2K7PA

Filamin a ig-like domains 16-17
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
188
structure length
188
Chain Sequence
b'GAMAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Filamin-A
publication title Atomic structures of two novel immunoglobulin-like domain pairs in the actin cross-linking protein filamin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 32
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k7pA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k7pA01
1JVKA 4UV7H 2X4RA 2QV2A 4OQTH 4LDEB 1QEWA 3RVUC 3QDGB 4IRZL 5CWSB 3UC0H 2UWEE 2I27N 3MUY1 5C0CA 1RUKH 4MNQD 3L7EA 2F15A 4K8RC 1YEFL 5IQ7L 2BSSB 2WAHA 2D4FA 2V5RA 4ETQB 3SN6N 3TBVA 4CJ0A 3TVMA 5JW5B 1TVHA 3A67H 1GIGH 1C1EH 2EH8H 5HHQA 4M3KB 4Y4FD 1WWAX 1C5DB 1LDPL 3KJ4C 4S1SH 2W1NA 3ETBF 2ZCHH 1PKQB 4UIKH 1FVCA 4ONFL 4E41E 4OBRA 1BMGA 2O26U 5GS2D 4G6JH 4NT6A 4L3CA 3X12B 4A6YL 2E7LC 1NLBL 2H32A 1FFRA 4ELMA 5BOZG 4JFDE 4LP4A 1LK3H 2B4CL 1HIMH 1UWGH 4RGMC 1NAMH 2X4QB 1MUJB 3GSWA 2FB4L 5IW6B 5I73B 2XZAH 3WYRA 5E5UB 3LHPH 1HINL 4OIIL 4RGNB 3MRGB 4QXGL 4OI9A 8FABB 3GZKA 3RWDA 2DTML 1RK0B 5HGDB 1WAAA 4RIRA 2J1KA 1OLLA 4YPJA 1G7IB 1RUPH 1U9KA 4LPWA 1QOKA 4KK8C 2CRYA 1G6RB 3B3IA 1BF8A 2IQ9H 5C0ND 5JXED 4MA1C 3QFJD 1NANI 5IB3B 1CVRA 4XVTH 1I7ZB 4WI6A 3PP3K 3PXJA 3U4EA 3WO3B 1KBGL 4Y5VA 3IAPA 1KG0A 1JYXA 1NBYB 2QQLH 5GZOD 3CUPA 3MLTA 2OR7A 5FGSA 1BPVA 1OAZH 2X4SA 3ARBB 3T0EC 3FRUA 1IAIM 4X6DE 1JZ2A 4Y5XC 4PD4K 2YRLA 3BXNA 4EUPA 2A6DB 1D5BA 1G0YR 1K2DA 3L3OB 1L0QA 2ITDB 4RX4A 3G6AA 1A3LL 2DQGL 1X5YA 3JWOC 2DM2A 1F45A 1EHNA 1JGLL 4OF6A 3FT3A 3WO4C 1MIEH 4K3GA 5KVFL 1FZOB 1RUAL 1GC1H 1QKZH 2EDJA 3MNZA 3CC5A 3E2HC 5E03A 4JQVA 5D7LD 4W81A 4N0FA 1CXKA 4KKAD 1A7RH 4AY0A 2HVKA 4ODSL 1FDLH 4PREB 4I5BA 1S7VB 1QR1B 1RJLB 3BUYB 1PEZA 1KCSH 3O2WL 1EFQA 4MXVE 4Y5YB 2Q6WA 5EBWB 3V5HB 3ULUE 3NIDF 5E08H 4BELD 5K59E 4NPYB 1FNFA 4E0RA 4WUKL 4A6YB 4G6MH 5JR1L 2OM5A 3OKLA 1KUMA 1MPAL 3Q1SH 4BFEA 3CSYB 2E5EA 1DTUA 2QL1A 3CD4A 5L88L 4P2OA 2DRUA 2HT3D 1MRFL 4Q58C 1QSFB 3WFHA 1KPRB 2C3HA 3ZT6A 3UTTA 2EZ0D 5H35B 1I8MA 1T83A 1DDHB 3K8LA 5D1QB 2XTLA 4HJ0D 1ZT7A 3KNBA 5KSVB 2VLKE 5C7XH 4EI6B 2WINA 5DF0A 1G7PB 3O6LH 1IJ9A 3O6FB 4LU5H 4R90H 3DNKA 5KSBE 4GBXB 4P5MA 4OLZH 4PRPD 3V0VB 3C60B 4KJPD 1K4DB 2UWEF 3RWJA 3SGEI 5F93C 3NCYS 1F2XK 4WW2A 3E6FA 2PYFA 2AJSL 5C0AB 2AQ1A 1CE1L 3FCTB 5DJ0A 5F9AC 4J8RA 4PR5A 3S5LG 2FO4B 5ICXA 1VADA 2NY6C 2VDQH 3MV8E 3PWLA 3GSUB 3G5XA 5DR5H 3BPOB 4KK6C 5CILL 5T1LD 3PL6A 3T1WA 1U3HA 3C8KA 3LIZL 1AY1H 4IIQC 1RZJL 4QYOB 3TIEA 1LK2A 2FSEB 3RZWA 1FG2A 3QHZH 5FO7A 2F74A 5HGGS 43C9B 4GO6B 4OZ4B 1ZK9A 1CGTA 2ADJA 3MCKB 3SHSA 4V1DB 4HHAA 5D8JL 3QIUB 3VXTA 1T7YA 1I7UA 1CFSA 2W0FB 3GMLB 4UV4L 4Y2DB 4CDHA 2MCPL 4KFZC 4AG4H 1IEBA 3S36L 3SGJA 3RJDA 4PBXA 3P4OB 3R1GL 1UJ3A 2EKJA 4OSUL 5I8CB 2HRPL 4NZDA 1NBQA 5TQ2L 4BQ8A 5KAQG 4XRCB 1E4WH 3LEVH 3MCLL 4POZC 4D0CA 1R5VB 5MP6L 1CICB 1DE4A 1WSST 3A6OA 3MTRA 5DJ8A 1J5OH 5EU3B 4QTHA 5IHUL 1J18A 4LLMA 4H1LG 1UGNA 3UZEA 3HRZA 3IDIB 3GSNA 1XGYL 3MLRL 4NQDA 5ETUB 3KJ6H 4Z7VB 4G80B 3RY6C 3TV3H 3I9GH 3VRIA 1MCJA 4HDIB 1WF5A 1FZMB 1H8OA 4X98B 3WN5C 1YC7A 3STZA 5JHLH 4U1JB 5ALBL 3ZKND 1A9BB 3SE9H 4GKZA 4K2UL 1JWSB 2H9GB 3CVIH 3B2VL 4CNIB 2IMMA 2BOBB 1YNLL 1MCBA 4IHOB 3DGGB 1MRCH 4LHUG 4X6DF 3DPBA 1MJJA 2BSRB 1P7HL 2BSED 3VH8G 4PY8J 4YHMH 4HQQL 1CLYL 5I30H 4MNQA 2X4UA 2NLJB 3DYOA 2AXFB 3FZUC 4H8WH 1AGFA 5D6DA 2APFA 1FL5A 2VXUH 5J12C 5C1MB 2YSSB 4FQ1H 4OZFA 3EHBD 4HIIA 3NACH 2GI7A 5JHDD 1MFEL 3CZFA 4XNZC 4ZPTA 5MHSE 1VACA 1ZA6A 2MNUA 3C5ZB 5C09E 1FAKT 4L4VB 2JJSA 1H8SA 1Q9WB 2OS7A 2Z8RA 3NBNA 1JF6A 4EN3D 1XF2A 4K3EH 4RMTA 4MXVF 3ARSA 5E7FA 3PWPA 1QFWH 1YJDH 4N0YH 3DURB 4HEPG 1CFVL 5HDBE 1MLBB 3PGDB 3QXDA 5DZLA 5K59F 1EUTA 1BQHG 2VL4A 5BO1H 1A7BA 5GRUL 2BMKB 3PGFL 4FHBD 4LPXA 1DZBA 5F96H 4ZFZA 3WFCH 2EDOA 5EFIA 3PWJA 2YK1H 3EFDH 1DLHA 1ZGLA 5IVZA 1ULVA 4I0KA 4OGYL 1T0MB 5CEXB 1FJ1B 1J0JA 2R2BB 5FUCE 5GPRA 4IMKC 5FA4A 4YUEL 1JHLL 2KL6A 2OTWA 3KLDA 4ZQKB 2CKBL 5CZVL 4I48B 1A9EB 3IAQA 1NDMB 2VDRL 4XC3H 4LLUA 5KSBF 2WBJA 3X3FL 4J3TA 4KKCC 3QXTA 1HHJB 2ID5A 1WBYB 5KANI 1MY7A 1T6VN 3OXSB 3SO3C 3IFPB 1ADQL 5F1IB 3OPZH 5CP3A 3FB8A 3QFJA 4F7TB 1N8ZB 1S7UB 1YMMA 3MBEB 5J13C 4N0CC 3GSQB 5D5MF 2BY0A 3PQYB 1YUHB 5B8CA 2DQHH 3TN0C 5DEGA 4S1QL 3MLSL 2G75A 3UJIL 4OM1L 2PR4H 3MJGX 1XMWA 5LQBH 3TP4A 2UYLA 4CAGA 1EEZA 2XZZA 2Y5TB 4NP4L 4PB9L 3O2DH 2VZOA 3TBYA 1TZIA 3NA9H 3IDJB 2K7QA 4JPKH 3QRGH 4KHTL 4APQA 4EI5D 4GW5A 3EOBA 5B3NA 5D7LA 1BFTA 1R24B 3MGAA 4GG8B 3GMMB 3LMJL 4GAGL 1A4JB 5DHYB 3DX8A 3S34H 5FYLE 3O4OC 1S7QA 1KEMH 3GBNL 4LCIL 2GK0A 4IMLA 2XZCH 3U79A 4OLVL 1M7IA 1N0XH 3RVTC 1NFKA 4JM2C 4LSUL 5ESAB 4FNLL 1MJ8L 5C3LD 4QNPE 4PRBB 1NCDH 4OT1H 5D96C 4N8VG 5GGVY 3RA7L 3WNPA 5FCSH 1KENL 2V2WA 1OGTB 3LKQA 4QRPE 1ZWIB 3QEHB 3VG0L 4PJBA 2LAGB 4OFPA 5LXGL 4YHIA 1JWMA 5IJKA 3QB7C 4LSQH 5ADOL 4XHJD 1RZFL 1DN0A 3CX5J 4ZS6D 4LARH 1K4CA 2BCKA 4HPOL 2CKBB 4H8WC 4QLRA 2V17H 1YN6B 3FONB 1EPFA 2KQNA 5F71A 4LLDB 3EO0B 4XBEL 2ZKHH 3S96B 4PRPE 4Z7NE 2YKLL 3HZKB 