2K7PA

Filamin a ig-like domains 16-17
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
188
structure length
188
Chain Sequence
GAMAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Filamin-A
publication title Atomic structures of two novel immunoglobulin-like domain pairs in the actin cross-linking protein filamin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 32
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k7pA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k7pA01
3HPLA 3QSKB 2NQCA 3BX7C 3CX2A 4NDMA 1EV2E 3BKYH 2ZPKH 1MFBL 1Q0XH 4KUZH 1JWSB 5KSAB 1BQSA 5BRZD 2P7TB 4KPHH 4LSSL 2Z93B 4OTXL 4HIIA 3VFRB 4V2BA 2YRZA 4I5BA 3U4BL 2NY4C 2X4PB 4MDJA 1MJ7H 1TQBB 4LLVB 5I74C 5ACLA 3ZKND 5T3XH 5K9KB 3RWHB 2F5BL 3ZLQC 4YFEA 1CK0L 1C16B 1PJ9A 2EEAA 5I8EA 4BJLA 1DBML 2YXMA 4KRMB 4HS6B 2W9DL 1FSKC 5EC2B 3S96B 3LPWA 4BQ8A 4LVHC 1KEGL 3FZUD 3BN9D 4KY1L 1JZ3A 1KTDB 1MFAL 3CMOH 3WNLA 5BV7C 4TOYH 1B2WH 1GGUA 3QRGL 4AMKL 3B4NA 2QQLH 1FZJB 3MBEB 2G5RA 1OB1A 1PQZB 4OT1L 2HTKD 4I18A 2X1OA 1FFOB 3V79C 4WWKB 1DL7L 3QJHB 1SVZA 4OCXH 3QEQB 4WUUB 3RKDD 4JRYB 1CF8H 3K1DA 5EOCJ 1YDPA 1I4FB 1IGYB 2P47B 3CC5B 1K5NA 4NKDA 1A4JA 3PWNA 5IWLA 5EUOB 3EDKA 3ZYOA 2QSCH 2W0FA 1AKJA 3EOTL 2EH8L 1Q9OB 1RIHH 5A16A 3KPNA 3RWEA 4NSKB 3T1WA 4V2CB 1HHGB 5F9JA 3MJ7A 4CDHA 1U6AH 1CDUA 2BC4B 3SGEH 4M1DL 1QACA 5DJ8A 5I8KH 5EZOL 1IKNA 2R1WB 1FCCA 3I84A 3MCLH 5GS3A 4CUCA 4M43H 4OZFA 4P4KC 2VWEC 4PJCF 1QG3A 1F2QA 3Q2CA 3D9AL 4EIZC 2GT9A 4J12A 3V7AE 3ES6A 4N0FA 4YHIA 3CFEB 4HT1L 4KI5F 1I8LC 1G9MH 2EYSA 1AKJD 2AABL 4BFEA 5I66A 3C8KB 3IXAA 4QHNA 3TWCH 3WLWC 3JV0A 4UUJA 1VFUA 4X83A 3OJDA 4IDLA 1OCWH 2VZ1A 4MCZA 4BH8B 2E9IA 4GKZB 1IM3B 1I8MA 4AZ8A 1GOFA 1RHHB 3QXDB 3V5KB 1ZEAH 5I1IH 3PIQA 1NMBL 1XGQB 4KK6C 4APQC 5E70A 2EO1A 3TVMB 1CFSA 4F9LC 3SEPA 3WKML 4AL8H 5C0FA 3PWPE 5CJQH 4LQFH 3MNVA 2BNUB 3E6FB 4N8CL 2B20A 2BZDA 5D2NE 3LQAL 1H3GA 4RISL 3VRLE 5GS0H 4HS3B 3EYOB 1CLYH 4L5FL 1V3JA 4GG8B 4ONHA 1D7FA 3SDXA 3R06A 1MUJB 4Z7WB 1GPOH 4JFQA 3V9FA 4IS6A 2R56L 2ZUTA 1NJ9B 1QRNB 4IMLB 3VH8B 4RFOH 3HMXL 3QULB 2HWZL 3GHBH 4S1RL 1HH6B 5EZJA 1JL8A 3AMLA 4NWUH 1ZLWH 5F71A 5JHLH 2ICWJ 4LQ1A 2X9XA 4L9LB 5KTEH 4TSCL 3B9VA 1JHKH 2XTJD 1MPAH 2A38A 3N1MC 3OB0H 2D4DA 3RJDA 3F12A 3THML 3UO1H 3AREB 1JYVA 5C0EB 4WFGE 3QB7C 2FIKA 3OXRA 4ZFZB 2BVQA 1XZ0B 4UTAL 4KK5C 3TA3B 1T03H 3RUGA 3QNXA 2D9CA 1G9NH 3TBWB 4OGXL 1IRAY 5DEGB 3MLUH 3NGBC 1LE5A 4R96B 5GRWA 1INQA 4NIKB 3DO3A 4R8WH 3K2MC 5HHVH 5E8NA 4M93C 1T89A 4Y4KA 2IFFH 1ES0A 