2K7PA

Filamin a ig-like domains 16-17
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
188
structure length
188
Chain Sequence
GAMAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Filamin-A
publication title Atomic structures of two novel immunoglobulin-like domain pairs in the actin cross-linking protein filamin
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k7pA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k7pA01
5BO1L 4KVCH 3MLSH 3STLB 2PETA 3QUMA 3QCTH 3PG2A 1X9QA 5C3TA 3DGGB 2G5RA 5C07B 3D5OF 1WF5A 3LY6A 4X7TB 4NQSB 2FGWH 1F00I 3LS5H 3O2WL 1EZVY 4K7PH 3V0VB 5GGSA 4PJBF 5CBEB 3ROOB 3BYTA 5EBLA 4UTBH 4OD2A 2EE2A 1G6RH 3M45A 4NKOB 1IGIH 5L7XL 1YEGL 3H9SA 3LDBB 4BK4A 5HGDA 4GMTL 4FQXA 4Z7VF 4NUJB 4MZ3A 3QUML 1XGUA 4G8IB 9CGTA 3Q5OA 1PW3A 1P1ZA 4HBQA 5BMFH 4N1CA 1UVQB 2R23A 3I6KA 4P2OB 4RNRB 5F3BB 5GHWL 2NX5D 5EOTA 1N3NB 1U2HA 4G8EB 1P2CA 3B9DA 5E56A 5A40E 3QUXC 3K4DA 5I1EL 1X44A 3KPPB 3VXME 3AMLA 1TZHB 1WIOA 2OL3H 3Q6FA 2VE6A 4YBQC 4RMTA 3GB7A 2CH8A 5B4MD 3HG1A 3PNWA 3NIGE 3KPMA 4U1HB 2XPGA 1BF2A 1S9XA 5C0CA 4OLEA 2VL5B 4QRSB 3WFBL 1U92A 1ZHNB 1RIVH 2HWZL 3GMLB 1I4FA 4WHDA 5F8QC 1T2QH 1ZTXH 4LHUA 1EO8L 1S8DA 2WLZA 2PW1B 5C0ND 4WUKH 2MKWA 1XR9A 5H94A 2R0KL 2ZWLT 1FVEB 4XMKH 5HVHC 2GUOA 2IH3B 2ICWA 3RWHA 4OCMC 4OLZH 3K0WA 4WY7H 2NNAB 1FE8H 2VL4A 2HT4D 3IDMA 3VRIA 2DI8A 4X6DF 3BAEH 4HEPG 4YK4C 2XZAH 5EA0H 3NGBC 3HFMH 5LJYH 4YQXL 4R7DA 4PB0L 1D5ZB 1RUKL 5D1ZA 4DGVH 1MHHB 5FAAA 5JNYA 3ZMRA 1NC2D 1P4BL 3KHQA 5EULV 5IB3A 1GZQB 1VGKB 2E6QA 1DFBL 1ZHLA 4K3GA 1QR1A 3GSOB 3F7YB 1M6OB 3UC0H 1H3UA 5H2BB 3WUWG 1QHOA 5HDBF 1RJYB 3SDXB 1HHKB 3G5YB 4IRSD 4I18B 5ETUA 1MIMH 3RZCD 4FQIH 5KVFL 4F8QA 1U8QA 4HPYL 3TO4C 4UB0L 1D6VH 3C8KB 4LCYA 2H3NB 2H45A 3UPAA 4KRNA 5IV2A 1I9IL 3GIVB 3DYPA 4FN0A 4TSCL 2VN4A 3BKCH 4QOKB 4DW2L 2BSRA 5B4MC 4Y19D 1CD8A 3ARGB 2R29H 4NN7B 4CN1A 4DZBB 2LAGB 5FM8A 4X4XA 3DETD 4Y4HB 5EO0B 4BH7A 1KIRA 1DN0A 1G1CA 5DURB 4MNGE 4JFOB 3JV0A 3WBDA 5I1AB 3QRFM 5C09B 3CFKB 2HH0H 5ELIA 3V4UL 1AI1L 3PP4L 4LIQH 4GW4A 3ARVA 1JGUH 3VXTB 4JO2L 3PL6B 3QUYC 3NIFE 4WHYG 3DROB 1WV7T 1GGIH 2UWEE 2HT4C 4OLYL 4PJEA 1CGTA 4GRMA 1KENL 3MV9A 5E6ID 5F9AC 4DEPC 1CS6A 5E00B 3QCUH 6FABH 1CLYH 2MQ0A 4HV8A 4GLRH 1L0QA 5MP6H 1C7TA 4OCYL 2J88L 3T8XA 3LS4H 1IGCH 1J1XH 3L3KA 4EUPA 3VRLE 1I3VA 1IGFL 1TQBC 1U41A 3DVNA 3KYOA 2MQ3A 3N1FC 4NRZB 5L2JB 1CZ8L 1ZAGA 4F7EA 4NRXB 2J6EA 2M1KA 5CSZA 5L8KB 3QXVA 4QCIA 5I1LA 3T3MF 3D9AH 4AEIL 2ATKB 2EE3A 4PJHE 4R9HA 3ZYJA 2R69L 3RZCC 1IJ9A 4KXZI 2EYTA 4P3DB 3V6OA 4JRYB 1AIFA 2KBGA 1JRHI 1FYTD 1KJMB 3DARA 3TJHD 5F9WB 2Z91A 3PABA 4MA7H 1G7IB 3JV4B 3VWKB 3TYGL 1CLOL 4NN5C 2WP3T 3VCLB 3U36A 1P9MA 4HKJB 2PYEB 3QIWD 5IM7B 5HHNA 5INDA 1A6ZA 1MPAL 2BVOB 4MQXC 1K2DA 4ZUWB 1FH5H 5ISZD 2LV4A 2J6EL 5ALBL 1AGBB 3DIFA 4MA8H 5GGUA 5HTSA 3SGJA 5K9KA 1I85C 4PJBE 5D7IB 5EC2A 4ZUTA 3U1SH 2KQNA 5TE7L 4NKIH 4YZFF 5DGRA 1MLBB 3SY0A 1FNGB 1IC5L 2QJDA 3PF2A 2VXQL 2ID5A 3F12B 4JKWA 1UB5B 5E2WL 3DX7A 4YDJA 1CXIA 2VO5A 2DOCA 2FR4B 4UBDD 3QI9B 2H1PL 2GT9B 3SGDH 4M1GL 5FF6B 4OCXH 3D69B 3HNVH 5I0ZA 4OGYL 1SMAA 4UIMB 1K4CA 3DMMB 1CDHA 3K74B 4JCMA 1G9MH 5FHAL 3QP3A 5AZEH 2RCSL 1I8IB 1CF8H 1YEJL 2XOTA 2VLMD 3IS1X 2J2ZA 4ORZC 1VDGA 5HYQB 1X6NA 1OLLA 2IANA 5FUOL 3EYVB 3S37H 4QHUB 1AGCA 1XIWD 2ADJB 4WCYL 1CBVH 3O9WA 1D5XA 5HI4C 5TGBA 5MEPB 4UV4L 3MXVL 3MOQA 1A21A 1IGJA 1GAFH 2PXYC 1VPOH 3NCMA 2B0SH 2OK0L 1S7RA 3GM0A 3W9DB 2HKFL 2Q3AA 5ESQA 3OJMB 4ZOAA 1RZIA 5DHVH 5MENE 4KAQH 3G5XA 1T22B 5AAWA 1G7LA 2ADIB 2GTZA 3WFCH 4FQQB 1AE6H 3TJHC 2BSTB 1MEXH 3RAJL 3SO3C 1RUQL 5HHMD 2D03H 1INQA 3PGFH 4RWYH 4HIEA 2FBOJ 2NY2C 4X6DE 1B9ZA 2KZWA 5SX4H 1ZHKB 4GXVL 4I13B 4NQDB 5CD5D 4HUWB 1G7PA 3S88H 2J4WH 3BIAX 3M07A 5T1KB 3FMGH 4QNPF 1CLZH 4DFHA 1E4KC 3L7FA 2C7UA 5T1LA 3O2VL 2Q7YA 3CFJA 2V5SA 1U93B 1YYLH 4NQXB 1ADQA 5HDBE 4KZDH 2QQLL 1KIPB 1YEDB 15C8H 3T0EE 5CWSB 4Y4KD 4X6EB 4UBDC 1SJEB 3CFBA 2OMBA 4EBQH 4Q7DA 1YEIH 2EICA 5CBEA 1FNEB 4OV6F 1KN2L 5FGSA 5D2NE 4DKFH 5ABDE 5IQ7H 3C2AH 5E99L 3CIQA 5IW3A 1JNLH 4BZ2L 3PJSB 1HWGB 1G84A 3ESUF 4ZNEE 2NY1D 4LSPL 5I30L 2V6HA 4HIXL 4U1SB 4DWHA 5L9DL 4JM2F 2BC4B 2XFXB 3CDCA 4HUNB 3HR6A 1ADQL 1XIWC 3QG6A 4LEOB 1P69B 4P2OA 4RNRA 5F3BA 4YNYB 1WWBX 3QH3B 1N3NA 4G8EA 3QRGH 4DGYL 2A77L 3QDMD 1HCFX 4NWTL 3D85B 5DUBB 4EOWL 2XTJB 3I75B 4P2RA 4GJTB 4U1HA 4UNUA 3OBAA 4V1DE 3I84A 2VL5A 1QZ1A 4QRSA 4Q9QL 3B2VH 3QUXB 3MRKA 1BD2D 1V3JA 3GMLA 5DT1H 1RZKH 5F7LB 3PE9A 2YKLL 4U2YA 2F5AH 4DUXA 3GSNB 1CICC 4N9OB 4HX1A 4PJ7B 5ACMA 4IEFB 1J18A 3S36H 4R0LA 3P9WB 1A4JB 4DN4H 4TQEL 1FVEA 5DUMH 3JTSB 2LAAA 2DBLL 2Y72A 4LEXL 2CGRL 2J3SA 4IDLA 3RGVA 2A2QT 2AAVA 4MXQC 4GBXA 4LPXA 3FTGB 3TCLB 3T3ME 1F8TL 1WFOA 5HVHB 1XF2A 1DR9A 3Q6GH 4Y4KC 5JTWA 2MCPH 1XF4B 3OJ2C 1AGDA 4L3EA 5D1QC 3RWFB 4PLJC 2IADA 2YPLE 1MHHA 1SY6H 4YK4B 5JW4R 3WO4B 7FABL 1QSFA 4U4BA 4ZUUA 4FZEH 1VGKA 4H5SA 5L8LB 5GGRA 4JY6B 2ADFH 4JFQA 3F7YA 5A2KH 4L4VE 3SJVA 1M6OA 3TH2T 1VERA 5H2BA 4WW2A 3GDBA 3MNWA 1RJYA 3SDXA 4PJGA 5EBWB 3O4LE 1BZ7B 3GEWB 2EDQA 2EXYD 2FX9L 1QA9A 5E2UH 