3GJFA 3ZE1E 2IPKA 4U6VL 4BKLB 1NC2A 3GBML 1FGNL 3VCLB 4JDVA 3TT1L 3WUWB 2XZQH 3KPSD 5HYFA 2J88H 1R6VA 1YJDC 1XIWC 5CZXC 1C5BL 4PJXA 1I8IB 2BHYA 1AHWA 4XCNB 2ZG3A 2NXZB 1JRHH 2DF3A 4GS7C 1KCRH 1FIGL 1RMFL 4KXZI 4LPVA 4CVUA 2NW2A 4EXPX 4LHQB 5F7MC 5HDBF 1T1WB 3MRFB 4X5LA 4MXQC 3CCHA 4OUUA 4I2XA 4Y4HB 1KJ2A 3DBXB 4P2YA 2FNBA 4ZS7H 3MUZ1 3UZVB 1SJVA 3C5JB 1S78D 3CX2A 4PJ5D 4GXUN 1YEEL 4YXLL 4X0KA 5C8JA 1BZ9B 1MWAH 2FZ3A 4PUBH 3ULVD 1OHQA 5EIQA 3IVKB 4JGUA 2FGWH 1FZKB 4U3HA 1QD0A 5LGJA 1Q8MA 4M43H 1MAJA 5DMGC 3QNXB 1D5MB 4Y1AD 4WHYH 2VKXA 1CFNB 1M71B 4MA3A 1T7ZA 2NXYC 2CLVA 3QUML 4PJDB 1U3YA 3FT2B 5C07A 2SEBA 4KWUA 5DQJA 4Q9QL 5DK3A 3BMVA 4UZGA 1U58B 3QEQA 1AKJD 3I3DA 3SKJL 5DEZA 1JNHA 2EXWC 3A6BL 1FO0L 3ISWA 1JWUA 3BH9B 5GGQH 3OX8A 5IJVB 4OAWA 1BVLB 3S4SG 3BKJL 5J89A 1MCLA 4NO0D 4YC2B 1KLGA 5CFHA 5D2NA 1PSKL 5TF1L 3RFZC 3IF1B 1A6ZB 1PJ9A 3QUYA 2QTEA 1WEJH 4U2YA 1I4FB 2Y7QA 4GKNB 5FA3A 4PJIF 1S9XA 4IRSB 1VFOA 4U1SB 4Z7UB 2C4XA 5DD1H 4IRJD 4GRWH 4NKOA 2M2DA 3DXAD 1GAFH 1G7HB 4N0UB 4F15B 3QAZB 4LPYA 1OQXA 2PKDA 2VWEE 2FHBA 4JO3L 5GS1B 4WJ5A 1HXYB 1OARL 2F5AH 3MRIB 4NDMA 2IANB 4DZBB 2XWBB 5ECJE 4X7TB 4LEXL 3D18A 4FQCH 4P23C 3QQ4A 4JCMA 5JHDE 3WJLC 4PGCB 3K2MC 3V5KA 5I1IL 5DJ2B 5FYJD 5E94A 5IFHH 5DZOA 3FHQA 5TDOB 1JPTH 2IPTH 4KTDH 5BXFA 2AI0L 5AYUL 2JCCB 4DUXA 4NUGL 5GRWA 4X4MA 1LE5A 3BDBA 4QNPF 4DTGL 1NC4B 4PJCB 2NR6C 2PO6B 4M8VA 1ZLSH 1WCBA 3MGOA 3D3VB 1UACH 2H3NB 1OAYL 4YBLB 2LV4A 3M8OH 4RMVA 1HILB 5C2BL 1HDMB 1QFHA 1Q72H 4PJGE 1MI5E 5EC1A 3OJMB 1JZ3A 4I18A 3JVGA 4HS8L 5ERWA 4OZGA 5HHNB 3G08A 2CSPA 3MJ9A 1C5CH 5CP7B 5DJCB 3GK8L 1G7JA 4Q6YA 4RA0C 2H45A 4FQXB 1I3VA 1R3LB 2EDXA 4HZLA 1F8TH 4YHNA 3U36B 1GZQB 3O3AA 5F7UA 3VMPA 2ZUVA 2B1AL 3MBXH 1N64L 5FKAB 5E1HB 5JW3H 3HI1A 2ED8A 3RVWD 2VXVL 5KOVC 2YBRA 2OK0L 1ITBB 3RGHA 3WXWL 5F1NA 1RHHA 1PQZB 4JQXA 3ZE1F 1MCPL 2DYPA 3VWKC 1LEGB 2ERJC 3I2CH 3HCVA 4XXCA 4WDIA 1H5BC 3H9HB 4ZUVA 3TBSB 3N85L 2K1MA 3MPCA 1IAIH 4AL8L 3TT3H 1URLA 4K94H 2D03H 2P43B 2NQCA 4M7LH 2IAMB 4ZO6A 2P5WE 2XTJD 2VE6A 3O9WC 5D7IE 1FLRL 4QGTA 3EYSL 1D5IH 2X4NA 1I7RA 3UPRB 3PP4L 1K8DA 2HLAA 4I9WD 3T0VA 4TVPD 5C0RL 2ZSWA 4YEFA 3WFEL 1AD0A 1JPGA 4K3JH 3HLAB 5I8EA 2E7BA 1Y6MR 1I9JH 2P24A 4DKAA 1UXWA 3D39D 1BIIB 4HKZB 5BRZD 1W8OA 1DVFC 1RURL 3QQ3A 2IFGA 2NY4C 3SDAA 3WLBB 2ITCB 2R4SH 2VN4A 3BIKA 1JNNL 4RFNB 1IGYA 4XNMB 4P3CH 2Y36H 4X8XA 2R56L 4M62L 2APBA 1WV7T 3TJEH 5EN2A 4GW4A 4PG9A 4D0BA 4U6XB 1JUFA 2DN7A 4NC1C 1BD2E 1J87A 4Z95H 1T03H 4RRPA 4NQCA 4PRDB 5D4QA 4MD4B 5ITFA 1DQDH 4ZNCD 1ZMYA 4RAVA 2O5ZH 1MFCH 4MA8L 4NQUA 4WI9A 1MIMH 3BP4A 1I3RA 2CLRB 5C0IB 1V7MH 3QXWA 3BD3A 4UU9A 4KMQA 5EIIA 5DJXA 2C1PB 4Q9RH 1K6QH 1RUML 1JK8A 1OD9A 3MV7B 4PPTA 5T3ZH 3HG1E 4LCYB 2LFGA 4LCCA 4C56A 2OI9C 1F3DJ 3EYOB 4MJ6B 3CVHL 3V0AC 1OB1A 2OTUB 4KK8D 3GIZH 4L8SB 1QSVA 4DQOL 1I3GL 1DSFH 3A0OA 1X44A 3AS0A 3KPSE 4HWBH 2Z31A 2DMCA 1BOYA 3ZKXB 3BI9X 1AGEB 4PTTB 4XAKD 4NOFA 3MJ7A 1HE7A 1VGEL 1AD9B 4R7DB 4D94A 1P9MC 3ZTNH 4F7PB 4YAQA 4U4BA 1D9KD 3FT4A 2X9XA 4OGAD 1QRKA 3RWCB 5DD6A 4O02H 3DVNB 4WO4B 5KN5A 4GOSA 2HJFA 1X4ZA 5E9DA 4RZCB 3JV6A 2F5BH 2AV7B 4PJ5A 4ZPVA 4PJGF 1DEEA 5HYQB 4NCDA 4P2RB 2JB5L 2N1KA 1FYTE 3FQRA 3RPIB 4JFOB 5D1XD 3GSXB 3FB5B 4K55A 1OCWH 3TIDB 4UNUA 1AGCB 1CD8A 2XRAL 3WXVH 3OXRA 2P8MA 3NPSB 1A7PH 5I1JL 1KIUA 3PABA 5MENA 2I60H 4K71B 1LEKA 4PJ9A 1T89A 4Y1AE 2JELH 3HKFA 5IFAH 1L4IA 3LS5L 1MHCA 4XPAL 1AJ7H 1JHTB 2X4RB 1AKJA 1BOGA 4K94C 4C59B 4HC1A 3IXAA 2QQKL 1G6RH 5F7KC 4GT7A 5C0CB 1IFHL 3DROA 3L7EB 2ZJSH 1MOEA 4TUOA 5C0BD 3SDCA 3TBVB 1P84K 2MSPA 5JOPE 1BM3H 3TVMB 5CD5C 1TVHB 5D7IF 2CLZA 4FXLA 2VDMH 4G8GE 1L7TL 5J56B 5HHQB 3ARDD 5EIVA 2XA8H 4G6KH 2NW3A 1U8KA 1HZHH 3DXAA 2E6QA 1BAFH 2X05A 1I9IH 5HDLA 4JANA 3QT2A 4IS6A 1J0ZA 4G6FB 3BOVA 1FVCB 3QI9D 4XCFH 4NT6B 4L3CB 4TTDC 2FJGA 5EH1A 2H32B 3N9GL 1ED3A 1QFWI 4RDQF 4PLKC 4LASL 1KJVA 3WKML 4ELMB 2R9HD 5CCKH 4G5ZH 1OOAA 4KK6D 3S98A 1CFQA 2J6EL 3GSWB 3WUZA 2ENYA 5BQ7A 1J0IA 5IMOA 4U1IA 1A7NH 1J1XL 1UEMA 5CHNA 4Q2ZA 5D2LE 3ZE0E 3OGOE 4YK4C 3RWDB 4XPTL 4RIRB 1ORQA 3U46A 5KZCD 3RU8L 4BK4A 4RFOH 3WFBH 4JR9H 2NY3C 2EC9U 4XCCL 1Z0NA 5DEFB 4AJ0A 3B3IB 4UDTA 3SE4A 1WZ1L 1MHEA 3LRSA 1I85C 4L4TD 4U7KA 4RA3A 4RMUA 3U4EB 1E6JH 4Y5VB 4OFVA 4QWWD 1KG0B 3BIAX 5F7EL 3CUPB 3MLTB 2X4SB 4X7SL 1T1YA 4OIIH 3FRUB 5HYJA 3UDWC 4QRTA 1QG3A 2DTMH 3NFNA 1F90H 3CLEL 4M9PA 3TLRA 3BXNB 4RWHA 4EUPB 1A6UL 1D5BB 1K2DB 4NKQB 3TO4C 3G6AB 4WTXA 3BUTA 1AXSA 5CJQL 5D7SH 4D3CL 3FT3B 4P48A 3SGKC 3IJYA 4MMZC 3DX7A 1IGMH 4XCEA 3MNZB 3CC5B 2GW5A 3TPKA 1QACA 3NCBB 4J4PA 4G8FA 4N0FB 3WFDH 3KPRE 4CBPA 3DSFH 2XTJE 2HVKB 4NQSA 1OM3H 1IRAY 2OL3A 4ZXBA 4I5BB 4PD4J 5EZLB 5ANMA 3ESVF 3O41A 4EOWL 4I9WE 5F1OB 2Q6WB 3QXAA 3D39A 5IB5A 4YHPA 1NCWH 4IDJL 3FZUD 3HC3L 4D8PA 1QHPA 5TE4L 5I73C 4E0RB 3VD9A 4TUKH 1R3HA 3GSNL 3X11A 1G7MA 5BRZE 3OKLB 3QO1A 4HZAA 3VD4A 4XWGL 5FGCE 4QRRE 4RGNC 5FGBA 4P2OB 3ULVF 3WFHB 3HI6L 2VZSA 5I0ZA 3UTTB 4JPVH 2XN9D 5EDXA 4W70A 4ODWA 1XR9A 1I8MB 3UTZA 4HIJA 1ZT7B 5T5NF 3KNBB 3QJHA 2AXGA 3DIFA 1CTNA 2WINB 3WDIA 2GFBA 4TNVF 1TMCB 