YEEH 5D2LB 3P9LA 3MNVB 2C26A 1EXUB 4G6FB 4APQA 1QHPA 1ONQA 1MELA 3D69A 1I8IB 4NRYB 2WINA 3RDTA 3TPUB 3FO0H 2YC1A 5GIRB 4MXVF 1INEH 1MRDL 3THMH 5JR1L 4R90L 1W0WB 1QSFE 4GS7B 1FPTH 4BK5A 3T1FA 4KTEH 1T7VA 1W72L 5F72S 4QXUH 4KI5F 3ILPA 3EYOB 1U93A 4K23H 1MJJB 3QUZB 4OGZA 4OGAD 5MEPB 3SE4C 3HI5H 3VA2C 2J6EH 3QO0B 3QUYD 4XX1E 4PV8A 3D6GA 2C3XA 3RY4A 1KNOB 3EOTH 1U3HB 3MXVL 5D93C 4XVJH 4HT1L 1OAXL 5DJYA 3L1OL 1REIA 4X99B 4NQCE 4HIHA 5TH2B 1W72A 3NTCL 2UZIH 5T3XL 4P3DB 1S7UA 3R06B 1I9EA 2AEWA 4JFOA 3KHQA 5KVEL 4Y4HD 4LF3A 3FT4A 3WHXA 1IEBB 5LBSL 3SJVB 2ZUWA 2ZG3A 4HKJB 4IJ3C 1YEHH 2LQRA 4X8JA 1N0XH 3QDGB 1E4WH 3H42L 3QUXD 4PBWD 5EBGA 2QEJA 3ZE2F 3RUGF 3G5ZA 4GW4A 2V6HA 2X4UB 4YHKL 1U42A 4OCSL 4NKMB 1OAYL 3FQWA 3S9DB 2W38A 4WUUE 4I0PA 5HHOD 2FIKB 2Y6SC 1J0HA 1UXWA 3HUJB 4YE4H 4XNQA 3LKRB 4U4BA 1FFRA 2VQUA 3AXLA 1FV1B 5TPWL 3V95A 1NLDL 2R9HD 3NFPB 2GQHA 5ILTH 4Y16B 1FQ9C 2DQIH 1NFKA 5F89A 4ODUA 1X4ZA 4PTTA 3L6FB 2DJ4A 2EC9U 5E8NA 3GB7A 1TQBC 3Q0HA 4OFVA 1OP5K 4NQCB 4N0CD 3TBYA 4MHHG 5CSGA 5FGBA 2WV3A 3PIQB 5E99L 1TCMA 1KIUA 4WUUB 2APXA 4HV8A 3JTTB 1AXTL 5DJDB 3GMLB 4R2GB 1JYXA 4NQUA 2R1YB 2P5EB 4HV8B 4LRIC 2D9CA 3ZDZF 1BFTA 1IAIH 1X5AA 3F6LA 4G6KL 3TBYB 4NQCA 3EFDL 4XPBL 1L7TH 2YBRB 4DTGL 4N5EC 4OFDA 1JMXA 4OIIH 4C4KO 4M1CD 2HTLD 4R90H 3O6KL 4KXZH 2VXQH 4LHUG 4UB0L 3V4UH 1AHWA 4M1GH 5K9OB 3F7VA 5A16A 3MOBH 5SWZE 5TFSH 2XWTA 1GGUA 3HNTH 3IDYB 3N1PC 5I16B 3PP4L 3TVMA 4FQJH 3AC0A 3M8OL 4LCWA