1DZBA 1UM5L 4PJIE 1EEZA 1UWGH 4RMSA 3UTQB 4KKAD 4YZFE 1T04B 1GXEA 4QRPB 2CDEA 1B0RB 5CZVH 5EU3A 3VFVB 1M71B 1PQZB 5I76A 3GIVA 3UBXB 2AGJL 5J3HC 1V7ML 5DFWH 2X44D 3ARGA 1QYGL 5DDHA 2I26N 1HILB 5F3HB 4CAGA 4Y4HA 5EO0A 2EC8A 1INEL 1CK0L 4QWWD 1PEZA 2ZUQC 2Y9RT 4JY4B 1I8LA 4JFOA 5I1AA 3D1MC 4HIHB 5I73B 5HD8C 4DGIL 1YEEH 3CFKA 1KFAL 5FYKL 5L7XH 1YEGH 4GMTH 3VXTA 1BQHA 3PL6A 1JZ5A 3DROA 1UGNA 1Y0LA 4LNRA 2BVQA 2D7OA 5I19L 4EI5C 3KLHC 5DMGC 4RDQG 3X3GH 5DTFB 1S9YB 5D70H 3HCVB 4MYWB 3DX8B 3VXMA 1E6JL 4CMHB 5JXEC 3CVHB 1HYRC 1ORQA 5KVEH 3TF7C 1I1CA 1T66D 1MRDL 1MCPH 5DHVB 5HGBB 3ARFD 3RL1B 2E7HA 2Q86B 1IAOB 3SQBA 1AHWC 5CINL 3O3DA 1NEZG 1MFDH 5L2JA 1JTTA 3MRPB 1CQKA 3M8OL 2E3VA 3H42L 4U6XB 2BNQD 2EE6A 4NHCH 1MHEB 1NC2B 2ATKA 2VXTH 1TQBB 5LGKA 1K8DB 2EXYC 2QQKL 3ZKXB 3MLYL 1R0AL 1KJMA 1IZJA 4LPWA 1CN4A 2V17L 1G7IA 4IRSB 1SYSA 4XMLL 2E9JA 3RZCB 4YDVB 1A7RL 1EEUA 5FYJL 3VCLA 2NYYD 2PYEA 2OS7A 2V2XA 4AL8L 1FZJA 2FHBA 3KPRD 2H32B 3OAUL 4PRID 1RJLA 4JGJA 1OM3L 4TULH 1A6WL 5D7IA 3PDOB 1XGRB 5IJVB 3QQ9D 2B5IC 2A9NH 1MLBA 1JFQL 2BJMH 1RUKH 1FNGA 2DWEB 3EBAA 3PP3H 3EFDL 2VDPL 5JIIA 4Y19B 1G1YA 3F12A 1FFNB 1FHGA 3BI9X 1NCDL 1QOKA 2FR4A 1BJ1J 2GT9A 3KS0J 1F58H 5FF6A 3DXAD 1QLRA 3ULVF 4UIMA 4PRPA 4P99A 1BMGA 3GO1L 2YMXL 2AEPL 4LGRB 3FB8B 5KVFH 1IAIH 1PG7W 4WFFD 2WBJC 3LN4B 1IC1A 1T66C 5CEXA 4LHQB 3EYVA 4OCRL 5E6IB 4P5KA 4LASH 2OJZH 4DW2H 3UTOA 5DJAA 1MCDA 4J1UA 2NPLX 3S5LA 4AM0B 3T77A 5JXAL 2C3XA 2Z31C 3TBVB 1ND0A 4NWUL 3THMH 1T22A 2ADIA 4WFGD 3PQYE 4R4BB 3VXOA 2PXYB 1QQDB 5HHQA 4YDKH 5LVEA 2X89A 3QHFH 4JO2H 4XCYA 2O5XL 3T4YA 3H9ZA 4HFUL 4Y4FD 3K2UL 3LQMA 2NYYC 3VFMB 3BXNB 2GI7A 2QHRH 1ZHKA 3PV7A 4ZFGH 1FYTB 3O3EB 2Q8BH 3IFNH 3L3IB 4OLYH 4HUWA 1KCKA 3SO3B 5T1KA 2OXGA 3HB3C 2N7AA 3FB7B 1I7UB 4Y16D 2NY5C 4L8DB 4FFYL 3RVUD 3V4VL 5KVDL 2J88H 2RHEA 5ISZB 1LO0H 3MOAL 1XCQB 4KVNL 4MD0A 1U93A 5T3XE 3WD5H 3IKKA 2P24B 4NO2B 4YGVB 3KPNA 3JV6B 4K8RH 4X6EA 4JO1L 4P2QD 1SJEA 5F7FA 1BECA 3CLEH 3VG9C 2VXSL 4U1KB 4BYHA 4JDTH 4XGZB 5EU7E 5FIEA 1UM4L 2FSEB 3BZFB 1HIML 3AC0A 5FUZH 4BSWA 3D87B 3K2MC 3PJSA 4JZJB 4PV8B 5C2UB 3MA9H 4ETQA 4PRDB 4IMLB 1F4XL 4TOYL 2G75A 2IPUG 4D9RD 4KMQA 3RY6C 2KZ1B 4MB5A 4LEOA 2YR3A 1OTUC 4JHAH 5LCVH 3UDWC 4U6VH 5E5UB 1FL6B 5HHPA 1MFNA 1YMHA 4FZ8L 3OKLA 1C08B 1XIWB 5DUBA 1IC5H 2XQYK 1IFHL 4PG9B 1ED3B 1F2XK 2HN7A 4UT6H 3ZKQD 1XF5B 4YR6B 3QUXA 3TWCL 1XEDA 1C5BH 1EX0A 4RAVA 1EHLH 3PWJB 1KTDA 4M7LL 3V5KA 1MFAL 1BAFH 1NFIB 3BO8B 3F65A 3GSNA 2VB5A 3KPQB 3TIDB 2MKLC 2DIJA 5FHAH 5EIIB 4X4ZA 1CD9B 5HHMB 1I3GL 3L3JB 2RCSH 4JJ5B 3HE6C 1A4JA 3B9EA 1KBGL 5L2KE 1ZT4B 1CXKA 3JTSA 2BVEA 1A6VH 3TYFA 4Q9CA 3MROB 5C2BL 3FTGA 3D39B 1A8JH 3U7YL 5MENA 5CJQL 4YFDB 1XF4A 4PJCE 3QISA 2COQA 2GAZA 3TH3T 3GSNL 3RWFA 4WHTA 4LLYB 1HQRA 5A3ID 4MMZC 3U7AA 3C5SB 5DMKB 1OT2A 3IXTB 2YD5A 4Y4KB 4Z7WF 2DKUA 4ODWB 5GRZA 1H3PH 3I3BA 1WEJL 1GPOL 1BVKB 1YMMB 5DS8B 2AJXH 3EOYG 4GXVH 2OBGA 2UYLB 1YQVL 1IE5A 2JF1A 2FRGP 2NY1B 2UY7A 2E6JA 3TBSA 4N5UA 4QRPA 2EDHA 1B0RA 3VFVA 1F13A 2XZZA 1OPGH 1DEDA 5E2TL 3TO4A 3ZL4H 2XYCA 2V9QA 4JPIA 5F3HA 1HILA 5IK3A 3QDMB 2QQLH 1LDPL 3ILQD 1EFQA 4E41A 3QULB 4PRNA 4JY4A 2R4RH 2P5WA 1ES0A 4KJQC 3LPFA 5E99H 4HLJA 2ZUQB 1WCQA 3QWQB 1M7DA 1BM3H 1R5WB 3JV5A 4XCNB 1BJMA 5I30H 3U6RA 3MLXH 4XHJC 1W8OA 4M4RA 4OZIB 1DEEB 4YDLC 2DDQH 3O6MH 5T33L 3GUTB 1ADQH 5DTFA 2AI0H 4X6CA 4OZ4B 5DK3A 3QUYA 3X14B 5TDNB 3EO1B 3DRTA 3OF6A 1U0QA 3HNSH 3CVHA 5HVGB 2A77H 4EI5B 4ZOCA 4HFWB 1A47A 4GFTB 5AYUL 2YN3A 4OF3A 4P49A 3RL1A 2Q86A 5FCUL 1IAOA 3WUWA 1LO3L 1CG9B 1A3LL 1A1NB 3NPSC 4PJXB 2FJHB 1T21B 2HT2D 4GRWB 2M8XA 4HGWB 2AJVL 2V9RA 4U6XA 4P9HH 1MHEA 1NC2A 1AHWB 1K8DA 2YKLH 1DUYB 1VFOA 3CVHL 4F57L 4MJ5B 3O6FD 5GSVA 3VFSB 2BRRL 4FG6C 4OI7A 1F4AA 4OD1H 2BCKA 3RZCA 4YDVA 2VOTA 1NPUA 3NTCL 4PRHB 4S1SL 4HUKB 2NXZD 1QRNE 32C2B 4ZO7A 2E9WA 4LDEB 1P84K 4LEXH 2W0FB 3OKDB 4EQ3A 1MHCB 1Q9OB 2D9QB 3OKYA 5DRXB 2YPLA 4FS0A 3PDOA 3ILQC 5T1DL 1DQJB 1XGRA 4OZFH 3ARRA 4PR5B 4XC3L 2A6DA 2DWEA 3V7AE 2VAJA 3RUGB 1WTGT 4PD4J 4DZ8A 4F58H 1FFNA 4KJPC 4XZUA 1I85A 4ZUSB 4MVBD 4ZO9A 1IL1B 3RZWA 3G6JB 3VH8G 1NBVH 1KLGB 3DV4B 4YHLL 5IFAH 5GISH 3VE0B 5GZND 3FB8A 4AH2B 5SWQB 4XH2B 1SBBA 4JDVB 1L7TH 4XCCH 2BHUA 3LHPL 4YEEA 3LN4A 1BEYL 1N6UA 3N0PB 5IGXH 1V7NH 4HLZG 1E27B 4LVNC 2O5ZH 3DYMA 5E1HB 4UTAL 4D0DB 1UYWL 4ZTOL 4Y0GA 3DYOA 3KHOA 3CFCH 1PX3A 4U7KA 1WBZB 3BDXA 3GI9H 4XAWH 3ARFB 4ZFZA 5FDWA 3L6FB 4AM0A 2D31B 4NNYA 5MI0B 4JGMA 2FWOA 3RVXC 2R1WA 2ZCKL 4YO0B 3GBML 1FFQA 4XB7A 3SKUD 2EDLA 2PXYA 1M05B 3QEGH 1QQDA 2BNQB 3IFPA 3QDJE 1KNOB 3MTRA 4O02L 3MRBB 3FT4B 2DAVA 2Z31B 3LAFA 3B9KC 5AG9A 2AK4E 2VMFA 2ERJC 3AS0A 3WUZA 2NXZC 3BXNA 3GZKA 4KGJA 5FA4A 1JZ7A 1WSST 4G7YH 2V7HB 5F1OB 3D3VE 2W65A 3LRGA 4YE4L 3RWGA 3KPRB 2ZOKA 1XCQA 3EYOB 5E95B 5F7EH 3WHE0 3E6HB 4PRIB 4Z7WE 1FJ1A 3QO1B 1WC7A 4YGVA 3GRWA 5DQDH 3JV6A 1FZOB 3T2QA 1E4KA 5EZOL 1N7ML 1II4E 3KWWA 4KXZH 4Z0XB 4U1KA 4NRYB 3SPVB 3VXRD 4XGZA 1JRHH 5LBSL 4UDTB 3HE7D 3BZFA 1NDMB 4OCWH 4U7MA 1R0AH 4R8WH 1A2YB 2ARJA 4D9QE 4LRIC 3IGAB 4PV8A 4RRPG 4N0UA 3BEWA 