2E6JA 4OKDA 5SV3A 3UTSE 3ZMRA 4MQ7A 4P5MB 3MODL 4D9LL 3RWJB 2PTTA 1MPAH 4QXWA 3DVIA 3GM0A 1GL4B 3ARBC 5J1SC 1RFDL 5L88H 5EOCH 4WW2B 3E6FB 1IQDA 1WGOA 2ARWA 1MRFH 2PYFB 1KIQA 2R0LL 2R0ZL 1J05A 5DJ0B 2DQIH 1NAKH 4J8RB 4PR5B 1QSEA 5ICXB 4G7YL 5IROA 1VADB 4HUWA 1AH1A 1INDH 3OKMA 3PWLB 1IC5L 3G5XB 2MMXA 2HT2C 4NWUH 3PL6B 4BFBD 3KXFA 1U3HB 3C8KB 4HF5L 4HJGA 4DN4H 1W8NA 2V5SA 4KKCD 3TIEB 1LK2B 4FG6C 1FG2B 1T2QH 5FO7B 4MCZA 2F74B 4HULB 1JRHI 5DWUH 2ADJB 1AP2A 5IBUG 1LD9A 2QHRL 3B9AA 4HHAB 4Z5RA 3JTSA 3VXTB 1XCQA 1GGUA 1I7UB 1CFSB 4GW1A 1UM5L 5GHWL 3WD5L 2VLLA 4JEGB 5FYKE 4N0CD 1INEL 5D7JA 3BW9A 3MZTA 2VSCA 1IEBB 1K9TA 5J6HA 2EXYC 1UJ3B 1D9KA 3FO9A 1U3ZA 4KH2A 3T0EE 3H2WA 1SY6L 3NCJL 4D0CB 1KC5L 5TE6L 5D2LF 1OF2A 2G9HA 4B7IA 4ERSH 1DE4B 5DT1H 5DJ8B 4MAUH 3HMWH 4DFIA 5D1QC 2VITA 4R97B 4QTHB 4LLMB 3GO1H 3HRZB 1W72A 1NCUA 2HJKB 4XP6H 1EJOL 3GSNB 4WTZG 5D1XA 1C12A 1DL7L 4NQDB 3S6CA 3CK0L 1F3JA 5FOJA 3NCCB 3VRIB 3O6FC 4GBXC 5LKNA 1P4IL 3T65A 3C60C 3STZB 3X14A 4E41A 4C4KT 2X6MA 1VFUA 4K3HA 1QPXA 4GKZB 1KN2L 5EUKA 5KG9A 3U0WL 1I9RL 3FFCE 1UKTA 3G04A 1RIVH 2ZCKH 1EX0A 4DKFH 4JM2D 4WFEE 1MJJB 4JFDA 1CLZL 2P48B 4TUJA 2EO1A 3F7PC 2UZXB 3BPOC 4IOFD 2X4UB 3QYCA 4MNQB 4Z7QE 5C0BA 1AGFB 4YHOH 1FL5B 2ZWLT 2DQCL 1A8JH 4OZHE 4OZFB 1NFDA 2OR9L 4HIIB 5SV4A 3GMOA 4K7PY 2VRAA 2OZ4L 3ARDA 3CZFB 4NZTL 3UEZA 3B2VH 4ZPTB 3QNYB 1VACB 1TQBB 1ZA6B 5HHOD 2BZDA 5ICZA 5JW4R 3QIUC 2Y23A 3LS4L 3VFNA 4C4KO 4Y2DC 1XF2B 1YEGL 4ZFGH 3PWPB 1U8QA 4HQQH 3OR6A 4WWID 3QI9A 3T09A 2VC2H 3QXDB 5JW4N 1CXIA 5C71A 1RAMA 4XNYL 1GPOL 4GJTB 4UBDD 4ZFZB 5EFIB 3PWJB 1XIWD 4KU1A 5CZXD 3ARYA 4HX1A 5DI8A 3IXTA 4WV1B 1DLHB 1MFEH 1OAQL 5C0JA 5IVZB 5TJWK 1KB9K 2C5DC 4ODVH 1X5JA 3WSQL 4FTVD 1OD7A 4JY5H 5JDSA 1F4YH 4HS3A 4O4YH 5FA4B 2OTWB 3R0MA 4L3EE 4U05A 1KLFA 4LLUB 4GUPA 4XWOC 1F58L 1NUDA 2WBJB 1N26A 5GRUH 5JOFA 4DVBA 3PGFH 2GAZA 3F6LA 4D9QE 2IBZY 4OLYL 3QFJB 4UOW1 2I26N 4XVSL 1MFBH 1YMMB 3F7YA 3MRDA 4HFWA 5IT2L 3MOQA 2GSGA 5GISL 4YUEH 2AEPH 1JHLH 1T7WA 4L4TE 2CKBH 5J06A 2VLJE 5FB8A 1ZS8A 4TPRL 5B8CB 4HAFA 5DEGB 3WDJA 3EOAA 4MS8D 4WEMB 1EGJA 3CLFL 3X3FH 3VXSA 2G75B 4LPTA 4TQEH 1IAII 5JO5A 3EJZC 3C5ZC 4XI5D 2UYLB 1KJ2L 1EEZB 4GMSL 1HNGA 2VLKA 3TBYB 4LHUD 1TZIB 4G8EA 2Q8AL 3L3HA 4YHZL 4UINH 1V3KA 4APQB 1TVDA 4GW5B 3EOBB 4RGOL 5D7LB 4OCXH 2DD8H 3DX8B 2WLYA 2BNRD 4AENA 1N4XL 1S7QB 4JGJA 5L2KD 1IM9D 2GK0B 4IMLB 1UXSA 4M4PA 2A38A 3P4LA 5L8KB 3HZYA 4JO1L 1M7IB 4ZD3L 2PTUA 1WICA 4H5SA 3FMGL 4PB9H 2HFTA 4YDKL 4F9PA 1NCAL 4JRXD 4GKSA 3QUKA 2V2WB 4PRIE 4BZ2H 2ZZUT 4XMLH 3LKQB 2B0SH 2Q3AA 5DJZA 3LH2L 2QQNL 3LMJH 4PJBB 3WBDA 1F2QA 4GAGH 4P23D 2XN9A 4YHIB 1IC4H 1JWMB 1W0YT 3V0WL 5ID1A 1SYVA 3H3PL 4YE4L 1DN0B 5MEPA 3W0WD 1K4CB 5JIKA 2BCKB 1BFOA 2YZ1A 3U7YL 5E2JA 4U3XA 3EJJX 1WBZA 3L1OL 3MBEC 3TBWA 4BUHA 5KJRL 5DTFA 5T3XD 4TTGA 4WGWB 1DUYA 4Z7QF 3GJFB 3EOTL 2YPLD 2IPKB 2D7TH 3O3DA 3QDJE 1NC2B 1WT5C 2FDBP 2GY5A 2XYCA 2HWZL 4JDVB 2C4FU 4HD9A 1RZKL 1DQML 2WUBH 1RZFH 3MRKA 2YD3A 4PJXB 4BQCA 5F9DC 1UZ8A 1AHWB 5DMKA 5FF6A 3RGVA 4XNQA 1IKNC 3UYRL 1OP5K 1CIUA 1G9ML 1YNKH 5BVJA 2J5LB 3EJYD 2NW2B 3CCHB 1IE5A 4OUUB 4I2XB 1AFVL 1KJ2B 4XVJH 1A6WL 5I6XB 3VWKD 3WNMA 4JFXA 3CPLA 4PV8A 3MRHA 5D72H 1KULA 4PJFA 4MJIE 1FYHB 3WNLA 5C8JB 1NUGA 4X0KB 5IW1A 2FZ3B 3BH8A 5TFSH 3MJ9L 1QBBA 4PJHA 1DQJA 1JFQL 3MXWH 4X6CE 5E4EB 3BN9D 4I77L 5MEOA 5LGJB 3FOLA 5TPWL 3W9EA 4O00A 1ZGLM 4HUMB 4DGYH 5EUOF 4MA3B 2CLVB 4DN3H 5ISZE 5C07B 2SEBB 3QA3A 5DC0A 5DQJB 1IC7L 2QSVA 4WTWA 1JN6A 1BEYL 1H9VA 2O93L 1DVFD 3QEQB 4PYHA 3CFIC 4NQED 3UTPD 4QCIA 3CMOL 1A14H 2NY4D 1JNHB 5FEBA 4XP5L 4MHHG 1JWUB 4P5TA 3IGAA 7FABH 3OX8B 2EDEA 1JP5A 1J1PL 4GAFB 3PJSA 4OAWB 4N5UA 2VKWA 3KS0J 4JFEE 3F65A 5I16A 4QTIH 1KLGB 1BJ1J 5D2NB 3VDBA 3KAAA 3QUYB 2V7HA 2V9RA 2Y7QB 2N7AA 5FA3B 1S9XB 1EO8H 3DI3B 4Y4KD 3QUXA 4NKOB 4HWEH 3NAAH 2NXZC 1PW3A 2QLVB 4PP1C 2VO5A 1OAKL 2FBOJ 3SKJH 1U8NA 4CRPA 1L0XA 1NDGA 3MLYL 4M7JH 4WJ5B 3MLZL 4NDMB 2ZUWA 2YUWA 4M1DH 3D18B 2W9DH 5HHOA 4PBVC 1O5DT 3D85A 3QQ4B 5TF1H 2ATKA 3V5KB 3S5LA 5E94B 4NJ9L 3WL9A 5JIPA 5BXFB 3TYGL 3FB6A 3GHEL 5DK0A 1LE5B 2YD2A 3MACH 3F58L 1YYMH 3U4BL 1WCBB 2OQJA 3MGOB 3IKKA 3QO0A 4GG6E 2VDNL 5SWSD 1U41A 5DUMH 3S8WA 4FXKA 5EC1B 5GRXG 3K2UL 4I18B 5ESVA 5ERWB 4OZGB 3G08B 1G7JB 4HZLB 2YA1A 4HK3N 5SWZD 4EJ1C 4YHNB 2VIRA 2AI0H 3O3AB 5AYUH 5I76A 4UT9H 1EFXD 1TETL 5FUOH 4JQIH 3SBWC 4HIXL 5GRZA 3HI1B 2NY7H 1ACYH 3BKCL 1V8HA 1RULH 4Y16D 2YBRB 4FZEL 5GGRY 3H42H 5C6WH 1OAYH 5F1NB 1RHHB 4YC2C 5EU4A 3IFOA 1GGBH 2DYPB 3GI8L 1KFAL 1ZE3C 4IRSC 3HCVB 4WDIB 4ZUVB 3GK8H 2BY2A 1BQLL 1DUZA 2IC2A 1A7QL 3ARFC 4KMTL 5HDQH 2A0LC 4M1GL 4F15C 3QAZC 4UUJA 5HBBA 3OV6A 2W60A 2VE6B 2MPAL 2E9WA 2MTPA 2X4NB 1I7RB 3TM6A 3UXFA 1K8DB 2HLAB 4M6NL 3AM8A 4LVEA 5IEHA 1NMBH 1KIRA 2ZSWB 4PJAE 1AD0B 1JPGB 2DQTH 1VCAA 2GJ6D 1OTUD 5I8EB 2P24B 5E56A 1UXWB 1H3UA 3BIBX 4JFFD 2A74A 4EKXA 4G3YH 3QQ3B 4KRMB 1RJZA 2PO6C 2YPVL 2D3VA 3SDAB 3BIKB 1T0PB 1AO7E 1IGYB 3DI2B 4YBLC 3REVA 3AUVA 5CD5D 1P53A 1J9CT 1IM9A 1FLRH 2XV6B 4OCSL 1Y18A 3EUUA 32C2A 1IGIH 5JIHA 5EN2B 4GW4B 4PG9B 1FH5H 1QFOA 5K93A 4HWUA 4ZTOL 2DWEA 1P4LA 3UTQA 4D0BB 1JUFB 4FQXC 5IB1A 1TZGH 1MHHA 1WFOA 1FVDA 4U6HA 2G5BA 5CEYA 1KN4H 4HC1L 4JRXE 1YQVH 3VFPA 3MYJA 3D9AH 4MX7A 4JZOA 4MDJA 1V3MA 4NQCB 5IHLB 5ITFB 1MREL 3NPZB 4LPUA 3D48R 5CLWA 1NLDH 1YYLL 4RAVB 1IMHC 5I19L 1B6DA 3BP4B 1I3RB 1IILE 4NRZA 3RNKA 5HXMA 2LTQB 4UU9B 5EIIB 5DJXB 3UYOD 4JM2F 4PIRF 1JK8B 2EECA 4R4FL 2DDQH 5IUSA 2IAMC 5FK9A 1KOAA 1IGTA 4LCCB 4C56B 4EUPG 4FN0A 4QHKJ 1IQWH 5BMFL 4L5FH 3W2DL 3T77A 2UZIL 3TCLA 3K80A 1OB1B 2NY3D 2YPLE 4I8DA 3U9PH 1FIEA 3HS0A 1X6LA 2HH0H 3PDOA 3P11H 3MUHL 2WWMC 4I3RH 2Z31B 1TJIH 4UB0H 1F4XL 3T0WA 2VXQH 3AROA 4TYUA 2VZVA 2VUOA 4TULL 3MJ7B 2VAAA 4KK5C 5C0DA 2DLTA 3BO8A 2YA2A 4RFNC 2ICCA 4YAQB 3FT4B 5T1DL 1X5IA 5CEZL 4WY7H 5DD6B 4XPGL 4ZUWA 1H3PL 2Q8BH 4JG0H 3ARGA 4ENED 3VD5A 2E9JA 2HJFB 5KN5B 5E9DB 4OIAA 2VXSH 4DQOH 4X5XA 4HMCA 4PJ5B 4ZPVB 5E1AA 1NBVL 1DEEB 3FQUA 3QULA 3QPXL 5ESQA 4L8CA 3FQRB 3K4ZA 5KS9F 4OI7A 4CDGC 5DJAA 3OXRB 2P8MB 1VGEH 3JZ7A 2CPCA 3PABB 5MENB 2EDNA 4X7CC 1LEKB 4PJ9B 5AZEH 1QLEH 4NWTH 3CXDL 5CAYB 3K81A 3OG4B 1MCDA 1MHCB 4ZUSA 1QZ1A 4OV5A 3VXME 1AKJB 1BOGB 4JE4B 2DQEH 3IXAB 4TSAH 4GFTB 2NMSA 1B0GA 1NGQL 3LQAL 4RGND 3DROB 3L5HA 4LBEA 5GSVA 4TUOB 1ZLVK 2XRAH 3SDCB 1MRDH 3P4NA 4YH6A 1FAIL 1HKLH 2BFVL 1H15B 3GKWL 4OM0L 4L8SC 1K3ZA 3WIHA 2CLZB 3JV0A 3HMXL 4X4XA 3FQWA 1CFTA 1MI5A 2J7LA 1A3RH 4Y4KA 3FRPG 3LS5H 5BCAA 4NM4H 2NW3B 4M7KH 1U8KB 3DXAB 4PJAF 4OLWH 4MLSA 4NC1E 3ZKXC 2WP3O 5EZOL 1UZ6F 2VL5A 4AEEA 2Y9RT 3FN3A 4P46D 4JANB 4EUPH 1PLGH 4PS4H 4IS6B 4L4JA 1T3FA 3ARBD 3G6JF 2QSTA 4EDWL 1P84J 1B88A 3ALWA 1CGSH 3NTCH 2C4FT 2FJGB 4GKOA 5AG9A 1OLZA 4WIQA 1ED3B 4GRWE 4WO4C 1KV3A 4PLNC 1KJVB 5F89B 3MA9L 3OF6A 1WTGT 2HT2D 1CFQB 3RUGE 3IFLH 4WW1A 2VSDA 3DETC 2HFEA 5BQ7B 3MLXL 5IMOB 1Q9OA 1R5WA 2JKXA 4U1IB 3OAUL 4FG6D 3WE6A 4Z8FL 4W4OA 5CHNB 5FM5M 2P5WA 3EFFA 3ZYIA 4Q2ZB 4JZNA 3KYKL 4N5EC 4RWYH 3PXHA 4K71C 1QNZL 1ORQB 3U46B 4RISH 5CJXC 4TSCL 1QA9A 2F8OA 4GQ9H 2DLHA 1NGWA 3Q6GH 3MNVA 4NN7B 2OJEA 4LASH 5HHME 3QEUA 2YN3A 3MFFA 4H0HB 4UDTB 1HQ4A 4NJAH 1MHEB 3LRSB 3QHFL 4HT1L 2EXYD 4KKBC 5SWZE 3HUJE 3MRCA 4PB0L 1NFIA 5AWNL 4Y16A 4K07A 5GGVL 1QSFD 5C08E 1MCKA 1T1YB 3K7UA 4AM0A 5CGYC 2A6IA 5HYJB 3O4LD 4QRTB 5D1QD 3NFNB 4UTAL 3TO2A 1CZ8H 4N8CL 1AE6L 4ZSOE 3MOBL 4FRWA 35C8H 4OLUH 4KTEH 1YPZE 1AXSB 4X7DC 2P44B 1WZ1H 1XAUA 4NBZB 1CDCA 3C60D 3KPTA 3IJYB 1IZJA 3DX7B 4XCEB 3C2AL 5DLMH 2EIEA 1OWRM 4KQ4L 3S4SA 5C0AD 1KTDA 4G8FB 4XMKL 4NQSB 2OL3B 4ZXBB 1B9ZA 4HIHA 5ANMB 3VA2C 4CMHB 3O41B 2NY0B 4WFHD 3MRQA 1NL0L 3TCXA 4O5LL 4FFZL 3QXAB 3D39B 4JFFA 4PRHD 5IB5B 3DVFA 4YHPB 1TLKA 1KELH 4D8PB 2EKSA 1INQA 1FCCA 3BMWA 1ZSDA 1W72L 5E2TH 5DJDA 3UJJH 1R3HB 3X11B 1G7MB 3HG1A 3U7AA 3QO1B 3MZGB 3HFML 5LBSH 3IJSA 3T04D 2FYYA 4J3OC 2X09A 4I4WA 5FOBA 2NTSP 2CGRL 2DMBA 1B6UA 4R2GD 4AT6A 4M48H 4V1DD 1ZV5A 1UKQA 1S3KH 3QIUD 4ODWB 1XR9B 3UTZB 5ALCH 3AB0B 1ZVYA 4HIJB 1Q38A 2J8UF 3QJHB 2AXGB 3B9DA 3DIFB 3DHJA 3O81A 2GFBB 4YBHA 25C8L 2NY2B 1ERNA 4Y5VC 4MQ7B 5K9JL 1Q0XH 3GSNH 4IEFB 2PTTB 1X4YA 4S1RH 3GJFK 1CICD 4RMWA 5ADPL 1YZZA 4JDZA 1IQDB 1NGXA 1KIQB 1HQRA 1X5GA 2P5EA 5I0DA 4Q0XH 1J05B 5EOQH 5DFVD 3P0GB 5KW9L 1QSEB 1C7TA 4HUWB 4K23L 3OKMB 2ICWJ 3TNNA 1FYTA 2Z9TA 4XC1L 3KXFB 1GYAA 4C57C 4HJGB 1FORH 3L5JA 4JQVC 5BVPH 2UV3A 4LOUC 3B5HA 4MCZB 6CGTA 1FN4A 1AP2B 5LWYL 4R26L 4JPWL 1LD9B 1CE6A 2R0LH 4F58H 4GRWF 4LVOB 4OZFH 5T3ZE 2AJUH 3DO7A 2C9AA 2CJUL 4Z5RB 1XCQB 1NJ9A 3NFSL 5DD0L 4GW1B 3SGDH 2VLLB 4O58H 4W6YB 3QDGE 5D7JB 1UEYA 3BW9B 5IB4A 3RUGF 3VGAB 5H37G 5J6HB 1U92A 2AXJA 5DRZA 1N7MH 1B2WL 1W0VA 3QPQC 5D70L 4HF5H 1D9KB 4KQ3L 2QSCL 3FO9B 2X2YA 4P2OC 4K3DL 3QWOA 4NZRL 1K8IA 1YEJL 1OF2B 3EJZD 4WCYL 2G9HB 2FATH 3UYPA 5DSCA 4KY1L 4G8GA 2VITB 3QWRA 4ONHA 1GGCH 1CR9H 4POUB 5D1XB 5LCVL 3VU2A 2E9IA 1C12B 1UM5H 5EO0A 3VFUA 4G7VL 1F3JB 2DLEA 2VDKL 4L8BA 4XNXL 2F58L 1W2KT 3T65B 3ULUL 3X14B 4E41B 4MJ5A 3HUJF 5DURD 2X9WA 2I5YL 2EDHA 4XP1L 2R4RH 4LLQA 3CFJA 1Z3GL 4WW2C 5EUKB 5KG9B 3BVNA 3DTXA 5TE6H 3G04B 2C26A 1ZEAL 1OTTC 2IH1A 4KI5C 4Z7WE 3MV01 1BLNA 4DCQA 3T3PE 3MREA 3O6KH 2V5TA 5KVEH 1YPZF 3CK0H 3PL6C 5CP3H 4D9RD 1U3HC 5C0BB 3LKSA 5INCA 1KEGL 4ZTPH 5GS0L 1MQ8A 4KJQC 4DAGH 3O6MH 3RDTC 1NFDB 3GMOB 2NZIA 1I1RA 4NZUL 3I85A 5L0QB 4XP4L 1DJSA 3IJHA 3ARDB 3EO1A 3U0WH 1I9RH 2FX7H 1JHKL 5T33L 5ICZB 2XWTA 1FNLA 5KTEH 2DQFA 3MBED 3VFNB 4P46A 3VFRA 4LSTL 2DLGA 2AVGA 1U8QB 2DBLH 3OR6B 2AK4A 3PQYD 2V9QA 3QI9B 3SGJC 4GXVL 2DIAA 1FNAA 2BY1A 3RWHA 1UJ3C 2HT4C 1GJIA 1CU4L 4RAHA 4M5YL 1T7VA 4ZAKD 2P4AB 2DQCH 2IMNA 2D7PA 3QCVL 4G43A 1MFDH 4HX1B 5DI8B 3IXTB 1SVCP 5SX5K 4F37K 3U1SL 3RKPA 5C0JB 4N8PA 1K85A 2DL2A 4JN1H 4R97C 5I18H 5H37H 3SE8L 1UM6L 3LS4H 4GH7B 5JDSB 3H8NA 3G9VA 1L9MA 4HS3B 1PZ5A 1RD6A 1NUFA 2VR4A 3OJDA 4GUPB 4N1EA 2AK1L 2OYPA 1RHFA 2CDEA 4JREB 4OUOA 2GITA 1B4JL 1VERA 5JOFB 4DVBB 2GAZB 4XNUL 1Q94A 3OKOA 1KB9J 2F53D 1H0DA 2ATPA 4CMMA 4LQFH 3F7YB 3GSOA 3LZFL 3MRDB 4HFWB 2GSGB 5IBTH 4R8WH 5D6DC 1B3JA 1UYWH 5FB8B 1ZS8B 4NKMA 4LLWA 3O4LA 4MHHI 1X5XA 2W38A 4GRLA 1QSFE 4QXUL 1TJHL 3EOAB 5ICYA 4LVHB 3VXSB 1WWBX 1P7QD 