4Y5YB 4XMLH 1GHFH 5E5MB 1HKLL 4PRDA 3QFJE 4IMLA 2EDEA 4PJAB 3GRWL 2WNGA 1JYNA 3E3QC 4DQOH 4FQ2L 4PLKD 4IS6B 1BZ9B 2AEIT 4HH8A 5IHUH 1BIHA 1DP0A 2QQQA 3U4BL 1C08A 1XIWA 4CUCA 4BUHA 2FJFA 3FN0H 2A9MH 2EIZB 4P3CH 4PG9A 5ESAB 4NKQB 4HCRL 4YR6A 3HI5L 1BFVH 4NZJA 3TPUB 3P0YL 4YUEL 2Y5TB 4PUBL 3PWJA 2QV2A 5EU6E 1FFOB 5HYSG 4JN2B 1NFIA 3BO8A 1C16B 5C6WH 5AG8A 3KPQA 4EDXB 2OTUB 5ERWB 5EIIA 3L3JA 5HHXH 4JJ5A 1BWWA 3MSPA 4Y4FB 2PYFB 4WWKC 4B50A 3GFUA 1ZT4A 4S1DD 1CICA 4UT9H 4HJ0C 4WTZG 3AU1A 3N9GL 4Z8FL 3D39A 4Y16B 1XR8A 3OKKA 3MV7A 3RY4A 3ELAT 4JFEE 3C09B 4S11A 3I85A 3DX6B 4KDTC 3PWLB 3P30L 1L9MA 3ZT6A 3HE7C 1AKJB 4NSKB 1BQLL 4QXGL 4IOIB 4Y4KA 5FHBH 2HJLB 4P2QB 5CJBA 3FONB 5DJ6B 5D1QA 4Z18A 3P0VH 3HLAB 5E2VH 2IEPA 1FAKT 1YMMA 3QNYB 4JKMA 3JZ7A 2UYLA 1VFBB 5KS9E 2KUTA 4F33A 3TN0C 3H9YA 3RP1A 3UJIL 5HY9B 1BOYA 3ILPB 3QBTB 4OCLC 5KVDH 4GKSA 2YUXA 4HZLB 4KVNH 5LAXB 5JR1H 5IHLB 1FFPA 4FNLL 4PGBB 1BIIB 5DVKA 2R1YA 1A5FL 4HF5L 4KQ3H 1YJDC 1I9JL 3INUH 3QDMA 5CGMA 1NFDB 2FLBT 4OZGF 2NW3A 3T1FA 4V1DD 5I74C 3SDCD 5CLWA 4M9OA 5DRZB 2CXGA 2UUDK 2YA1A 1UM4H 4DVRL 2X70B 2A1WH 1U8JB 2VLRA 4JDZA 2NZ9D 1P4IL 1YEKL 1FORL 1R5WA 4XCNA 4W70A 1B4JL 1GOGA 5EFIB 3RDTD 3P0GB 3MGTB 4OZIA 1BX2B 1DEEA 1HHHA 4YPGB 3GUTA 1V3KA 4RISL 1H8OA 3SDDC 2A83B 1A7QH 4YHIB 5IVZA 4ZPVB 1EAJA 2IFFL 4JPWH 2DS4A 4EJ1C 4XNZC 1H3GA 5IBLD 3L9RB 4EI5A 3OKMA 4HFWA 1G0XA 3VGEA 4KTDH 1KF9B 2GSIB 1A7OH 2CPCA 3MRHA 4F7MA 2YD6A 3FQRB 4FMKA 4BFIB 1A1NA 5JXEA 1IFHH 4PJXA 2FJHA 2XWJB 2BHZA 5DD5L 4X99B 3QHZH 1VADB 1WIPA 1KCUL 2ZCHL 3BISA 1AHWA 4HAFA 1MI5E 3L7EA 1DUYA 2APXA 3OJVC 2CLRB 4ELMF 5DQ9A 2DLHA 4MJ5A 2A6KA 2Z4QB 4U2ZA 5A1AA 5D72L 1I3GH 2EEDA 1Q9LB 1T1ZB 5T3ZH 4GAGL 5GIRB 4PRHA 2ENYA 3U2SB 3BUYA 32C2A 5E4EC 1I8MB 3BD3A 2JB5H 3X11A 4QRTB 4EIGB 4LRNL 1MHCA 1Q9OA 4XP1L 5DRXA 4L4TD 4MLIA 4MMXC 5CJQH 2O5YL 2B2XL 1KLUB 3LV3A 1WZMA 3MQIA 4E5XB 5EBMB 1X4YA 3RUGA 1FIEA 4ZUSA 3RIFF 1IL1A 3E6FB 3E3QE 3BQUC 4NCDA 3Q1SL 3U46B 4F7CB 5KOVC 4OKVB 1N5YL 1WEJH 2GKIA 1T7VA 3VE0A 3Q5TA 5SWQA 1JGEA 4XH2A 4AH2A 2CRIA 5A2JH 4ZSOA 1CDJA 4LLAA 4Y5XB 1NEZA 4WI3A 1A6AB 4RBPK 1WZLA 4PPTA 3MGOB 1F90H 5C0DB 3QAZC 4MA1B 5B39G 1JWSA 4D0DA 4H20L 1KJVB 4XP9L 1ZLVK 3X3FL 5EN2B 4DK6A 1DBJH 1A4KB 2WBJA 3CXHK 4BKLA 4CJ1A 4URTB 1UH3A 4QLRA 5EU4A 1WBZA 4I3RH 4ODHH 3MJGX 3F6IA 3MRRB 2FNBA 3L6FA 2XN9E 2YWZA 5I66B 2CQVA 2D31A 3EJZC 5DWUH 2XKNB 4N5ED 5T1MB 4FP8L 4WUUA 3WEXB 3HC0B 1EGJL 1HDMA 4TN9A 3V7MA 4RX4D 1KCLA 4YDIL 2AQ1A 3TA3D 1NAKL 2BNUB 3FT4A 4JB9H 2Z31A 1MJ7H 2JJUA 1AQDA 4G6AD 5F96L 2P8MB 4X9HA 4ALAH 1XGYL 4XNQB 4PV9A 4TVSa 1EJOL 5T33H 2V7HA 3PHSA 4XPAH 2NY6D 3AS3A 5CEZE 2R2BA 4LP4A 2ERJB 3UTZA 4HIIB 2NXZB 3KPRA 5AYUH 3GM8A 4G7VH 3EYOA 1T0PB 3BEVB 4FRWA 1LO3H 1R3JB 1HEZB 4NQTA 3BIBX 1A3LH 4EXPX 1RHHB 2H2PC 4OGXH 5E1AA 4UQ2A 2X09A 4OF5A 3TVMC 5DJCB 1IZKA 4IOSD 4M8QA 4YHML 3MLVL 5MHSE 3SPVA 1MIEH 3UXFA 5TPWL 1G0DA 4JM2D 3UJTL 3PUCA 1RZ7L 1NDMA 4EVNB 1X5FA 5IBUB 5I6XC 4M4PA 4QRRB 4MCYA 2EEAA 3IGAA 5DZOA 1KXTB 1DQTA 1UB6B 2RFXB 2W9LA 3PHQB 2UUDH 1N8ZA 3U4EA 4KGLA 3NTCH 5E5MA 4S1SH 3EGSB 3C8DA 3ULSB 2EZ0D 2NY5L 4PJAA 2CRZA 4LU5H 3D0VB 5CJOL 5J1AA 1VACA 3B2UD 4PGCB 4IS6A 5BS0E 2R56H 1T7YA 3Q5YA 4D0BB 3RBSA 3RY6A 5J0BA 2VNCA 4JFYB 3AGVA 2EIZA 4XCFH 5IHBA 3UDWA 1PFCA 4J2XA 1D6EA 1S5IH 2B4CC 4QHNB 5J6GB 3AB0B 3TPUA 2X4NB 4P46D 1ONQA 1FFOA 1DQLH 4LCIH 2XICA 1C16A 3QEHB 3MLZH 4U0RB 2DICA 1JGLL 2HT3C 3FRUB 4EDXA 4HK0B 2DQEH 1YY8B 4LVEA 4KK6C 1NGXB 1I9RL 1BEYH 1P7HL 2IH1B 4AK1A 1NCAL 2VISB 3BZ4B 4UOW1 4WHYH 4LLUB 4KROC 3E2HB 4WV1B 4XXDA 1IM9D 1ITBB 1BBJB 1C7SA 4Z78B 3BDBA 1CR9H 3IT8D 3MR9B 3HE6A 3VFOA 3ARED 2DLIA 1FNAA 2EDTA 4Z7UF 4PJBB 3U0WL 1OCWH 4MX7A 3FHAA 4CKVX 4TSBH 5DJDA 3PWLA 4XI5D 3GMNA 1AKJA 2BFVH 4M6ML 1BP3B 2R2EB 5EIVA 3WE6B 5CFHA 1GGTA 2EDJA 4IOIA 4FFVC 4KK5C 4P2QA 4Z7VB 5F9OL 4FQCH 4LBEB 5D2LB 1KT2B 3F7VB 3VXRB 1KTLB 3HE7B 3HLAA 1F4YH 4JGUA 4TNVF 3GSWB 2ZUYA 2N4IA 3BPLC 5E9DD 4M6NL 4WGVB 4ZDHB 1A6TB 3HMWH 5EWIL 2GCYB 3U48A 4N0CD 4KQ4H 4RAUA 1UEMA 3P73A 4YE4H 3C6LC 3QQ4A 1CGWA 3R4DA 2DLTA 2DIBA 3NFSL 4CVUA 3HPJB 4A6YH 1OP3K 5LAXA 4PY7A 2F53E 4XPFL 5LKNA 4JLRB 4PGBA 1BIIA 5HBBA 3ZDXF 2AVGA 2OQJB 4GQ9H 1B0WA 1FVDB 1NFDA 3IKCB 2PO6D 5GRXG 6CGTA 5H35B 5DRZA 1ZLVH 4V2CB 5LBSH 1MJ8H 3K8MA 4GMSL 5E70A 4O2FB 1UM6H 5DRNB 4D2NA 1J87A 4X5WB 2CJUL 5EZIL 5INCA 4KJYB 3NCBB 4TNWF 3BKYH 2ADGB 3ET9F 5IVNA 4QXWA 1BX2A 3VD4A 4X6DB 5F6HJ 1NGZA 5L2KD 5BRZE 4LLVB 1C5CL 1L7IH 3GSXB 3GRWH 1HZHH 2X1XR 4YHIA 1T2XA 4XNUH 3MNZB 2W07A 2JELL 4NQEB 4YC2C 4X98B 1RUPL 3T1WA 3L9RA 1ZOXA 2YC1B 4Z5RA 1CL7L 1PY4A 2GSIA 1NQBA 5J6HB 4HS3A 1B4RA 4XC1L 2ARJQ 2IMMA 4BFIA 4MSWB 1F6FB 2VDKL 2VLJB 5GGTA 4XNZB 3HI5H 1AXTL 1UJ3C 5C1MB 1WWAX 4M61B 1HXYB 5E08L 4CU8A 2EDRA 3NFPB 2Y25A 2CLRA 4KI5C 2DD8L 5F70A 1U8LB 4OQTA 2BNRA 1D5IL 4JO4L 2P5EA 1EHXA 3O45B 2A0LC 1T1ZA 5J9PB 1DVFD 1S3KH 4F3FA 1ZGLA 5GIRA 3O2DA 4HAGA 3U2SA 4WI7A 4BFGA 1BQSA 1I8MA 1OGAD 3ARSA 4U1JA 5GGTL 1J1PH 4QRTA 2OXHA 3IU4H 4XPGL 4MQ7B 4G9FE 4NNPL 1KLUA 4Y2DC 1QO3B 4EN3D 4PRBA 4JQIL 5EBMA 4NZUL 3ULVD 4UILL 4JRXD 3U0TB 3JTTB 3OR7A 4PJFF 3TBWB 4W6XB 1J86A 4J4PC 1KXQE 4XVTL 5D6CB 4GKNA 3SDCB 5IESL 3U46A 4F7CA 1DBKL 1PYWB 3P2TA 4X4ME 3B8SA 1MQ8A 2FATH 3LEXB 4M1DL 2C4XA 1AP2B 4QTIL 5IBTL 1JZ6A 1W0WA 4CRPA 2EH8H 4XHQA 4X5XB 1WQVT 2DYPA 3ME0A 4MAUL 2YSSA 2FGZA 4MXWL 4Q74A 3RDTB 1A6AA 2GQHA 5EOQH 3UJIH 3IJSA 2H8PA 3KLDA 4M7JH 5JIHA 4Y8AA 1QLEH 3MGOA 5FGCE 4GKZB 3VWJC 4NP4H 5KSBF 1N2RB 1NMBL 4KRMB 1JNHA 3G08B 5IHZB 5HGAB 4KKBC 3QO0B 4F9LC 4XVJH 1I9JH 3OQ3B 5KVGL 3MRRA 5C0RL 3QAZB 3QPXH 5I66A 1QLFA 1JN6B 2XKNA 3Q0HA 5T1MA 5HGHA 3CZJA 3V2AR 4JHBA 3KAAA 3CVIH 5B38G 1JPFB 5FO7A 2VR9A 4POZD 4LSQH 1FORH 5T3XH 4JFFB 3UTSB 1DVFC 1M7XA 4JFHE 3CXDL 2P8MA 2GJ6A 3HPLB 5IIEA 2YD2A 1CFVL 1WGOA 1C12B 4RISH 3S9DB 5DLML 1QRND 3B9KA 4KKNA 2UZIL 2M26A 1JUFB 3W0WB 2CK0L 2DQGH 4Y89A 5KG9A 3VH8A 1XZ0A 1R3KA 3BEVA 3ULVC 3OX8B 2CIKB 5DFVD 1R3JA 3F5WB 5FKPB 2C1PB 3LH2H 4GSDL 4L4TB 4P0DA 5IJKC 3MRNB 5DJCA 4MHHG 5IQ9A 1OP3H 3VFGL 3KR3H 5GS2D 1PKQA 2N56A 3PWNA 3GMQA 1AO7B 1HI6B 3GMOB 3N85H 3IDXH 4I4WB 4LF3B 3LEVH 3T2NL 4QRRA 4K9EH 4Y88A 2AXGA 5B39B 1T03L 3C5ZC 5BZDA 1Q72H 3OAZK 5E4IA 2PTUA 2R8SL 1QBMH 4GOSA 2HFFB 2RFXA 3HI1B 3PHQA 4L3CB 4A6YB 4L8BA 4WU7B 3SQOH 5I6XB 3ULSA 2DI9A 5DVNA 4LRIA 1IGMH 3D0VA 4FTVE 3O6LH 2SEBA 4XP1H 5TF1H 4IRJD 4PP1C 4PGCA 1GC1C 1X7QB 2B2XH 4P9ML 1EUUA 3MUGB 1G7MA 3A6CL 4D0BA 1EEQA 1T1WA 4LVOB 5EC1B 4QHNA 4C57C 5J6GA 4JANB 1BJ8A 5JOFA 5I8CB 4IDJL 1N0LA 3UPCA 2YPVH 4FQJL 3VFTB 5J8OA 1OSPL 2AK4D 3CX2A 1YNKH 3QEHA 2AV1B 2R9HC 4FXKB 4M6OH 2MCG1 4KDVA 3TA3B 4FABL 1OTSD 5D5MF 2IPUK 4LSRL 2IAMC 1CCZA 2ICEA 2VISA 5K93A 3D3VD 3TO2B 1OAXL 2D0GA 4LLUA 3V4PL 5HXMA 4ODVH 5HI5C 3OG6B 3EYSL 3SOBH 4S1QH 5DFVC 1KULA 4NKDB 1LNUA 3WCYA 4WWKA 2PCPA 3QCVH 4LLDB 2YEZA 1TDQA 1U91B 4CJ0A 2VXVH 4LSUL 4KROB 5F7UA 5IMOA 3K46A 2EDWA 3MRQA 4LGPB 4DUVA 4RRPA 1TVDA 4N1HB 2J8UF 3I9GL 4FP8H 4Z7VA 1FNFA 4LBEA 5D2LA 3W9EA 3QFDA 3OAYK 3G6AB 1FNSL 3F7VA 4KDTA 3GNMH 5D8JL 3VXRA 4D9QD 3HE7A 5F96H 1KCRH 1TETH 5SWSB 3GSWA 3S3SA 4I77L 1UCTA 5LGHH 2PUQT 1EJOH 3QFJD 2ZNWA 4LCWE 1UZ6F 2GCYA 4LAQL 5BVPL 4PTTB 1LP9F 4C4KT 5GRWA 4UAOB 1OB1A 4UDUA 4GH7B 4OAWB 4PJFE 4JFPA 4N90E 3HPJA 3H7LA 1CFTB 1RVFH 5DUPH 3ZE1F 4Z6AT 4GXUM 5HYSA 2OQJA 3TN0A 2ZUUA 1VHPA 1KJ2H 1FVDA 2ITDB 1X5YA 1ZHBA 4HUUB 5HYJA 1SVCP 2P8LA 4Q9RL 2H2SD 2I9LA 4XP6L 1F4WH 2GY7B 3MLVH 3OSKA 4KPHL 2HTLC 4PG2C 5TFSL 5GGQL 1KJ3L 1LO2H 1MF2H 1VEOA 4O2FA 4YHKL 5DRNA 5EU6D 3KYKL 4P46B 2ZKHL 4WTZA 4X5WA 1OTSC 4O00A 1J05B 2B1AH 5KSBE 5ALCL 4G6FB 1A1OA 3FO0H 4PY8I 5DR5H 2UVFA 3VDCA 4K23L 2NY3D 5E8PA 1FG9C 4JHWH 4POYA 1Y6MR 5CJOH 4H26B 3BGFC 3ABZA 3MNZA 3SDYL 3B8YA 4NQEA 2Y07L 4BK5A 1IM9B 4H8WC 3JVGC 5DJYB 1YJDL 3C6SB 3OR6B 4JFED 5J6HA 5E24E 3SDDA 1CE6B 2IQAB 2X05A 3AREB 4GS7C 1D9KC 1F6AB 4MSWA 2VLJA 4YC2B 5BXFB 3RWCB 4RZCB 4NBXB 3ZYOA 1IAIM 4HG4K 3SHSA 2ZUXA 3MRDB 1U8LA 4XVSL 3EYFA 2Y36H 1RUAL 4N8VB 2RGSA 3H6JA 4CVXB 2CD0A 4ODUB 3NZHL 4WO4D 4MZ2A 1GGUA 4U1IA 5GPRA 3VJ6B 5GS2H 4N0RA 5E9DB 3UEZA 4LIQE 1AGFB 1CTOA 3KPOB 4R3SB 1J8HA 3KDMA 1TLKA 2XG5A 5TH2B 1E4XI 1ZMYA 2AW2A 2VUOA 4CADB 1QO3A 4JY5H 3JWNC 4HJGA 1AXIB 1FC1A 3EKCA 3WIIL 1QHPA 1JPGA 2VAAA 3LB6C 3L1OL 1RIHL 1NCNA 3PWVB 2BDNH 1WIUA 1NSNL 5F9OH 5EO9B 4HW6A 2F54E 5C0BA 1FZKB 3P11L 5F88B 4MDIB 1MRFH 1CU4H 1YC8A 1AP2A 1RI8A 3MJ7A 2NY0D 1YN7A 1PY9A 3GBNL 3H3BC 4YBLB 4M6NH 4TUJA 3QIBC 4QGYA 4QHLB 1XGTB 3C60D 3WLWC 1TENA 3BP5A 4GKZA 1N2RA 1YPZA 3NFSH 2IG2L 3OMZA 4R26L 1RZFH 4O2CA 3WIFB 5IHZA 5HGAA 1MAML 3I3EA 3RKDD 5HVFB 2XZCL 3QO0A 1IT9L 3VFWB 3CLFH 2X4PB 3MBXL 1WZKA 1JN6A 3OPZH 4LMQI 3VD3A 4HBCL 5D5ME 3KNBB 3TP4A 3DRQA 1MI5D 4GAJH 4JVWA 4N0YL 4JFFA 2CJUH 1C1EL 2ED7A 3UTSA 1UCBL 1FIGL 2CLZB 2RB8A 3OL2A 5D7JC 3QJFB 3LKQB 4OIAA 1NBQA 3HPLA 4WFEE 4ZPTB 2GEEA 1ROWA 2BRQA 1X5KA 4XPBL 2DLFH 2WV3A 2C9AA 5F89B 2AXHA 2C4FT 1DVFB 3FFDB 4XPTH 2PW2B 3SKOB 1A7BA 2JELH 2J8UE 4ZUVA 5KJRH 3MREA 3W0WA 3MLWL 4LHJB 4ZQKB 1OGAB 1Q0YH 1RIUL 3OX8A 2VDRL 4OFYD 3JUZA 3F5WA 4XC1H 5FKPA 2P48B 4FQ1L 1MFCH 4L4TA 4M02A 4U33A 3PWPD 1A6PA 1TJIH 2X2YA 4XP4H 4EN3B 5JOEA 2RJMA 5AZ2L 1HH9B 4TUOB 5FUCC 4JRXB 3EJJX 2JK5A 2YXMA 3HUJB 4LPCA 5D9SA 3HZKA 1ZXQA 1AR1C 1UWEL 1AO7A 1DBML 1HI6A 4I4WA 1V3MA 4P5TD 1UZ6E 3AXLB 3VXSD 3UO1L 1FDLH 1ZKAA 1LP9E 5E94B 3TVMA 1JF5A 3UTTB 4JO4H 4KY1L 5B39A 4NOFA 3H0TA 3LVEA 5CEYA 5LQBH 2HFFA 1LHZA 3HI1A 1IRAY 1JPTH 4L3CA 4UI2A 3ZE1E 1G9NC 4POUB 5DJXB 2XWTB 2DKMA 3C5ZB 3B9AA 1NDGA 4ZXBD 4B0MM 2OP4H 1NC4B 2X5PA 1VKXB 5M94B 5B3NA 2IPKB 3KJ4C 1U58A 4ZTPH 5B38B 3WS3B 3MUGA 4GO6B 3FO2B 1F4HA 4OQTH 2XN9D 2CKBA 4HXAL 5EC1A 1JMXA 4X4MA 3L3OB 3MRFB 2CSPA 1WCBB 1RZJC 4TRPL 2BY1A 5I8CA 4XVTH 2WWKT 1XFPA 4XMPH 4MJIA 3O2DH 3P77B 1V3LA 4FXGA 5IG7A 5IBTH 3OKNB 1S7VB 3BHBB 4R7NB 1GGBL 5IFHL 3BH8B 5I1HL 3FFCA 2ORBH 3QDGA 3KYMA 3TA3A 2BY2A 4L5FL 4W6WB 3T04D 4MB3A 4X80H 1NLBH 1KC5H 5MERB 1TTGA 2NY7L 4HPOL 4WI4A 5ANME 1KCVL 4UZGA 2CKBL 1YY9D 4L9LB 3D2UB 1KEML 5KSAD 4ZYKA 4WEBH 4NT6B 3A6BL 1U3ZA 5GS0C 1QRNB 3BT2H 4XNMB 1QBLL 4ONOA 4NKDA 1Z2KA 2DQUH 2FX8H 3BJLA 1X5IA 3TCXA 4WDIB 1NCBH 3VXQA 5A2IH 3ULUE 