5FCUH 5JO5B 4Q9BA 2OMNA 1CGXA 1TQBC 3GJFH 9CGTA 1QRNE 1IEHA 1D6VL 4JG1H 1QBLL 2JJSC 4EVNA 2VLKB 5HHVH 1VPOH 1H3VA 4G8EB 4XX1G 3L3HB 3KG5A 3SKOA 4AMKH 3UTSA 4X9IA 5F9WC 3NH7H 3TJHD 1C08A 4AENB 4HKJA 1J12A 3CLFH 4KPHL 4WV1C 4WUUE 3E1F1 1UXSB 1XGQA 2MQ0A 5BV7L 5FO8A 1U3JA 5JQ6L 4PRHA 2NXZD 1T7XA 3P73A 3BESR 4PP1D 2ZUUA 4ISVA 4H5SB 1WZLA 4KRLB 1L7IL 3D0VA 2XG5A 3L5XL 3NZ8A 2Y4SA 4GKSB 1WLHA 3QUKB 1CL7L 4Y4HD 5DJZB 2WBJC 5BS0D 2WLZA 4H0IA 4ZUTA 2XN9B 1WFUA 2C3GA 4M03A 1VFAA 5ID1B 1SYVB 2OR8A 4LSSH 3T0DA 1SJHA 4RNRA 5MEPB 1SJXA 4FFVD 4OCRH 1BFOB 2H1PL 4HPYL 3EZJB 4Z7WF 2BXYA 1OGAA 4HFUH 1WBZB 4S1DC 2BRRH 1R3IH 3TBWB 5EORH 3VI3E 1SMAA 4ODBD 5DTFB 5C6TL 2HKFH 4XPHH 1DUYB 5B8CC 4KKLC 3O3DB 3C8HA 4UI2A 4P2QD 3T0EA 4DVRL 5J6GA 1MCNA 5DMJB 2CMRL 2Z0BA 1NSNL 4F9LA 2GK2A 3MRKB 1LO2L 3VRLE 1UZ8B 3MYZA 5DMKB 1OWWA 4YHKL 5FF6B 3RGVB 4XNQB 3FO2A 5C0GA 4APQC 3LPWA 1N2RA 2NY5H 5KJRH 4HCRH 5BVJB 2EE6A 4KKAC 4QHUA 1XZ0A 2RIKA 4JRYD 4UQ2A 1JGEA 3QRFM 3FFCA 1LO0L 3KWWA 4IRSD 3CPLB 4JFXB 4PV8B 1IAMA 3MRHB 4XP9L 5D71L 1QFUL 3LN9A 1RZKH 4PJFB 3C87A 1X5HA 5IW1B 1TQCB 1NCCH 3TEUA 4JLRA 4PJHB 5GJSL 1DQJB 1KACB 2HT3C 5MEOB 2IAND 3FOLB 3OKDA 4JKMA 1OT1A 4OZHA 3W9EB 4KV5E 4WFGD 3TH3T 3GI9L 1X7QA 2EZ0C 1AQKH 1NMAH 3P30H 3RI5K 3L5IA 4L4VE 1DBKL 3QA3B 5FYLL 2AKRA 4F57H 4H20H 4KVCL 3GUTA 5H2BA 1JN6B 2NX5D 3MQIA 1A5FH 2RQ8A 2DJSA 5SX5H 4RRPG 4M6ML 1NC4D 4QCIB 1UQSA 2PO6D 1IGJA 4KJPC 1P4BH 3D3VD 4P5TB 3IGAB 3U82B 4JO4H 4X4YA 1YEIL 3MJ9H 3PJSB 3ZLQC 3E6HA 2HLFC 3X3GL 1KLUA 4NO3A 5FUZL 1S7XA 2HFGL 3KLHC 1RVFH 5I16B 2MJWA 4JM4H 1XFPA 2V7HB 1YY8A 3SDXE 2B5IB 1SHMA 3GHBH 4FQXD 3ZKQD 4EIGB 3QUXB 1NCBL 1Z2KA 5B22A 3VXOA 3U83A 1HOCA 1U8NB 4L3EA 2DLFL 4NCC1 1NDGB 3ZHLA 2J5LC 4D9RE 3NIFE 1NAMA 3MXVL 4WGVB 2WUCL 5I6XC 3TBTA 5HHOB 5INDA 5IFJA 4JB9L 2ATKB 2FD6L 1MH5A 1U8IA 3QR2A 3S5LB 3UO1L 3M07A 3WL9B 4BFGA 5E2VH 3FB6B 1FNSH 4NQVA 3DV4A 3OWEA 4MZ2A 5DK0B 2AQ2A 1DBBL 2A73A 3B9KD 4OD1H 5E4EC 3AXLA 5A16A 1EO5A 5CJOH 1PX3A 3QO0B 1S9WA 4GAJL 4J3VA 5GZND 4J3XA 1J1OH 2OJZL 3MLZH 4PY7A 2WWMD 1SEBA 4FXKB 2FIRT 4MAYA 4CADA 3AMLA 5ESVB 3SJVD 5LG1A 1QYGL 5C9JA 15C8L 2EIDA 4FABL 4AEIL 4LSDA 4NJ9H 2AGJH 2Q87A 4FS0A 2BP3A 3EBAA 2VIRB 5H94A 3MFGB 2W91A 3DMMA 3KDMA 2ZPKH 5HI3C 2R2HA 3ARQA 1OP3K 5I76B 2XPGA 4G9DA 3GHEH 2WV3A 2APVA 2XKNA 2XG4A 3WNKA 1YECH 4NN6B 3VI3F 4NHUB 3U4BH 3AMKA 3CFDA 4XB7A 1FSKB 4YDIH 4ZO7A 5EU4B 3IFOB 5D2NC 2F53A 2VDPH 3TESA 3QUYC 2FBJL 4JFHD 4E9LA 3TYFA 1HHKA 2NY5C 1ZLUK 4M1CD 2YD9A 5J7CC 4XH2A 1WIUA 2IFFH 3BSZL 1NCNA 1DUZB 1KJ3L 4Z7VF 3CDFA 4GRMA 4KROB 4UUJB 4ORZC 4JRWA 4PRIA 2W60B 2I24N 2Q7YA 1OTSD 1AXTH 5I15H 1RZKC 1P7QA 5CBEA 1EA9C 4BYHA 3MUJA 5J9PA 5JTWA 3HNVH 5HHXH 5IEHB 1KIRB 4DFHA 4M7ZB 5I1HH 3SDYL 4EN3C 5E2WH 2VYRE 1NQBA 2HP4A 3L7FA 2XICA 3ZDZE 3CAFA 1SM3L 4KZDL 2A74B 1ADQA 1RJZB 4NQTA 1V05A 3BD5A 3AGVA 2YRPA 3EDJA 4M6OL 3REVB 1JTOA 1U6AL 1IGCL 1T66C 3QDJA 1IM9B 1Y18B 1CBVH 32C2B 3S35L 3ARRA 3DSNA 2MCG1 5F7DA 2OXGA 3JVGC 4I18C 3RNQA 2CO6B 2R15A 2DWEB 1P4LB 4UILL 3UTQB 3VRJA 5IB1B 1MHHB 1FVDB 4U6HB 2G5BB 3T3ME 4MJ2A 5CGMA 2F54D 5CEYB 3DX6A 4LIQH 5BS0A 3GJEA 5IWLA 1S9KC 3VFPB 3MYJB 3ULVH 4MX7B 4JZOB 4MDJB 3JBG7 4WO4D 4WI3A 1CQKA 2F19L 3RIAK 1CD9B 2WIMA 4JQXC 2WNGA 1OVZA 4OB5H 4P2RD 5EU5A 4NNPH 4XPBL 4NRZB 3RNKB 4XXCC 3WIHL 3ARTA 4MJIA 4LCWA 2FX8H 4EBQH 2NTFA 2Q76A 2E7MA 5EZJA 4N5ED 3VDCA 5FK9B 4X6CA 3UJTL 1IGTB 4HC1H 1HKFA 4P2QA 3Q48A 3TN0A 4FFYH 1AI1L 3T77B 1KXTB 3TCLB 2Y25A 3NIFF 3HS0B 1CDIA 3BAEH 4DZ8A 4PJDE 5CUSH 3PDOB 1MAMH 5FHBH 4TRPL 3QCUH 2R29L 1LO4H 5HPMA 1TCMA 3S37L 5CD3A 4LAQH 3OAZH 2HVJA 3IDXL 4ACPA 4HXAL 5JA9A 3LEXA 5C0DB 3HNSL 3BO8B 5I66A 3SDAC 4JRYA 5CGYD 3SGDI 3TVMD 3VXRE 3W2DH 4ZUWB 5F7FA 2UZIH 1NKOA 3ARGB 1OSPH 12E8L 4K7PL 2XIDA 4X5XB 4S0TD 5EWIL 5E1AB 5EG6C 1UH3A 4MA7L 4OF0A 1RZ7H 5DUPH 4TOYH 5KBNC 3FQUB 3QULB 1E6OH 5ESQB 5A2JH 1DP0A 2R1XA 3K3QA 4G6FD 4L8CB 5FYJH 2OP4H 1LILA 3JWDH 1CDYA 4WU5A 3K1KC 1BHGA 2V7NA 5DJAB 2VLRE 4JFZL 3FFDA 4YO0A 4XPFH 1YEDA 2B1HH 3ZDXE 5EOTA 4XHJC 4OCWH 3REWA 5ILTH 1MF2L 1S9YA 4L29A 3C08L 4ZUSB 4OV5B 3HB3C 2NX5A 5JPNA 4CKVX 2LTQC 4ZNEE 1S5IH 2JCCE 1B0GB 4N8VB 4I3SH 1QSZA 3GRWL 3I50H 2YMXL 4LBEB 4Y0GA 5GSVB 4LCCC 3P4NB 1OP3H 4GG6A 4TSBL 4YXHL 1MCOL 2AEWA 1ZTXL 2A1WL 4BM7A 4X4XB 3FQWB 1CFTB 1MI5B 2BVTA 3K74B 1A6PA 4NGHL 4Y4KB 1WTLA 2Z31C 3SQOH 4ZG1A 2ZP0T 1FNHA 2EYTA 2VL5B 2VAJA 2PUQT 1IGFH 3D87B 3PUCA 4FQLH 4F7MA 3QUMA 1N0LA 2E27L 4OLXL 4PYGA 3ZDZF 3BEVA 1ZLUH 1KB5A 1T3FB 2DL9A 2JJUA 3RAJH 2J2ZA 3MA7A 3JSSA 1FAIH 4LGSB 1FO0A 5AD0B 3HC4H 3GDBA 3R06A 1QPPA 1NGYA 3GSVA 5DD3L 4RX4D 3SKMA 3FO0H 3LKPA 1WJ3A 2OL3H 4TVPH 4WW1B 3ULVC 4KHXL 2W0LA 2HFEB 1EDQA 1FG9C 3B9KA 4ODHH 1Q9OB 4YX2L 1FBIH 2R0KL 3WE6B 2R69H 2CXKA 3U7WL 1KCUL 4H88L 4JFQA 2P5WB 4ZOEA 3EFFB 3EOYG 1IBGL 4KVNH 1BJ8A 4JZNB 3H9SE 2CR3A 1DQLH 2IJ0C 2AJVH 4PJ9C 4F33A 1T89C 1QA9B 3VXUE 3SJVA 1NGWB 1V3LA 1UVQA 2I07A 1U2CA 2KBGA 1J8HD 2OJEB 3QEUB 3MFFB 3RWGA 3PE9A 1T21A 1SBSH 1I75A 3R0NA 3QPQD 4LVNB 3B8YA 3P40A 3MRCB 4JPIA 1NFIB 3IFNL 4P2OD 1FL3A 3OAUH 4Y16B 4EXKA 3SDCC 2YZ8A 4AM0B 6FABL 4LKXA 2A6IB 3TO2B 2EEBA 4F80A 1F42A 3O8XD 4MJ4A 3CIQA 5DVKA 3KPMA 4K9EH 4PJDF 2A77L 3NABL 1HYSC 3KLAA 1ZVHA 1JGVL 1CN4A 4U1GB 3MRBA 4U33A 3QHFH 5F7YC 1I1AD 3F7QA 1V7NH 4UDUA 2XT1B 5M95B 2Q86A 1TJGL 2WM0A 5AZ2H 1QTYT 3SEPA 5GGTA 3S4SB 2AP2A 1KTDB 3IU4H 1DBJL 4KI5D 4OJFL 4HIHB 4KGJA 1U2HA 2BDNL 3F7VA 4HS6A 4UTAH 1MNUL 1WK0A 3JWDC 4UT6L 3MRQB 5CINH 3TZVA 1DFBL 1BX2A 1ROWA 4JFFB 3O0RL 3HC0A 1U3HD 2ESVA 2EKSB 1CGVA 1INQB 3MV7E 1ZSDB 4KJQD 5DJDB 1G9NL 4QOKE 3HG1B 3V6BR 2XXMB 1XR8A 3IJSB 3S35X 2FYYB 4I4WB 5FOBB 1DQTA 3GMNA 4WI7A 4AT6B 3CH1A 3HAEA 4DJMA 1NGPH 1T04A 3ZDXF 5KVGL 4NN7C 2W0KA 4O5LH 3SE4C 4NBXB 1QLRA 4HJJH 2VH5H 4ALAH 2F54A 4HUXA 3NCMA 3PWVA 2HT4D 2JCCF 3BJLA 2LU3A 3RVWC 2GCYA 4JHAH 2G60H 4PJCF 2E6PA 3QUZA 4PJEA 4JDZB 1FRGH 1NGXB 3BISA 3MSPA 3M1BB 5IM7A 1HQRB 1U93A 2P5EB 2IH3A 3I84A 4OCNC 1HEZA 4NQDD 2LABA 5I1CL 1EAPA 4PRNA 3RBGA 4MLIA 3TNNB 1FYTB 3PWUA 4LRNH 25C8H 3NZHL 3MJ6A 5IESL 3BKYL 5DDHA 2CK0H 3BP5A 5AUMA 5I8KH 1JGUH 1XF3A 4J4PC 4ZXBC 3ESUF 3VI4F 1FN4B 5KSAD 3S37X 1MWAA 2ZUXA 1CE6B 3A6CH 3M45A 4CMHC 5E2UH 3OSKA 2VQTA 3DO7B 3DUUA 3VXMA 1NJ9B 3EYUH 1N6UA 1BJMA 1WBXA 5DRXA 5GRJL 4JKLA 3MV9D 5IB4B 4XVUC 5C0CE 1U92B 4MXWL 5DRZB 4QT5A 4DW2L 1W0VB 2RBLA 1REIA 3EO9L 4K7PX 3WIFA 5FGBC 3QWOB 5F7WC 1K8IB 5D93B 5DSCB 4G8GB 3OB0K 3AB0C 4JPWH 3G5ZA 4ONHB 3MRLA 3PWPD 1NMCB 3CVHA 4KJYA 4PP2A 5DD0H 3ZE2E 5EO0B 3VFUB 4H26A 4M3JA 5HJ3A 3RQ3A 5CSZA 4L8BB 3Q5OA 3T4AA 4MJ5B 1B2WH 3SOBL 1G84A 4DUWA 3VE0A 3FHAA 4K9EC 2PYEA 3CFJB 4LLQB 4K3DH 5CSGA 4K8RL 3BVNB 1A4KA 4XB8A 3MUGA 3DTXB 1NPUA 4ELME 2IH1B 1BLNB 5KVDL 4KY1H 3BKMH 4DCQB 3RVXD 3MREB 1JPSL 3IETA 5IROC 5IMKA 1AGBA 4FQQA 1A1MA 4MDIA 1FGVL 2NNAA 3LD8B 3VW3L 2XI9A 3GNMH 1CYGA 2WBJD 3LKSB 5INCB 5DQ9A 2AJZA 3ULUH 1LP9A 3M17A 1WAAE 3CSPA 5K9QI 1Q1JH 2EDLA 5T1MA 5IGXH 3IJHB 1CK0L 3EO1B 4W68A 4YGAB 2NPLX 4YWGH 2XWTB 1YMMD 4S1DD 1EGJH 2DQFB 3KYOA 2FJFA 1C16A 4P46B 4GSDL 3BZEA 3VFRB 4DGIH 2YWZA 3IU3A 5D7JC 3GMRA 1F97A 1RU9H 2AK4B 4FZ8L 4HUKB 1JZ5A 3VGAC 5J57B 3MOAH 5I74B 3RWHB 1HSBA 4KKLD 3V4VL 2ZUQB 1D9KC 2AABL 5C08A 4OGAC 4YHYB 3MLWL 5D7KD 3B6SA 2W9EH 3R4DA 5IW3A 2YS4A 4G43B 1F3DH 1F4WH 5E5MA 3Q5TA 4NZUH 5DK2A 5B38G 3WV0A 4ZSOA 4YFLI 1JYWA 1VDGA 1UCBL 1LO3H 3ARED 1JNLH 3ULSA 4C54A 3WIIH 5D1XC 1N6VA 2BC4A 4APQD 1EHXA 2VMFA 1PZ5B 2BNQE 5SX4H 3LEYH 5DMIL 3OJDB 4GXVH 5FYKL 2CDEB 2WIIA 2RFXA 4OTXH 2OX5A 1LHZA 5I1KH 3QDME 2GITB 2J4WH 2MQCA 2Y5EA 5F9OH 2CKNA 1Q94B 1J8HA 1P7KA 5KSUA 2BOCA 3RTQD 3OKOB 4JKPH 3OL2A 1H0DB 2ATPB 2VQUA 2LQRA 4CMMB 3GSOB 3SE8H 1DBAL 4FQ2H 3THMH 4JDTL 2XNAA 1E4XH 3G5VA 3QEGL 3INUH 2VZ1A 3D0LA 3JWOL 1JIBA 2KKQA 3AFLA 4X6EA 5FGCB 4NKMB 4LLWB 1JTTA 2J6EA 3O4LB 3K4DA 4GRLB 4ZODA 1MFAH 1Q0YH 3UTTE 3O8XA 5L0QC 1WWCA 1B4JH 3ARDC 3H3KA 4WNQA 2DICA 4L8DA 3ZO0A 3QNZA 4EVNB 4BQ6A 1I1AA 1ACZA 3S3JA 1IARB 4LK4A 3SKOB 1BFSA 1BBDL 3SDDA 2UUDH 3QI9C 3UTSB 1OQOA 2HLFD 3JV4A 5FHAH 4HUUA 4G6AC 4PLJD 1MQKL 3KLHD 4OCYH 5ACZA 5B39G 1NC2D 4P4KA 3HNTL 5TQ0H 1C08B 3W11D 3QZWA 3UAJC 4PY8I 2BVUA 4HKJB 4HUVA 3L9RA 2KQMA 2R9HC 4KI5E 5IVOA 1O7VA 2XKUA 4UV7L 1XGQB 4OQTL 5FO8B 5D5ME 3LCYA 2CDGA 3QSKB 4PRHB 1FVEB 1D6VH 3FRPA 3P73B 2P49B 4NNXA 4ISVB 1G7QA 3OKYA 4XMPH 3D0VB 3UC0L 1JZ4A 4HBCH 3SY0A 3NZ8B 3LQZA 3WHXA 1RUKL 3ZE2F 5E6ZA 3PG2A 3CDGB 4HXBH 2FX9H 4JREC 4CUCA 4R2GB 5EULV 2ADFH 4ZUTB 3A67L 1GIGL 2FWOA 1C1EL 2EH8L 1VFAB 1SJHB 3I6LE 4RNRB 2DQJH 2EYSA 3D1MC 1OP9A 4ELMF 1OGAB 4S1SL 3ULUC 1CLCA 4QWWC 3OB0H 1L7IH 4UIKL 4HH8A 5HTSA 4ONOA 4G6JL 3FKUS 5DHXB 2JJTC 3L95A 3C6SA 3WS6A 5I71B 3T0EB 2WANA 4LVHC 4LSPH 3IDYB 5J6GB 3AC0A 5C07D 1WAAF 4TNWK 1LK3L 4YJZL 5TE7L 1HIML 1UWGL 1NAML 2B2XH 4M02A 3QEQD 3TO4A 1D3CA 4NQDE 4KUZH 4QKXB 5HI3D 1CD1A 2XZAL 1L9NA 3WO4B 3LHPL 3FO2B 3SGKA 5C0GB 2X40A 3KYAA 1N2RB 3KPLA 4QHUB 1JE6A 1XZ0B 3TNMA 4UQ2B 5E8OA 4WEUD 1JGEB 2LVEA 4FP8H 4XAWL 5FAAA 3QUYD 3HTLX 5KSAA 3LKOA 4I13B 1RUPL 3FFCB 3KWWB 3NN8A 2P42B 4X9HA 1EHLH 1A2YA 2IQ9L 4Z7WA 3DX9A 4Y19D 4XVTL 3MV9A 3ZSTA 4JN2A 4F9PC 4MNQE 5L7XH 4MYWB 3PP3H 5KVMC 5EU6D 2GJZA 4LSVL 5D9SA 4JLRB 4JO2H 2QQLL 2NY1D 5FGRA 1OAZL 3D2UD 3PNWA 3TPUA 4UTBH 4KRNA 3OKDB 4OZHB 3WJJC 5E6IA 1X7QB 3EGSA 2UZYB 4U1MA 2O5YH 3AVEA 1LO0H 3MLVH 4GAYA 3S3PA 1FNEA 2Y07H 3UBXI 2AKRB 4YNYA 4ZO8A 3GUTB 5H2BB 3OG6B 3K4AA 4WENB 5CIPA 5IB3A 4Q9CA 1UQSB 3V6OA 2P46B 1GC1L 1IGJB 4X4YB 1QKZL 5DURB 1B0RA 4WI5A 4OD3H 1T66D 1KLUB 4NO3B 2MKLC 5EZIH 1FDLL 1S7XB 5LAXA 4MVBD 1NGZA 3VA6A 3AY4C 5LGHH 1KCSL 4AK1A 1YY8B 3CGTA 5A2IH 2ITDA 4BZYA 3FB7A 4BFIA 4DOHB 1SY6A 5E08L 1AR2A 3VXOB 3RGVC 4G6ML 1HOCB 2EYRA 4L3EB 1Y0LA 4H1LH 5GRVL 4NUJA 4FFWC 1MEXL 1R3JA 1NAMB 2J12B 4WVRA 4QF1A 2DYPD 1YDPA 1BFVH 5DUBA 3TBTB 2ADIA 3FQTA 4WW2F 5INDB 5IFJB 4F7CA 1MH5B 1BGXH 4UT7H 3QFJE 1U8IB 1EMTH 2PNDA 4KI5F 5JXAH 3O6LL 5ENWA 2J3SA 1TQCC 4LU5L 3JV5A 4NQVB 4OLZL 3DV4B 3NVQA 2BERA 2A73B 1LE9A 5ABDE 3LN5A 4ZAKB 3AXLB 2PXYD 5C86A 4PJIE 5A16B 4KUCF 1S9WB 2F9BT 2I25N 5GGUA 5D7KE 2EH7H 4PY7B 4YPGA 1SEBB 5K9OA 4MAYB 4CADB 5IBUB 5J1TC 3AREA 1RIUH 4AIZA 1QRNA 2VDQL 4K7FA 5C9JB 3EDEA 5EC2A 