3IYLW 4L8SB 5KVMC 1EERB 4P5TC 2VZSA 5MHSD 5F97E 4KHXL 1MFEL 1VEMA 5J89A 1QSVA 3AMKA 1WZ1L 5HI3C 1NL0L 3G6AA 3S98A 1FGVH 4HS8L 4GG8B 3ZKND 4O4YH 3HZYA 4HDIB 1W0VB 1OAZL 3FOMB 5SWSA 4AZ8A 3IVKA 2AXJA 4RGNE 5GGVL 4MHHI 1RULL 5CGYC 4KRPC 3MRIA 5M7QA 1CFQB 2OTWB 1G9EA 1SJVA 5ENWA 4JZNB 5DF0A 1J0JA 1N59A 3FB5A 2Z93A 2YD3A 5E8NA 4NPYB 4OAWA 4OFKA 3PV6B 4XNYH 3OB8A 2XA3A 4MGXA 4OD3H 5BS0D 4ODSH 2B8OT 4NC1C 4IRJB 3NABH 3C6LA 5DC0A 1B2WL 2ITDA 4NKMA 5C0JA 1Z0NA 4O58L 4HUUA 4UNTA 4F15C 2DMCA 4DKEL 4TVPH 1UXWB 3QIUD 1I1AD 4AEHH 5B3JF 4UINL 3FT2B 2X4UB 4TSAL 5EBGA 1J05A 5GZOC 3N1PC 4D9LH 2AJUH 4NO5B 2AK4B 2ZOLB 1AY1H 2OR7A 4ONGH 2LABA 4I2XA 1W72B 2CUIA 1VCAA 4H26A 4U0QB 3ZTJG 1TZIB 5ICZA 2J8HA 4QHKJ 3NACH 4BZ1H 1BGXL 1IM9A 4RGOH 5E8EB 3REVB 4HLZH 4PJEF 3PGCB 4L9DA 2ITCA 3C6SA 5KSVA 1WUNT 3W2DL 1CE6A 3I02A 4JRWA 1F6AA 1HQ4A 3MRCB 3O3AA 4Z7WB 5ID1B 3DVIA 3WSQL 5BXFA 3RWCA 4RZCA 2QEJA 4I3SH 1YC7A 1EPFA 5I1JL 1NUNB 2L0DA 1CDCA 1D9KB 3VGAC 1MHPH 5JHDA 3MRDA 1UJ3A 5DD0H 3WKNA 1CE1L 4P48A 1EV2E 4YX2L 4FABH 4XXCC 4Z7OF 4XWOC 4CVXA 4ODUA 4Q0XL 4OUUB 5C9KA 4XNXL 3ZSSA 3KPLB 5H8DA 5E9DA 1G6VK 5C7XH 3CK0L 2HFGL 3QFJB 4IIQC 3KPOA 4M9PA 4R3SA 2K1MA 3ETBF 3I2CH 3NH7H 2FL5B 1H3XA 2F53D 4JN1H 2BX5A 4HHAA 1E28B 1JPST 4JO3H 4K3DL 1A9BA 4H88H 1IQWL 4LKCA 4JPKH 3DO7B 4OM0L 1DE4A 1RK1B 3AM8C 3O0RH 3KXFD 2F58L 3PWVA 4G6MH 1KLFA 1J5OL 4FOMA 2W1NA 3BKML 1ZV5A 4Y2DA 3B3IA 4M62H 3GSUB 5F88A 5D8JH 3H9SE 4WI8A 2AKRB 5ADOL 4G8GD 5EU6B 5FK9B 4UV7L 5BZWA 4J4PA 1MCIA 3RBGA 1QFOA 2EKSB 4NGHL 5BRZD 4WEUD 3HAEG 4XPHL 5CD3B 4Q97A 4QHLA 1XGTA 3GGWB 2HRPL 1SEQH 1DBBL 2NY3B 4BELD 4MA3A 3IDYB 2P1YA 3A6OA 5FGRA 3RWEA 3C5JB 4I9WE 5GQBA 1UKQA 3QXAA 5ITBL 4W6YB 5F1KC 5JUEL 5IW1B 4U1NB 4KKLD 1F42A 3QUZC 2FEDC 1FAIH 3VFWA 3HG1E 2XQBL 4S1RL 3VWJA 2P49B 2X4PA 3WHXA 1A14L 3MRJA 3FO9B 5CEZH 4JFEB 3U9UA 1OAQL 2IPTH 1KJ3H 4K3JL 3BN9D 3KNBA 4F9LA 4YHKH 3MC0A 4DUWA 3U9PH 4P23C 2ZKHH 4Y2OA 5C6PB 3CC5B 3IFOB 1IKFL 1OQOA 1ZLUK 5LXGL 3G5VA 2NQCA 1HK6A 4CU7A 3ALXA 2EO1A 3LKQA 3O6KH 4ZPTA 4ZD3H 4G3YH 4QF1B 5DHXB 1FCCA 4ZS7L 1FRGL 2WW8A 2JJTC 3GJEA 5F89A 5JQ6L 3H9HB 1DVFA 4WO4B 2PW2A 3SKOA 3SDYH 1PAMA 2GW5A 2Y07H 1OD9A 4PJ8D 5IB5A 2E27H 4PB9H 1OGAA 4G9FD 2XWBB 3WFDL 3AS1A 4WJ5A 5IB4A 4HUXB 2WINB 1R5VB 3GIZL 5HVWA 2AJSL 2VXUL 4HT1L 2UVEA 3VA2C 4GT7A 2GJZB 2NR6D 1HH9A 4TUOA 5IT2L 2Q6WB 3MOBH 1DSFH 5BV7C 3HUJA 1UQSA 3ZYZA 1M7IB 4MS8C 4XVUC 3AXLA 2AERT 1KELH 4NJAL 5IJKA 3VXUB 5E94A 4UT7L 3UTTA 1IAKB 4XTRD 5DSCA 5C6TL 2VDML 1KIQA 1O5DT 2VWEC 5EG6C 2WAHA 3UZVB 5IKCB 1S5HA 1CGYA 5DI8B 5DJXA 3TFKD 3C5ZA 5HHOA 1TPXB 4I5BB 1X6LA 5EUKB 1NC4A 4KKLC 3LQAL 1VKXA 3C60B 2I60H 2KPNA 2E9BA 3ULVL 4OSUL 2IPKA 5B38A 2OJEA 3FOLB 4M43L 3WS3A 1S7QB 2YK1L 4JHZA 2DWDB 3G9VA 3V52L 1G0YR 4XBGA 2MSPA 1U8PB 2MPAL 5D7SH 5FOBA 1ZLWH 1VGEL 1YEFH 3KJ4B 5I8OH 4P2OC 3UJJL 2FO1A 3NCJH 4YXKH 3MNVB 3P77A 5JZ7C 1NUGA 1ETZB 3BHBA 1UFUA 5I1GH 1MI5B 2Q76B 5C0IB 3BWUC 3O41A 3QEQB 4RFEB 1U6AL 4PJEE 3MV9E 1OSZB 4HWZA 5MERA 4OB5L 3BIKA 3QNZA 4PJ5D 1MCOL 3ECBB 3D2UA 2F9BT 3NA9H 3T3PF 3BZEA 1GC1L 1P7QD 4R26H 3I50H 4JG0L 3MJ9A 4PJ9C 5C08B 5DGQA 4NZRL 1MAMH 2IAMA 5GRVL 3C2SA 5CBAB 2PN5A 3UPRA 2I5YL 1KB5B 3ALPA 43C9B 1XH3B 4L8SA 2OM5A 2D0HA 4LSSL 5I1IL 3PWPB 3V6FB 4CMMA 5CZXD 4PRAB 3LSOB 2CO6B 2CMRH 5IB2B 1JZ2A 1LILA 3S35H 3HZVB 2R0ZL 5I8KL 3V6OE 3H3PL 4GG8A 2WZPD 4TTDC 4P5TB 3VXSB 3FOMA 5EOCH 3SCMD 1BVZA 5BOPA 4EDWL 3ARZA 2B20A 5F9JA 1S9WA 4WW2F 1MVUB 2AJYH 1CFQA 1TJHL 1J10A 2OTWA 1G7QB 4PJGF 1RQ5A 1CXEA 3K4AA 3FQUB 2V2TB 4JZNA 1MCSA 1MSPA 3BP7B 3MLWH 4RQQA 3PV6A 4NO0A 4P59L 5K9JL 4I18C 2ZPKL 4KRPB 3JWOH 4ZXBB 5DO2C 1A7PH 3ES6B 3VMNA 4AQ1B 3BGMA 3RVWC 1LEKB 4Z7QE 5GRJH 1KYOK 5D93C 4L1DA 3T0DA 3VFRB 5CKGA 1KIUA 4WGWB 5D7LA 4G6JL 4MNQA 4RGMC 2W9DL 4C83B 4RAHA 4D3CL 2X4OB 5GJSL 5A43C 1WICA 4PG2A 3WFEL 3ARQA 2ZSVB 1FCGA 5TDOA 2ZOLA 4MDJB 5DFTA 1WAAA 3A67L 3OHXA 4HKZB 4ONFH 1TITA 4B5EA 1I1YB 2IANE 4ELKB 5CILL 1TTUA 1QEWB 1TZIA 4P4RB 4KK8D 3B5TA 43CAB 1HSAB 4OJFL 3PGDA 4HD9A 3CMGA 3KLAB 5E8EA 3REVA 5KSAB 2JB6B 4Q2ZB 5F1IB 1TNMA 4QHMB 5E8DH 5FV2A 4M03A 5TE4H 4JFXB 2VZTA 3JVGA 1MCFA 3BN3B 3RU8L 4I48B 2R4SH 2P4AB 4HKBB 2Q8AH 1QP1A 1D9KA 1PLGL 4MAYD 1H15A 1D5MA 4RFOL 4IBLT 3L3HB 1INDH 1ZA3B 3JWDC 3MCG1 4FXLA 1NGPL 5JO5A 4X83A 3SKMB 3TNMA 1FV1A 4LCCC 3MRGB 3X17A 4J3TA 1QFUL 4NDMB 4AIZA 1Q1JH 2NY7H 4LCWD 5SX5K 3DSFL 3WL9B 2DM7A 3ZHKA 4QKXB 4PGEA 1UACH 5SWZB 4LSVL 1F97A 5LWYL 2FL5A 1OF2A 3QXWA 1BBDH 4H8WL 4OZGB 2MHAB 1LMKA 1IEAA 1E28A 2R0LH 2VSCA 4OV5A 5JW3H 3VWKC 1X4XA 4IIQB 2B4CH 3FQTA 1RK1A 4ERSH 3WFZA 1RU9L 3MV8D 3KGRA 1DJSA 1WZ1H 2ICWJ 2IALB 4LLWB 3GSUA 3L5XH 3MODH 5IEKB 4U05A 4NZDA 5T5FH 3QIUB 1I1AB 4KUZL 1Z3GL 5GGVH 1F3DH 3WS6C 4M48L 3LD8C 3GSRB 4N8CL 4PFEA 2C26A 3ZKMC 3EYUH 5HDQL 3DX9B 4CW1A 5CD3A 2D0FA 3IDNA 3GGWA 1GOHA 1LO5B 1EHNA 3QI9C 4K94H 5E5RB 2F19H 5F1SA 1QR4A 4PS4L 1T5WB 5BJTB 1KEGH 3EUUA 3FO1A 2I07A 3DMMC 3QIBA 5IW1A 2RAMA 3PHOB 4BA8A 1GIGH 5DD3H 3L5HA 5F7YC 1MNUL 1YN6A 4P2RE 5IFJB 4HWEL 4PGZA 3MLUL 3U4AA 1TZGL 2X10A 3GMPA 2OYPA 3LMJL 