3W39A 5IMLA 1GH7A 3T08A 3AS3A 5HGAA 3VD3A 2OZ4A 5H94B 3HPJA 3KDMB 2B7DT 3DMMB 5E0QA 3SDAD 2R2HB 2YXFA 1AY1L 2XPGB 4G9DB 5IV2A 2H2PC 4M61A 5D7LE 2XKNB 4Z7OE 1XT5A 4Q6IA 5E70A 4G9FD 3QHZL 3QQNA 3CFDB 4U1KA 4OBSA 3RTQA 3ME0A 1P5UA 3N0PB 2F53B 2H8PA 1FPTH 4HEME 4WUUA 5CMAA 5IG7A 2B5IC 3TYFB 2EDDA 5EO1A 1HHKB 4O2EA 2VDLH 2BNUA 1QBMH 4AG4L 3QUXC 4IOFC 1TZHA 4LEOA 4XH2B 5F88A 1K5NA 1SEQH 3O3UN 4GRMB 1FP5A 4NQCD 1B4RA 4PRIB 5J12B 5EO9A 3MROA 4PJ7E 1UT9A 3FTGA 1E4WL 3LEVL 4PJBE 2Q7YB 1P7QB 5T3XH 1J5OL 5CBEB 3HB3D 2VXTH 5J9PB 1F5WA 3RHWK 5EU7E 2ICWB 5T1KD 4PGDA 2GY7B 1N6QH 3KJ6L 3L7FB 3TV3L 1KJMA 3I9GL 1YNTA 3VWJD 4V2CB 1F6AA 4J6RH 4C56D 5HSFA 5JHLL 5GSRA 5HYSA 1J11A 4UBDC 2VDOL 2X70A 3SE9L 2KDGA 3CVIL 3BT2H 3QDJB 3DGCR 3V52H 1AGDA 4KRPB 1MRCL 2Z31D 4P9MH 5F7DB 1R5IA 3RNQB 3KVQA 4JHWH 4PJXE 5TDPA 4YHML 5I30L 4ONGH 3IRPX 3VRJB 5CZKA 1I1FB 5ID0A 2F8VA 3CDCA 2D0FA 2FHCA 4H8WL 2Z4QA 2XY1A 1I1YA 1ZXQA 4KZDH 1B90A 3DX6B 5BS0B 3V4PH 3GJEB 3ARPA 2GHWB 4FQ1L 3QIBA 5DO2D 3NACL 1OAUH 5E9DD 5IVXA 4N0RA 3S36X 1GCFA 5EU5B 5EPMA 4HMEA 1QFWL 1UCTA 4MJIB 1YJDL 4N0YL 1II4E 4LCWB 1X3DA 2W9LA 2ENSA 2H26A 5FDYA 2NTFB 2Q76B 4KROC 5EZJB 5BO1L 1QQDA 5MEND 2DQUH 4X6CB 3HN3A 4MS8C 3FN0L 4P2QB 4PJ9D 3TN0B 5F96L 4YGVA 3WFCL 2J8HA 1KB5L 4XCYA 4X5WA 2YK1L 3EFDL 5I1LA 4DZ8B 3MLUH 2YUZA 4XI5C 1OAXL 3WDHA 4M7ZC 4L4VA 4LLVA 5F7LB 2NYYC 5IBLD 5HPMB 3QEQE 3B9EA 2RCSH 4TNVK 5DD5H 5CD3B 1P69B 4O9HH 2HVJB 3ILQC 4XC3L 3UZQA 3SDCD 3LEXB 5I66B 2E7HA 4JRYB 2LE9A 3EIFA 5TGBA 3T8XA 1AI1H 4R4BA 4HKXA 2RHEA 5D2NE 4UOJA 2Q20A 1LNUA 3OPZL 1HYSD 4I1NB 3TWCH 4Y19A 3SDXA 3G5YA 3NCFB 3SQBA 5IQ9A 3I02A 5JUEH 1A7OH 4U6YA 5EU6A 1G7LA 1IVLA 4BSVA 3S37H 3V5DA 4WU5B 3D2UA 4ZYKA 4XGZA 2V7NB 2DQHL 1RIHH 4D2NA 3FFDB 4YO0B 2FECI 1P6FA 1UADC 1YEDB 4ZOCA 4Z7OF 2PR4L 5EOTB 2AJXL 3REWB 3LV3A 3TA3A 1S9YB 4L29B 5LQBL 2ZOLA 2BVQA 4FQJH 4J3WA 2NX5B 3O2DL 5JPNB 5EWIH 3NA9L 4MSWA 1RZ8A 4URTB 3ET9F 1EIBA 3QRGL 5CEZD 4X4ME 1RUQH 1PFCA 2R8SH 3E3QC 3S34L 4GG6B 1KEML 1WT5A 4PJ7F 2KZ1B 4PJBF 5GGTL 2XZCL 3OR7A 1MF2H 3L3GA 1N0XL 4OZGE 1BZ7A 1GOGA 2CIIA 2FH6A 2A83A 4Z0XA 3TC9A 1NCDL 4OT1L 4P3WA 2EYTB 4F7MB 3QUMB 1KNOA 4PRAA 3BEVB 3EJYC 1KB5B 5T5NG 1IT9H 1P5VA 5GIRA 2YMXH 5HYJD 2FR4A 2AJYH 2GQHA 2N4IA 4ZDHA 3MA7B 1SMOA 4QHMA 1FO0B 2IF7A 3ARGC 3R06B 1EZVX 1NGYB 3GSVB 4LARL 4U3CA 5F8QC 3SKMB 1KTRL 3UTOA 3LKPB 3IKCA 3RY4A 5CLTA 4ZFOA 2V17L 1GGTA 5MEQA 2HMIC 4PJXF 2Z92A 2X9YA 3B9KB 2ZKHL 5F3HA 3BN9C 2PXYA 1T1ZA 4J4PD 4JFQB 4ZXBD 3ZSSA 1B0WA 3BPLB 2NY0D 4FQIH 2XZQL 4F33B 1F11A 4PJ8A 1A6TA 5SX4I 2IADA 2NXYB 3SJVB 4PGJA 1UVQB 2I07B 4YHLH 5DHVA 5DD3H 3LPFA 4OZIA 2MHAA 4Q97A 3RWGB 1JRHL 4XVUD 1T21B 3EDFA 5CBAA 1KCRL 4ZOBA 4MD0A 4XTRC 4JPIB 3Q5YA 5E4IA 4G9FA 1FL3B 4AIXA 3P2TA 1KGCD 3QCTH 2Y06H 4LKXB 4X6FA 1IBGH 1GHFH 5L8LB 1E4XI 3P0VH 5I1EH 3NCYP 4PBWD 4Y4KC 3KPMB 1XGRA 3OZ9H 3KLAB 3UMTA 2NY2D 1MWAL 3BQUD 4PUBL 2CDFA 3MRBB 2ORBH 2FGWL 1D5XA 4UDUB 4O2FA 2Q86B 1CVSC 4KGLA 3RL1A 4M43L 2K3TA 3KS0H 2M1KA 1C8PA 5A2FA 2X89A 3G6DH 4OFYD 2VABA 5I1GH 1QSED 3F7VB 5T1KA 4HS6B 3WCYA 1PGRB 1BJ1H 2GSIA 2M8XA 4LSRH 3TZVB 2EDRA 4DK6A 1BX2B 5DJ6A 3VWJA 2DWDA 3HC0B 3S3SA 3KXFD 5F1KC 2CIKA 5GGQL 2ESVB 4AEHH 4W4OC 1XR8B 4C56E 3MNWA 3FL7A 2BJMH 3GMNB 4QHNB 1WZMA 3CH1B 1Q9LA 1WEJL 4MQSB 3HAEB 5F8RC 3RWFA 3V7AE 1T04B 4HGMA 1MNUH 4I0PA 4UT6H 2EDBA 5DD1L 5D7JD 1GAFL 1QLRB 4WWKA 5FYJU 2F54B 3BE1L 2DI9A 2EIBA 3CFEA 4HUXB 3PWVB 4ZUUA 2GCYB 4Y16C 5DQDL 1U91A 5DRWA 4LRIA 2F5AL 4YQXL 2J8OA 3QUZB 4PJEB 2R0WH 3VXRA 1ZANH 5IM7B 2VB5A 4FQCL 1U95A 3RZCA 1U93B 3HE7A 2IH3B 4CU7A 3OKKA 4PJ5E 4P57A 5A1AA 5IFHL 1HEZB 4NHCH 1W0WA 2YC1A 1JPTL 2C1OA 4LIQE 4U1SA 2IPTL 4KTDL 3ULVE 3VFMA 3IAGC 4OZGF 1EAPB 5DGRA 4PRNB 4UMGA 4NKDA 3PWUB 5E5RB 4E41D 3BWAA 3ARFA 5L9DH 3PHSA 1ZLSL 4WU7A 1UACL 3QDAA 5DDHB 3TGXA 2FO1A 3LPGA 3UP1A 2VLRA 3BP5B 5AUMB 4WEBH 3M8OL 5MENE 1XF3B 1MJ7H 1Q72L 4X7TA 4JFDD 1JF5A 1MWAB 4KJWC 1QEWB 1C5CL 4P9HH 1OTUC 4U1LA 3DUUB 3VXMB 4ZFFA 1F8TL 1WBXB 3N1PC 5DRXB 4ZNEA 1DBMH 2DIJA 4YXKH 2E8ZA 2HKHH 1MJUH 4MQXC 5JW3L 4QT5B 5GS3A 3WIFB 4FOMA 3GEWB 3QG7L 3DJ9A 2UY7A 2EDYA 4FQHA 4ORGA 4CL7A 3IDNA 1G9EA 4U6TA 1JL8A 1JJUA 3I2CL 3G5ZB 3DXAE 1CQYA 3AU1A 3MRLB 4IRZH 3CVHB 4KJYB 3OJVC 4PP2B 4YFLF 1IAIL 4G6AD 4H26B 1YEFH 5HJ3B 3TT3L 5IQ7H 5CSZB 2D03L 4M7LL 3RY5A 1T5WA 5CS7A 3T4AB 3UX9B 3UAJD 4YBQD 1YA5A 3WNOA 3EO9H 3VE0B 1KTKE 3B43A 1D5IL 2PYEB 2HTLD 1BBJA 2CUHA 1A4KB 3MUGB 4HWZA 4BQ9A 5FYJE 4K3JL 5F72S 5F97E 3BPNB 1LDPH 3IETB 1QLFA 5IMKB 1AGBB 4FQQB 1A1MB 4MDIB 2NNAB 1DR9A 2WZPD 5M94B 4ONFH 1X9QA 4JFYA 4P5KA 5FM8A 3WLWC 4A6YH 2R4SL 5DQ9B 2AJZB 1DQQA 1NLBH 5B3JE 4P3CL 5I17A 1LP9B 2Y36L 3M17B 3VFSA 3H9SA 3TJEL 5T1MB 2B4CH 4Z0BL 1I1CA 1R0AL 2FHFA 4QXTA 3VXUA 1Z9SA 2PETA 2FB4H 3ULUD 5HHMB 5L6YL 3KYOB 1GGYA 1C16B 2FJFB 2JB6A 3BZEB 1JPSH 1ZHBA 5DFWH 4Z95L 3IU3B 3GMRB 1HINH 2YD4A 2ZNXA 4B0MM 4LKCA 2H2SD 1T4KA 4QXGH 3MJ8A 1HSBB 1FC1A 3H0TA 3CH8A 3KGRA 5C08B 3VXSD 1DQDL 3B6SB 3BP7A 4ENEC 4NKIL 1ETZA 1MFCL 5E5MB 5D93C 1MIML 1OSZA 3MLPA 3LKRA 5DK2B 3LB6C 1V7ML 2VLKD 3QIWA 4ZSOB 4F8QA 