4XWGL 4DTGH 5KTEL 3GSVB 4ELMB 3VW3L 1AQKL 4N9GA 4YXLL 3LPGA 4X0KB 3Q3GA 5IMMA 4UINH 5IVOA 1T80A 3CC5A 4TSAH 4APQD 1F3JA 3T3PE 1U42A 4ZFFB 1IKNC 4FFWD 3CCHB 4QF1A 3WFHB 1MAJA 3WKML 2B39A 3HNTL 4H1LH 4OGZA 2VR5A 4CNIB 5D7JA 3RL2B 5DJ2A 3TZVD 1ZT7B 1DBAH 2H26A 4JZOB 1RJCA 3W81A 3UZQA 4L3EE 2FBJH 1JHLH 3OXRA 4U1MA 2YD4A 2A73B 3EYQD 5GS1B 1QSFE 3RPIB 2GJZA 2W0PA 5AWNL 1QKZL 2Q6WA 2EYSB 3RJDA 3SJVE 3FQWA 2F54D 4Z95L 3KXFB 4XP5H 4QY8A 3TV3L 3SDXE 1A6UL 3VXUA 2DMBA 3KPSA 2F5BH 2HVKB 3CFEB 4ESKA 3EDDA 3BW9B 5J11B 1IAKA 5DEFB 4YX2H 2BOCA 1NJ9B 4Q6IB 3TEUA 4G8GB 5F93C 3CU7A 5FYKE 3T2PA 3RVTC 3BYYA 3CK0H 1E4XH 3QG7L 2DJSA 5BRZB 3FZUC 2ZUVA 4I5BA 4LFHD 1YUHB 1N64L 2Y06L 1A1MB 2Q20A 3RNQB 4KK9C 5I15H 2QQNL 3MLTA 2A74B 1S7QA 5DHYA 1MJJB 12E8H 4MB4A 2DWDA 3IFLL 1SYVA 2QR0B 3BSZH 1U8PA 4X7DC 1IQDA 3X13A 2OI9B 4JPVL 4LGSB 4BQ6A 5C71A 2FIRT 2NXYD 5C09E 3OZ9H 3VG0H 1TCRB 4LFHG 3QA3B 3MNVA 2OSLA 3L3DB 1ETZA 3O8XD 3D0LB 2BK8A 5EO1B 1D5BB 1MJUL 1UC6A 5C70A 2XTJC 2CDGA 4ZFOB 4WFED 1G9NL 3K1KC 3P4OA 2VKXA 1TVBB 3QEQA 4NGHH 4BH8B 2VDOL 3LZFH 4L1HA 4PJDA 3GHBL 4JFDB 2HRPH 5B22A 3RHWF 4K71B 2HLFD 1IC4H 2DQFA 3FHQA 2ICCA 2Q3ZA 4G9DB 3RVVC 4O9HH 5ILTL 5C08A 5K9QI 1NANI 5FYJE 5D1XD 3BE1H 3UBXG 4PJ8B 5L6YL 3O4OC 4EI6B 1T20B 3CZFB 3DV6B 1KB5A 4JFZH 1RZJL 4PJ9B 2JCCA 3KJ6H 3IJHB 3PWPA 2VLKA 5FB8B 4DVBB 4OLXH 1MWAB 3DHJA 1JBJA 3CDYA 3GJFB 5EDXA 5C0FB 3WNOA 2HJFA 5C0AD 1VFAB 3VU2A 5F71A 4P5TA 3R8QA 4D8PB 2W60B 2WUBL 3V0WL 2EDNA 3MUJA 1MREL 5DD1L 3WO4C 3EFFA 4YHOL 2E9IA 2PYEE 1PSKH 3CDGA 1FYHB 1MVUA 5J1TC 1U3HD 3ARBD 3DPBA 5CP7B 1G7QA 1H8SA 1KB5L 3FQUA 1VFUA 3ZE0F 5CHNB 5GS0L 1OARH 2NW2B 1JVKA 1TJGH 3BP7A 3OB0K 4RWHA 4PGDA 5D7IE 4I8DA 4NQVB 1GZPB 1UADC 3UROR 4WRLA 3AVEA 5I18L 1LE9A 4ETYA 1K9TA 4XBPA 1LEKA 1BFTA 2JIXD 4KV5F 4KU1A 2DL9A 4HS6B 5DC4B 1JGVH 3EZ8A 2F8XC 5IUSA 3HRZA 1HINL 4UT7H 4PRPE 5FOJA 1IM3B 1HHGB 2C4FU 1QSEA 2DQHH 2VDMH 5D93B 1NAMH 1Z9MA 2ZSVA 3C8HA 2NCMA 2FH8A 4MDJA 4F2MB 4ODXB 1AC0A 4RGMB 3T65B 2XXCB 4J3WA 4OI8A 3RIAK 5I73C 4QXUH 5JW4N 4HKZA 3PDDA 2VH5H 3SKNA 1G9MC 1WBXB 3QZWG 4GUPA 4YHNA 4Z7UB 4P4RA 3FL7A 4CL7A 5IEHA 1HSAA 1ZWIB 4OSUH 4PJ5B 3HC3H 1QBAA 3QDHA 2GITB 5IMKB 3IETA 4Q2ZA 4X6CF 4CDGC 2NTFA 1I9EA 1FFRA 5C0NC 4R90L 4X8JA 2W9EL 2XKSA 3ULUD 4QHMA 3QPQD 1JHKH 4JFXA 4CMHC 5GSRB 3HZMB 4KZEL 35C8H 3RTQD 1R5IB 5ICXB 2APFA 2Y6SD 5KW9H 4LOUD 2PR4L 5AUMA 3SE9L 1T1XB 2GFBB 4Z76B 4H1LB 1J1OH 2MMXA 2Q7NA 3SKMA 2D7TH 1T89C 2OR9L 3MBED 3MRGA 4RGND 3VXNA 5L0QC 5CUSL 2A38A 5ACZB 5I1CL 4NDMA 3U0PB 3SCMB 3QDAA 2DQCL 3SE8H 5JORA 1MCOH 4K7PX 1RMFH 2VIRA 3F6LA 3GK8L 1A3RL 1RURL 4LCCB 4ZAKD 3HI6H 4XXCA 4W68A 4M7KL 2FECL 5SWZA 3ZKXC 1IGTA 2P44B 2PTTA 4NZRH 4OZGA 5F44A 4R4FL 2NLJB 2AEQH 2GK2A 1JNNH 4TPRH 4IRSC 1DANT 3H7BA 4IIQA 1CFSB 5IF0A 3S34L 3HKFA 2HA1A 2NZIA 3MFFA 1EXUB 2V2WA 4LLWA 3NAAH 5A16A 4PTUA 1ACZA 2M2DA 3H3PH 4OLVH 5IEKA 3AM8A 4UQ3B 3R1GL 2Q1EA 3MJ9H 1YECL 3SGEI 5MEOB 1KXVC 2IQ9H 3EOAB 2EDXA 3CNKA 4AMKH 1ACYL 3DETC 4PJIF 2FD6L 3WXVH 3BMWA 4FFZH 3WDJA 1DLFL 1NCWL 4WENB 3SKJL 1G6RB 3HS0A 2O61A 5D71L 3LD8B 1X4ZA 2WIIA 1T5WA 3OXSB 5T3ZE 1RV6X 2DN7A 2BXZA 1Q0XH 2Z35A 4BQCA 4IHOA 5IFJA 3UAJD 4GG6A 3GSVA 3VRJA 1ZS8B 2CLVA 3QUZA 1KPUB 4X0KA 4Y1AB 5E6IC 1RSFA 5JPNB 2X4SB 4OZHA 4R6UA 3E8UH 3U79A 3IRZA 2OL3B 4QTHA 1FBIL 3EOTH 4MAYB 4G42B 3MA7B 3V0AC 2DLEA 1CVRA 2CKNA 3D18B 4P23A 5I1KL 3T4AB 1CDUA 3LEYL 4QRUB 4U6YB 4WI2A 2BY0A 3MXWL 4OJFH 3S4SG 4M6AA 2ZJSH 4JZOA 3OKEA 2JJTA 4PJFB 4MLSA 4ODTL 3CMOL 3L5WA 4AT6B 1KB9K 2EDFA 1EMTL 3EDKA 1FSKB 3UTPE 4QYOB 1CT8B 2YD8A 3P4NB 3RPIA 5DA4A 1R3IH 1YNLL 4OT1L 3L95A 5KN5B 4OLWL 1S9KC 1Y18B 1CD1B 3FAXA 4BQ9A 3HAEA 1ZEAL 3C08H 3KXFA 1FO0H 5J7CC 1T5XB 3MV8B 3QIWC 5IR1B 1ZK9A 1EFXD 1R6VA 4FQXD 4K3EH 4JKPL 3ZE0E 2HVKA 4GW5A 3ORJA 1JNJA 4U7SA 1NJ9A 4PREA 1G7HB 4NIKB 4G8GA 1IEBB 4DAGH 3AS2A 1S7UB 3STLA 4HK3J 2I25N 3Q48A 2JKXA 4QRPE 1VSCA 5FYLL 1K6QL 5MEQB 3DGGA 4KV5E 4J6RH 1YUHA 5C07A 1A1MA 1NEUA 4IJ3B 4X7TA 4NQSA 3EOBB 1CXFA 4X8XA 4JZJC 3V0VA 3UAJC 1EVTC 2A74A 4X7SL 1MJJA 3ROOA 4HWBH 3S96B 3HG1D 4YXHL 2QR0A 4E41E 5C0CD 4NKOA 2P46B 4D0CB 5BV7L 4KJWD 5DJ0B 2ESVB 2P5WE 4HXBH 4NUJA 2WWMD 4E42B 4LHUD 1TCRA 3TM6A 3QA3A 3ZTNL 4LSTH 4G8IA 2HKHL 3V5HB 5EO1A 1D5BA 1HNFA 1VFMA 25C8L 2WIMA 4OM1L 1UVQA 2VSDA 2X9WA 1RHFA 4ZFOA 3ULUH 4ZO8A 4NUGH 5DEZA 4BJLA 4APQB 4M5YH 3ARWA 5TQ2H 4BH8A 4QT5B 2G5BB 2X1WL 4X6CE 4JFDA 5CIPH 2VLLB 1UA6H 3KPPA 3MCKB 1TZHA 4XX1G 3VDAA 3C9NB 3TNNB 5C9JB 1X5XA 1SJHB 1L9NA 2ZUWA 4L29B 1DQML 5F7DB 3P9MB 1JV5B 1QVOB 4M3KB 5JOPE 1ZHNA 2QSCH 3TT3L 5D1ZD 2ZZUT 1P84J 1S9VB 1OAYH 1TZGH 3DV6A 1PG7H 5KTEH 4PJ9A 2FX7L 4OFVA 2PW1A 3VW3H 3IJHA 4ZFOL 1NCCH 5CD5C 4NQCB 4DVBA 4JQXC 1MWAA 3GHEH 3O4OB 4YWGL 4QRQB 1HCVA 5C0FA 3K80A 2RIKA 2VC2L 3WLBB 2XZQL 2C1OB 4OFDA 2IH3A 4GRLD 4NM8L 5ITFB 1A3QA 4D8PA 2W60A 2NNAA 3G04B 4KKCD 3RWDB 4M1CD 3ZYIA 5CP7A 4LQFH 5CHNA 4YPJA 2ZCLL 2J8OA 1Z5LB 1D5ZA 3T0WA 2B1HL 1BFSA 1GZPA 4P2CG 2VDNH 1MWAL 1GZQA 3LRSB 3GSOA 3QQ3B 3D25B 3DTXB 2J12B 3HMXH 1M1SA 2NY1C 4H25B 3BH9B 4O5LH 1HHKA 3G5YA 4I18A 3NBNA 5FO9B 1I1RA 3KYAA 2NXYB 5CP3A 4V2BA 3S37X 5D5MB 1ZLSL 3C8KA 4K8RD 1HSBB 2H3NA 3DWTA 2DTML 1DQDL 3U7WL 1CTNA 2AABH 5BO1H 3FCTB 1SVZA 2EC9T 1J0ZA 4F2MA 3MV9D 4ODXA 3T65A 4KUCF 2G9HB 4QOKA 1EBPA 2NX5B 3EHBD 2RBLA 3VFNB 4DZBA 4MJ4A 3VMPA 4KHTL 1N64H 1DTUA 2ED9A 4Z7UA 5GJTL 2XA8L 3F58L 1ZWIA 2D4FA 4IOFD 3U82B 2EXWD 3O2WH 1U8NB 3M1BB 2J8UB 2GITA 5IMKA 4NOBA 4OLUL 2EYRB 4OIIL 5C09A 4NJ9L 3NCYP 4M5ZL 4BM7A 5JDSB 3DUSB 1XGQB 5D1XB 4JPVH 3WNLA 3DBXB 4IM8A 4XBEL 5GSRA 3BPCB 3QUMH 1FPTL 1R5IA 5ICXA 4GRLC 5E0QA 1T6WA 2VQTA 3SEPA 2YA2A 1YNTB 3MLRL 3NOIA 1MELA 2BY3A 3T2OA 3UBXI 4LLMB 3ARYA 1T1XA 1FL5B 1MJUH 4Z76A 1OGTB 4CN4A 2X4QB 1N6VA 5E00A 5GHWH 1LP9B 1G9NH 1S78D 5C0AB 4OF8A 3SGDI 5D4QA 5ACZA 2DM4A 2Y5EA 5BCAA 3GBLA 5I1EH 1PKOA 5K33A 4BSJA 1EDQA 3UCRA 3T0AA 4LCCA 4NRZA 1U3HB 5L0QB 4NRXA 4HKXB 3W11D 2W0KA 4MJ6B 1CGSL 3N50A 3WFBH 5L6YH 2NLJA 2HWZH 5A2FA 1YEHL 4KMTL 3REWB 1EO8H 1CFSA 4KTEL 5IB1B 1RZJH 4PJCF 4P3DA 2FB4L 4JRYA 1AFVL 1L4IA 1JE6A 5HPMB 4K7PY 1OAKL 4KKAC 3JV4A 1ORSB 2BSSB 3VWKA 2R0KH 1KG0B 3CX5K 5JIKA 5FECB 3QZWB 4HKJA 3JWDL 4UQ3A 2V5MA 5IM7A 4N0UE 2BVOA 4O51B 4ZUWA 1AGBA 3RA7L 4RDQF 3NCYS 2NY4D 1L0YA 1UG9A 1SBSL 1MRCL 4QWWC 3S8WA 4R97B 4YQXH 2IAND 4PB0H 5ANMB 1G6RA 3GKZA 3O9WD 4G6KL 3WS6A 1P4BH 1UB5A 1RFDL 3HC4L 3OXSA 4G5ZL 1CVSC 1DFBH 3WJLC 5J4MA 4KVCL 1AD0B 2KDGA 3QCTL 1E6OL 3QI9A 3D69A 3S36X 1HN1A 3DMMA 1ZS8A 3MV01 2FGWL 3LS5L 4Y1AA 4K7PL 4RMVA 4HPYH 2DJ4A 1J0KA 4UB0H 1I8IA 3TIEB 3RTQB 1S78C 1AC6A 2G2RB 2OL3A 5ICYB 1CWVA 5KSUB 1G6RL 5HYQA 1JWMB 1IGIL 1U8IB 1XF1A 1I9IH 2QSQA 5HHME 4G42A 3ARFC 2ZP0T 1CFNB 3MA7A 4QHUA 2ADJA 2DMKA 4TSCH 5MI0C 5MEPA 3MBEB 5D7KD 4RGNB 1K5NB 2HTKD 1R3HB 2VITB 1IKNA 4PBWD 3WO3B 3UYOD 5T1LD 3W9DA 5BMFL 1I3UA 3D39E 3MV7E 4ZAKB 1ZGLM 4FQQA 3V4UH 4AT6A 1AI1H 1JGDB 3PP4H 2BSTA 2OL3L 1CT8A 1NGQL 4U6HB 1H9VA 2XKUA 4N1EA 4BSVB 3BWAB 3NA4A 1T5XA 3MV8A 2X9XA 4NQDA 1UZ8B 2DM3A 1RIVL 3V8OA 1KENH 4K2UL 4XRCB 1T2QL 1YMME 4WHCA 3QQ9C 4WUKL 5I1CH 1GCFA 3QIWB 4C56D 4OCYH 1S7UA 5EUOB 1IGFH 5F7WC 4NO3B 4XMKL 5MEQA 3GK8H 4NQXA 4YHPB 3CPLB 1CZ8H 1KIPA 1YEDA 4OLZL 4WY7L 5CWSA 5HGGS 2BP3A 1FE8L 3VXPB 3E0GA 3EOBA 1ZA6B 5DA0B 1IILE 1Q9WB 3BAEL 5DMIL 4AEIH 1FNEA 3I6GB 3QDME 4M00A 2XZAL 4Y5YC 4P2RD 2R69H 2KKQA 3CU1A 1JF1B 5EA0L 3HFML 2FO4B 1MCNA 3OGCB 1NKOA 2WMPA 4D0CA 4DGVL 5JHLL 5DJ0A 2ESVA 4OBRA 1J0IA 3TYGH 2VLRE 1CLOH 4U1SA 4EUPH 1U8HB 3RX7A 2DKSA 2BC4A 2XFXA 1BFOB 3V5HA 2AJ3B 2QL1A 3S4SB 1NGYB 3UC0L 2BVYA 1MPAH 2Z8VC 2J6EH 5ALBH 4TTGA 4OZIE 4YNYA 1MIML 1NMCB 1GSMA 5L8JB 3QH3A 4QT5A 2G5BA 5TE7H 2C3GA 3ARXA 3D85A 3BP4B 2C3HA 3MCKA 3RGVD 4P4KD 3I75A 4OZFG 2VXQH 1K4DB 4GBXD 5ESVB 5E2WH 1JV5A 3LKSB 1BHGA 2IFGA 4L3ED 3BKCL 1JHTB 4MNHB 4PJXE 2H1PH 3FB6B 4M1GH 2R29L 1S9VA 4Y4FC 4ZS6D 1CD0A 2HFTA 1QSFD 5JQHC 1JYWA 4OGYH 4U6TA 3QT2A 4JEGB 4NQCA 4RMUA 3SJVD 4PJ7A 2XQYG 5JIPA 3FT3B 4QRQA 1H5BC 1YEJH 4Y16C 1QNZL 3WLBA 4OD2B 3ZZ1A 2C1OA 3EDEA 2HH0L 4IMKC 2I9TB 5ITFA 3RVUC 1OY3B 5I17B 3C09C 4LIQL 5FUOH 5HGDB 1JGUL 1EFXB 4FQXB 4WCYH 4PRHE 3TCLA 2ILLA 3W39B 5FYKD 4G43B 4UV4H 1A9EB 3MXVH 1XGUB 5JW5B 5JA8B 3BOVA 1EVUA 3U30C 2OK0H 1Z5LA 2HKFH 3AY4C 5AYQA 3ARGD 2WQ8A 1P2CB 4ODTH 3LRSA 4JY6A 4PYHA 4BUGA 3QQ3A 3LS4L 3RUGE 1IGCL 3DNKA 3DTXA 1J1XL 3T0XA 3Q6FB 3RAJH 1RUQH 2VE6B 2HJKB 1NMAL 3GB7B 4MWFB 5EBWA 3KPMB 1BZ7A 3G6JE 5DRWB 5C0CB 3DUUB 5FO9A 1CXHA 1U92B 3UTQA 3D9AL 1NFDF 1I4FB 1CDIA 3PL6D 1HSBA 1T04A 4LHUB 1S8DB 1OW0C 1V5JA 1HYSD 1M71A 1PQZA 4ZSOE 3BKJL 1XR9B 2GJJA 3UBXA 4MA7L 4P4KC 5H94B 3O2VH 5FYLH 2NX5A 3VXMD 1BVLB 3EO9L 2ICWB 1FH5L 1J0YA 3QXDB 1NLDL 4HIHA 1KN2H 3U1SL 1AH1A 2IJ0C 5JDSA 3DUSA 4RMRA 4QEGA 1BD2B 4BZ2H 5BV7H 5D1ZB 4AEEA 4WUUE 3BRGC 4LSPH 4HIXH 3BPCA 5E8OB 1OP5K 1ZHLB 1QR1B 5L9DH 2AV7B 4LLMA 1S9YA 3HCVA 3RJQB 1KSRA 1OGTA 25C8H 3HNVL 2BOBB 3DX8A 5ETUB 2P8PB 4GRLB 5C0AA 4DGYH 5T5NG 1KTRL 4HULB 5DHVA 2PKDA 5GRUL 4NWTH 5HGBA 1G9ML 1U8QB 5A3IC 3MJ6A 5AZEL 4EOWH 4LCYB 1NANH 3ZHDA 4Y5VC 1T89A 4BFBD 3KPRE 1DQMH 2APVA 2D9CA 3MRPA 4Q9QH 1CBVL 3B5HA 4X4XB 1XMWA 1GAFL 1DN0B 1VPOL 5HPMA 4IRSA 4KAQL 5FECA 4PLNC 2VC2H 4TQEH 3WFCL 1AE6L 3QZWA 3KVQA 4PRPD 1B0GB 5AEAA 3QSKB 5IWLC 1LE5B 2LE9A 2DBLH 2H32A 2YBRB 2CGRH 2HFEB 2D03L 3PGFL 3PIQB 4RWYL 2OZ4A 2CR6A 3K4ZA 1F8TH 4NFCA 4PJAE 1F02I 5IJVA 5KS9F 4GXUN 1YQ2A 1A7NL 3MV9B 3S88L 2J4WL 4RA0C 1OVZA 3FMGL 2B1HH 4Y19A 5F21B 1CLZL 7FABH 1X5ZA 2CUHA 4DK3A 2V7NB 2D3VA 1AD0A 2D4DA 1VENA 3DVNB 4Y5XC 1YYLL 4KZDL 2FX9H 15C8L 2OZ4L 1UM5H 4MA1C 4QCIB 4EBQL 4R2GD 5I1LB 1YEIL 2X89D 3MCLL 4DKFL 5IQ7L 2DTMH 2G2RA 5ICYA 2EYTB 1JNLL 1JWMA 5IBUG 3S5LG 1HKFA 1T7XA 2LFGA 2AGJH 5E6IA 2BXYA 1V7MH 3RI5K 5I0DA 1QYGH 1HWHB 1K5NA 3U36B 2HT2C 2QADD 2VITA 1INEH 1CK0H 5IVXB 3F58H 5INDB 1K2DB 3DIFB 3TBVA 4IRZL 4DGIH 3QRGL 4F9PC 4ZUTB 5CP3H 4FA8A 1MCRA 1KFAH 4R4BA 4N8PA 1JGDA 5FYKH 4U6HA 3IS0X 3O6FC 3SY0B 4BSVA 3DX7B 2FCBA 4P2QE 4YDJB 3VFMA 1RD6A 5I19H 3B2VL 1MVFA 1FYTA 3O3EA 1OQXA 1UZ8A 5TQ0L 3L3IA 2Y7QB 1Z9LA 5DT1L 1RZKL 3ARPA 1UKSA 5F8RC 1FG2B 3FB7A 1E6JH 3W82A 1I7UA 2F5AL 4X9BA 2X1QA 4L8DA 1MRDH 5FGBC 1ODAA 3QIWA 