2VZTA 4M8QA 5GS0D 1NMCC 3ULSB 1KBGH 4Q9RL 4OLEA 1K6QL 2BC4B 4DK3A 2GYSA 4MNHA 2ZUSA 5T3ZL 3HMXA 1I8KA 2C7UA 2JTDA 4S0SD 1J10A 3V4VH 2WIIB 2RFXB 4P99A 1M1SA 5E8PA 2A6JA 3GIZL 1I8LA 4TVPE 4MMXC 5ANME 1DSFL 4XXDA 4OI8A 1J8HB 1P7KB 5KSUB 2BOCB 1A3LH 2DQGH 3JUZA 2YPKA 1I9EA 1T80A 3ARUA 4HWBL 1ES0A 1JGLH 4OF5A 4NM8L 3L3IA 3D39E 5KVFH 1RUAH 3LD8C 1HCVA 2XNAB 3G5VB 2YD5A 3D0LB 5HYIA 4KMLB 3ZTNL 4JVUA 4QOKA 2XQYG 4X6EB 4ODSH 4ETYA 2YHGA 3NIGF 3PHOA 4P9HC 4O02L 2D7OA 4UIMA 3O8XB 1HWGB 3GMPA 3OKNA 3O2WH 2L7UA 3DV6A 4WNQB 5KOMC 3ZKMC 1OL0A 2DM7A 4L8DB 3BQUA 3QNZB 3CJJA 4P46C 2ZNWA 4WUKH 1I1AB 1XGUA 4X9FA 5JR1H 1DBAH 3HPLA 3SDDB 1ZHLA 4JDTH 3WXVL 3JV4B 3SE3A 4HUUB 1A7PL 2ZUQC 2PF6A 5ACZB 2I60L 4PG2A 3X13A 2FEDD 4YHYC 4P4KB 4OFYA 2L4OA 3QZWB 1U8MA 2JELL 3V4UL 4BSWA 5IFAL 5J11B 3OBAA 4HUVB 3L9RB 1U36A 1FLTX 1AJ7L 1ZAGA 2OSLA 1A22B 1HXMA 1ONQA 2CDGB 4NNXB 4U7SA 3RGVD 1G7QB 4KKNA 1G6RL 4WHCA 3SY0B 1T5XA 3LQZB 3WHXB 4LFHG 1J88A 2ZJSL 3O3BA 1ZHNA 4FFWD 4QGYA 3CU7A 5FM5O 3IS1X 5JMOC 2AJSH 1MQKH 3GKZA 1WCQA 3D69A 1BM3L 5JZ7D 1CE1H 3P9LA 4Y5YC 2FWOB 2VDML 5C0FA 2XA8L 4G6KL 2KUTA 1P1ZA 1HZHL 3HI5L 2AEQL 1PEWA 4XAKE 1BAFL 5CILH 3IDGA 1I9IL 1XGPA 2UWEA 3VXNA 3BGMA 3LIZH 3P4MA 1RZJH 5IP4A 4XCFL 1JBJA 2ZG1A 2B4CC 5A2KH 3L95B 3C6SB 4MNGE 1ND0A 4GRLC 5AYQA 3B9VA 1N5AA 5B3JF 3R8BB 5MHSD 5D8JH 3MO1A 5C09D 5JDJA 5CCKL 1JYVA 4UV4H 4G5ZL 2MCPH 2Q3ZA 3TO4B 4W4NA 4RFEA 4J12A 3S36H 4P5TD 1JZ6A 1CD1B 2VISA 1A7NL 2H2PD 3R1GH 4OSUH 1VENA 3RRQA 2HRPH 5TQ2H 1IL1A 3KPLB 3MCLH 1XCTA 2VR5A 5MP6H 2OMBA 3TNMB 5E8OB 1HCFX 4RFOL 3WFBL 4JR9L 5KSAB 3LKOB 2R1YA 5IHUH 1H8NA 3NN8B 1UFUA 2DMKA 1A2YB 1XGYH 3MLRH 3QUXD 4Z7WB 5TE7H 1KTLA 3BYTA 3DX9B 4L3AA 1KF9B 4HG4K 3MV9B 5BW7A 1KCLA 3VXPA 2ILLA 4JN2B 1E6JL 2GJZB 5D9SB 3OKEA 1EBPA 5ALBH 5C0BE 4MCYA 2IG2L 4K2UH 4MGXA 4J1UA 5ELIA 3PNWB 3SCMD 3TPUB 3U48A 4JKKA 1NFDE 1YNLH 4R2GC 5E6IB 5F44A 3D85D 2EE3A 3Q0HA 1F90L 3EGSB 4XAWH 2YEZA 5HI5D 4U1MB 2AS5M 1TTGA 3MCG1 2ZUYA 4GAYB 5DEFA 1CLYH 3EKCA 1FNEB 4YNYB 5D7SL 3BDXA 3CFKA 4IJ3B 5CIPB 4ODTL 2ARJA 2DOCA 2BY3A 4NFDA 1IGML 4NO2A 3C9NA 4YZFE 1B0RB 4LSVH 4X6DA 1CICC 1UM4L 1H3WM 3WFDL 3DSFL 1OM3L 5I71C 1ZGLB 5LAXB 5BZWA 2R1WA 1NGZB 4QO1A 3IDYC 5DFVC 2ICEA 4BH7A 3C6LD 5JLZA 5J3HC 3PGCA 4F9LC 4JFPA 5FO9A 3FB7B 4BFIB 1NCWL 1CFVH 2APXA 1ZLWK 1F13A 2HJLA 4TUKL 2BNQA 5EUOE 2EYRB 4BH8A 3BRGC 2CUIA 1Y0LB 1LQSR 1EO7A 1GRWA 4FMKA 3U0PA 4NUJB 5FYLD 1R3JB 3PV6A 3QDMA 4HMDA 1SVZA 4JPVL 1L6XA 3FB8B 4QF1B 5DUBB 1YDPB 3RIAF 5EZLA 4OGYH 2ADIB 3FQTB 2JF1A 2A9ML 5TH2A 3RL2A 1SJEA 4F7CB 3VGEA 3FOMA 3ABZA 5CZVH 5ENWB 2VDRH 2EC8A 4KROD 3UPCA 3QDHA 1T2XA 4QRPD 4JY6A 1LE9B 3LN5B 5EBGA 5EOCL 2X4PA 1LEIA 4E42A 4LPCA 5GGUB 1MEXH 3VXSE 1ADQH 4YPGB 1NBZA 3C09B 2DQIL 1NAKL 3DVGA 5K9OB 1HN1A 3AREB 2NYYD 3I3BA 4AIZB 1QRNB 1RZJC 4K7FB 2FJHA 5EC2B 3W39B 5IMLB 1ZGLP 1INDL 5HD8D 5KSBA 5HGAB 3ILQD 4B7LA 4HH9A 4NWUL 3GFUA 3HPJB 4DN4L 2B8OT 1DLFL 5IV2B 4NFCA 4S1QH 4M61B 3MLSH 4MQTB 1T2QL 3IT8D 1UB6A 4Q6IB 3S7GA 3UJIH 4OM1H 1MHPL 1VHPA 5DWUL 4U1KB 3RTQB 1PY9A 3MV8A 2H8PB 3BZDA 4NP4H 4WUUB 5CMAB 2R39A 5IG7B 5D5MA 5EO1B 1YN7A 4O2EB 4LL9A 2BNUB 3S88L 1Z0MA 1VA9A 3OAYK 4KHTH 1TZHB 1VB9A 4LEOB 2WMPA 1FV1A 5MI0B 5F88B 5J0BA 4IBLT 1K5NB 3CSBA 3DOSA 1PG7L 3V2AR 5JIIA 3ZZ1A 5EO9B 3MROB 1RJCA 3FTGB 3RDTA 4LCIH 3GBNH 4WI4A 2XN9E 4ERSL 5DT1L 4MAUL 3HMWL 4OLVH 5D1ZD 3ZT5A 1KSRA 1X5ZA 4YFEA 4LSUH 3I6GA 5I75B 3GO1L 4FNLH 1MJ8H 2X41A 4PGDB 4XP6L 3HE6A 3QFDA 3QHTC 3RA7H 1MCCA 1KJMB 1YNTB 1KENH 4HK0A 1F6AB 5F7HA 3VG0H 5LXGH 1UWXK 5GSRB 5HYSB 4ZAKC 1ZHKA 2X70B 5ADOH 1EAJA 1RIVL 2ZCKL 1NFDF 1YEHL 4PTUA 1AGDB 2ZCLL 3QWQB 1DEDA 4HPOH 4DKFL 4F3FA 4MAYC 1R5IB 4FQPA 2W65A 5TDPB 4WRLA 1OW0A 4L9LA 2HJKA 4XBEH 5ID0B 3DMMC 3S9DB 2YKLH 2Z4QB 2R2CA 4YHOL 1I1YB 4U0QB 3K1DA 1CF8L 4U6VH 3QIBB 3GBMH 5GGSY 4YZFF 1FGNH 3TT1H 3ARGD 2VDOH 5IVXB 4X6BA 1GOFA 1PKOA 1C5BH 2FL5A 4OKVA 2BVOA 5B38A 2HMID 3QJFA 5EPMB 2UVEA 4PJFE 3NMEA 1GC1C 4ZFGL 4LDOB 1FIGH 1RMFH 2VC2L 2H26B 4PJHE 4NQXA 1QQDB 3FQNA 3DRTA 3F7RA 4YGVB 5AG8A 5C09A 4XCYB 5C0EA 4X5WB 5I1LB 4BQBA 4NZJA 1PG7W 4LNRA 3QNYA 4Y4FA 3RBSA 1YEEH 4ODVL 4LLVB 4YXLH 4U7MA 4JY5L 1BREA 1F4YL 4O4YL 1YY9C 4XTRD 1TVBA 3ULUF 4ZFOL 1Z9MA 3TJHC 5I2IA 3WHE1 1ZLWH 3MRJA 1EUUA 5TGBB 3V6ZA 3FN0H 3QUMH 3T8XB 3CFBA 1MI5D 4R4BB 4HKXB 1KB5H 4Q9QH 4KRPC 1LNUB 4WV1A 3ZYJA 4Y19B 1OAXH 3SDXB 3G5YB 2YRZA 1MFBL 2DI8A 3C5SA 3A6BH 5IQ9B 3NGBB 1FO0H 1TPXB 1XEDA 3I02B 4U6YB 5EU6B 2WWKT 1G7LB 4BSVB 2AEPL 3V5DB 2NY1B 3BKJH 4GXUM 3D2UB 4ZYKB 4Y4HC 3SCMA 4XGZB 3RWIA 5IWLC 3HAEG 1FFPA 4D0DA 1WWWX 3KR3L 4NNYA 1PSKH 5B39A 1CTOA 1BECA 3BZ4A 4TQEL 3LV3B 5HHOE 3TA3B 4UNVA 4FFVC 1EK3A 3OF6D 5CJ8A 2ZOLB 2BVQB 5JXEA 4MSWB 1RZ8B 4NO5A 4UINL 2ADGA 3PHQA 1ORSA 4JO3H 2P5WD 4MWFA 5I8OL 1A6AA 5B21A 3STLA 1OARH 1S7RA 1AQDA 4OCXL 2DD8L 3GM8A 1AXIB 4LEXH 4PJIA 4AH2A 4KDTA 1QFPA 3C6LA 2WWKO 5I1IH 5KS9E 4JZJA 2AJXH 3OR7B 4X8JA 3VFWA 3L3GB 4YFDB 5IK3A 2D31A 4FTVE 1BZ7B 2CIIB 3CXHK 4NUGH 2A83B 4Z0XB 4R3SA 2FEEL 4GMTL 4DTGH 2JJVA 1KNOB 1HWHB 2HTKD 4PRAB 1A1NA 4BZ2L 3OAYH 4XMLL 2B0SL