1AJ7L 1AD9B 4LLQB 5ISZA 3S3PA 3CSPA 3CJJA 5EUOA 4F7TB 1LEGB 5CINH 4DN4L 4YHPA 2P24A 3O3BB 4NO2A 4MVBC 8CGTA 3MYZA 3M8OH 2VN7A 3H42H 1WK0A 5T3ZD 3N1GC 1AGCB 1B6UA 5EORL 5IW6B 4N0FB 1D5XB 3BZDA 3P4MB 1NFDE 4RA3A 3RX8A 2QQKH 2FSEA 3Q6GL 5GZNC 1IGJB 3MLYH 1RK0B 2MCPL 3QUXD 2IC2A 1S7RB 2HRLA 5IP4A 2V17H 5ESQB 4JZJA 1SY6L 1DN2A 2GHWB 4HCRA 4YBQD 3DXAB 1YZZA 2GTZB 4FZEL 1A7RH 3SGEH 5FYJH 1U8HA 2ADFL 1BFOA 4AL8H 3S4SA 1NGYA 2RR3A 4ZG1A 3OAUH 1INQB 1ZANL 4HIEB 1PZUB 3RA7H 3VFUB 2K7QA 1O0VA 1EBAA 1OM3H 1A6WH 1FL6A 4LPUA 2K3TA 1SBSH 5E2UL 5JW4M 3AB0C 1UWGL 1G7PB 1JFQH 1TIUA 2C5DC 2LU4A 3EFDH 2VDPH 1K4DA 1DANU 1ED3A 4UUJB 5CZVL 1NCDH 5MEND 4G5ZH 1XF5A 4U0RC 3LKSA 3L7FB 2C7UB 5T1LB 1E6OH 3CFJB 1JHTA 2Q7YB 4MNHA 3FB6A 3UTPD 3GO1H 1I8KB 2AEPH 2YMXH 3TIDA 2VZOA 3CFBB 3E2HC 4WV1C 1S7SB 3FT3A 3BUTA 1YEEL 2UY6A 2BNRE 2I9TA 2P5EE 5I17A 4OCRH 1EFXA 4JQXA 4ZOEA 5D2LF 3MROA 1H5BB 2CXKA 3W39A 4QRPD 4G43A 1A9EA 1IC7L 5JW5A 1QFWM 4C56B 4DOHB 3X3GL 5D70L 3QG6B 3T0ED 3TO4D 4LLYA 5JXAH 1EH9A 3C5SA 4NWUH 5DMKA 1ZVYA 5KVEL 5L88L 1MCPL 1OLZA 3IXTA 2C3WA 4WU5B 4CVZB 4WEMB 4E41D 3U30B 1NGQH 4ODWA 2HJKA 2O5XH 4P2RB 1P6AB 4MWFA 4DJMA 4HIJB 1MFDL 4HFUH 5J13C 2P5WD 3K2UH 5DRWA 1BVKA 4PP2B 3DUUA 5DS8A 3MRKB 4NHCL 4K2UH 4NFBA 4OZFB 2VXTL 2DF3A 4PLKC 3P4LA 1WFNA 4FFYH 3V4VH 4HX1B 3MOAH 2F74B 3C87A 4YHYB 4R0LB 3QUYD 4WVRA 2XV6B 3HHRB 3OF6D 1BVLA 5SV4A 3QULA 4JO1H 1SEBB 5JDJA 2R39A 4W4OC 3RGVB 4P4KB 5ECJE 2VXSH 3LPWA 3QXDA 5DMIH 4GBXB 5JOPD 1PJ9A 4TULL 1XF2B 1HIMH 1FNHA 3G9AB 2X7LB 2A9NL 1BD2A 3NFNB 5H37H 1AGDB 2BJML 4L3EB 2IADB 5JHLH 1TVHB 1QSFB 4ZUUB 5E8OA 4H5SB 4S1DC 2X40A 5GGRB 4JFQB 2AV7A 3SJVB 1F4XH 4TOYH 4WW2B 5HJ3B 1F58L 4M8VA 3MNWB 4OZ4A 4I3GA 2BOBA 3X14A 5TDNA 3EO1A 4PJGB 4WI6A 2GJ6E 2P8PA 4TVPE 5TE6L 4XCEB 4NZTL 4GRLA 1X5AA 4MCZB 1QA9B 1EEZB 4FZ8H 1IAIL 4LPTA 1FLRL 4NCC2 5EZLB 3T0EC 2O26U 1CG9A 4Q58C 1CL7I 2YPLD 2CDEB 5EU3B 4GAYB 1T21A 5D2NC 5I76B 4HGWA 4LASL 3TWCH 3BRFA 4MQXD 2OJZL 5I75C 1EEYB 1T3FB 4L4VD 4M7LH 5DDHB 1MFAH 4Y5VB 4HEME 4FQPA 3O4LD 2YRLA 2GYSA 1PKQE 3VGBA 3VFSA 3THML 1QNZH 1KBGH 4QRRE 5HSFA 1B0GA 1LE5A 4WTWA 2QHLA 3BX7C 1MCLA 4YDKL 4HMDA 2YBRA 2HFEA 3QHFL 1BQHB 2W0FA 1JPSL 3PIQA 3OKDA 3WHE1 3OG4B 1Y0LB 5C2BH 3U7YH 2V9TA 1LO4L 4LNRB 2BVQB 2QHRL 1DQJA 4ZFGL 1LQSR 2Q8BL 3IFNL 2YUVA 2OLDA 4PR5A 3SDCC 1S7WB 3GSNH 3VXMB 4NN6B 1ORQB 1L0XA 3SGKC 2NZ9C 2V7NA 1HE7A 3G6JA 1LO0L 3RRQA 5KBNC 3WD5L 1NMAH 1YPZF 5HI4D 1KLGA 3O3DB 3DV4A 3RDTC 1GRWA 5LG1A 2I27N 4K8RL 1HH6B 1GPOH 3WJLA 2PXYD 1KN4L 3CLEL 1YQVH 4JDVA 5HDLA 1EGJA 1A0QL 4JDTL 4OIBA 1Y6KR 5IBLC 2E7MA 3QQNA 1E27A 5F7KC 5FUZL 3BKJH 1I7TB 5E2TH 3R06B 1SYSB 3MA9L 4CN6A 2NY2D 3EO9H 2OCFD 2V2XB 1LDPH 1JYVA 1FZJB 2KL6A 3MX0A 5IVXA 2DM2A 3ARFA 4RIRB 2R2CA 4JHAL 1NLDH 5LCVL 1RJLB 3MUY1 1FZMB 3H3KA 4U6VL 4YO0A 4RFNB 2WWKO 1DQQB 1M05A 2BNQA 3WN5C 4F37K 1KNOA 4WFHE 2IBZX 3MRBA 1J8KA 4EEEA 4UT6L 4Z7VE 4GQPH 4OTXL 5KOMC 5D2LE 3VXRE 1FGNL 2EC9U 1C5BL 2Y7QA 3AFLA 3O6FB 1EHLL 3F7PC 2AK1L 1FG2A 3S6CA 1BAFL 1QLRB 4PRPB 5GRUH 1AD9A 4LLQA 5FCUH 4NC2B 3E6HA 4F7TA 4PRIA 1LEGA 2V5RA 5CEXB 3QO1A 3O3BA 1FZOA 2E7CA 3ZHLA 1YDPB 2AJVH 1A6VL 4P5KB 2ZUSA 5IW6A 4Z0XA 2ZG1A 4N0FA 4O2EB 4NRYA 5FM4A 3P4MA 4MNGB 5DJAB 1MCWW 4UDTA 5E6YA 4OCNC 4J1UB 5HYJE 3MYJB 1RK0A 3D48R 5TJWK 3S5LB 1A2YA 3CVHH 4F57H 1MCWM 3T77B 2VERN 1ND0B 2BRRH 1JZ8A 3DXAA 4Y5YA 4LVHB 5F9DC 3VXOB 5HHQB 1N26A 2MJWA 4AIXA 5ID0B 4R2GB 1XGPB 2UWEB 4XCYB 3T4YB 1H3PL 1K8IB 1GH7A 3VFUA 4LVOC 5M95B 5T1DH 1BZ9A 4HG4J 1CICD 2AJXL 1A7NH 4XC3H 4NQEE 5IOPB 4N5EC 1WWWX 2DQJL 2YN5A 3D39D 5ESAA 4U31A 4UUJA 3T0BA 3MV7D 1ERNA 1OPGL 5LGJB 2QADB 4DFIA 1DL7L 3PQYD 2Y5TA 3TA3C 4JQVC 3ZL4L 4MD0B 2VLJE 4G6AC 4MXQD 2H32H 4JN2A 4PJHB 1MCBA 1I75A 3KPNB 4HK3N 4YHLH 1I8KA 2OZ4H 3QNXB 2R1XB 5E03A 1S7SA 2LQRA 2OTUA 2NY6C 5D1QD 5ERWA 4PLJD 3MCLH 3LHPH 2GTWB 2R4RL 4MD4B 4Y4FA 1U36A 2PYFA 4JAMB 2Y1VA 1YMMD 1F45A 4BSWB 5CLTA 3CSBA 4UTAH 1BM3L 2W91A 2J7LA 5KAQF 1UYWH 3ZT5A 4ZTOH 1H5BA 4DKDC 1S7XB 3MLXL 4Y16A 5FXCH 3BPOC 4WWID 4ETQB 1RZGB 5T3XD 4IMKA 1LWRA 2DDQL 3O6ML 4C56A 2G75B 1VB9A 1J8HE 3DX6A 3PP3K 2AI0L 3RPKA 1CGXA 3HNSL 4JM2C 3UYRL 4IRZH 3VGFA 2YWYA 2ZCKH 2EH7L 4NSKA 5HHPB 3GBMH 2MQCA 1YMHB 4WU5A 4CVZA 5CJ8A 2HJLA 3OKLB 3FONA 5DJ6A 5J3HD 1FC2D 3AY4A 3K3QA 4O02H 3CFIC 2DIAA 4YFLI 4HIJA 2HN7B 2XY2A 4UAOC 4U49A 2W38A 4PP2A 5C0BE 3DI3B 2VLRD 3QNYA 1M4KA 2EZ0C 2WBWB 4KUCD 4X9IA 5TQ0H 5B8CC 4P9HL 1VFBA 2BMKB 4RAVB 1KTDB 4OZFA 3V5KB 4NBYB 3B2UC 2FYYB 5HD8D 5J13B 5HY9A 4FQHB 3ILPA 1AJ7H 2FIKB 4N8VG 5EPMB 4HZLA 2F74A 4OD1L 2WANA 3U83A 3P9LB 1OW0A 4RBPH 1YPZE 1FP5A 4EI5D 3KPTA 5KZCD 3KLHD 3BD5A 4P46C 1SEBA 2HYMA 5GGRY 4JCLA 5EORH 1N7MH 5DMGD 4P4KA 5EZOH 3TYFB 4LL9A 5JXED 4ZODA 5MENB 1EA9C 2X70A 2VZVA 1U8JA 2X7LA 3NFNA 2GAZB 1XAUA 4WHTB 1RPQA 1TVHA 1HQRB 1T2JA 4F58L 5EFIA 2EEBA 3MGTA 3NGBB 2PNDA 2WK2A 1HKLH 4YPGA 1OAUL 1R24B 3BP6B 4JFFE 3UTSE 1NBVL 2E7BA 5HJ3A 3ZO0A 2A83A 3K81A 1LVEA 1ZANH 3AREC 1KOAA 4XCEA 4ZPVA 5IFAL 4FQ2H 5GISL 4E0RB 4MCZA 4PRHD 2JTDA 1MUJB 2AQ3A 3U4BH 1L7TL 5EZLA 4XCCL 3FQRA 4XI5C