2Z0BA 1A0QH 2X4RA 3BT2H 1BOGA 1U8LA 2IALA 5I73B 3KYKH 1JNJA 4QWWC 1I8IA 4F8QA 4FHBD 3AU1A 1LEKA 2CLZA 2GK0B 3VE0B 3SBWC 3U0PB 4D9QE 2EE9A 1KELL 2BVPB 4WHTB 3M17A 4OD2A 4LU5L 1ZSDB 5CSZA 3TPUB 4DUXA 3VD3A 4HSQA 4RFEB 4UQ3A 1IAKA 3UAJD 3SDCA 3WE6A 3OJMB 5ALCL 2XN9B 3WFEL 2IWGA 5E56A 2CIIB 4J7RA 3MGTA 2VDNL 1NAKL 3ULUH 4NJAL 2I9TA 1MFDL 3DVIA 4JG1H 1PYWB 4Q9RL 3FRUB 4WW1A 3J7HA 4MB3A 1JMXA 4Z76B 4PJHB 1FC1A 4Y4KD 4KZDH 3N1GC 3S37X 2EDDA 1X6LA 3VFPA 3RGVB 4AIXA 4QXTA 4FXKA 2BXYA 2GY5A 1OY3B 2VO5A 3HI5L 2NY2B 2QSQA 1W8NA 2DLTA 5J3HD 4FXLA 3DLQR 5IV2B 1D6EA 1HHKB 3HI6L 1MWAH 3SQOL 5E24E 1CG9B 1J87A 4OZIE 3SDCD 1BX2A 5GIRB 4N5ED 2W0PA 1ZAGA 4N90E 2J2ZA 3S5LA 2C7UB 4OV5A 1X5ZA 2DLFL 3LQAC 3LS4H 2VLLA 5J56B 3CK0L 1DUZA 3ZSSA 3EBAA 5HGDB 3RA7H 2GJ6E 3OKLB 4P9HH 2FB4H 1MCPL 1X5AA 2X7LA 4U1IB 4WO4B 4CJ1A 1D5ZB 2R0KH 1FFQA 3MV9A 3UJJH 4YXLL 3DGCR 4CRPA 5IG7A 1DN0B 5E94B 4FQJL 5IMMA 2DKUA 1I7ZA 1NCNA 2H8PB 2YPLA 1ZT1B 2FWOA 4XWGL 5FHBL 1FRGH 2BY2A 1R5VB 4X6CE 4R0LA 4H1LH 2FX7L 4J3SA 4WUKL 5F7EL 5DTFB 1K4CB 3VXNB 1F42A 5C0NC 3BPNC 1HEZA 5ICYB 3Q3GB 1HQRA 5MEPA 1E4KC 1OP5H 1IAIH 4FS0A 3T0EE 5BZDB 3OQ3B 5KSVA 1KCRL 3MGOB 3BVNA 4GUPB 3L3IA 4X6BA 5I71B 2E27H 3MV9D 3LV3A 4JANB 1LDPL 3GI9L 4OQTH 4XP4H 2ZUUA 1BQLH 5LG1A 4PRBA 2CUIA 3O3DA 1JFQL 2YPLD 4K9EL 1S9XB 5J13B 4U49A 2GJ6A 4NRZB 4LCWD 4EDWH 4I3GA 3VGFA 4EKXA 1WK0A 3HNSH 4HUUA 2FX8L 4I48B 3FHQA 4JFFE 3W5NA 5CD5C 3FAWA 3SHSA 2EXYD 2HLFD 2NY3D 3EGSB 2R2HA 5E8EA 1KV3A 4JPIB 1EDQA 1S5HB 1AI1L 3HE6A 3JV6B 1JJUA 3AM8A 5ITFA 5TPWH 2BRQA 5D7LB 4OBRA 3QFJB 2XXMB 4KROB 1DANT 3QQ9C 4MJIA 3E8UH 1NFKA 4HWBA 1RZ7L 3AS0A 2LV4A 1MCQA 1WEJL 3PHQA 3O6FA 4L8DB 2BOBB 2ATKA 4MA3A 4Y4HA 1EX0A 1A5FH 4G8FA 2DB8A 1DBJH 3BDXA 1A7NL 2VDRL 3N1FC 2KUTA 3F6LA 3VXMB 5KAQG 4DKEH 3P77A 5JW5B 5K59E 1DBKL 1HXYB 1OAKH 1A3RH 1QSEB 3GSNB 3SDAA 5SWSE 2HFFA 2ENYA 5JA9A 1QQDB 1A6AA 4HXBL 4OD3L 4OGAD 5F72S 2QKIB 5CJXC 1JTTA 1SYSA 1EA9C 5CJ8A 4ENED 1IGFH 2H41A 4S1SH 3QG6A 1LEGB 4MJID 5DXWA 1WT5C 1RURL 5I1JL 2GY7B 4N1EA 1QFWH 4ZD3H 4Y4HD 4X5XA 1FH5H 4MXQD 5BW7C 2WLZA 4LSVH 4PRNA 2X4NB 5D7IF 5EU7C 2KZWA 4DN4H 1UYWL 1LK2B 3LKQB 3HPJA 4O58L 3BP4B 4KKLD 4ORGB 3CDGA 1IM9A 2Z91B 3Q1SH 3O2DL 4NN7B 3SDAD 3TN0B 5E8OB 2P43B 3I6LE 3ZKNC 3MCKA 2HLAA 3T1FB 5TQ2H 1S9VB 1I7RB 4RCAA 5D7KE 2VXSL 3V0VA 4CVWA 2YA2A 1L7IL 4G80A 2DQIL 3FQWA 3QCVH 5CAYB 1VENA 1YEGL 3FZUC 2OM5A 4L29B 2Y5TA 3FQNA 4EEEA 4P59H 1UQSA 3GSOB 4GH7B 5HHMD 1H8SA 4KMTL 5DJYB 4DAGH 1OTUD 2C1OB 1VKXB 3I2CH 2HKFH 1YMHA 5DSCB 2HTKC 4Z78B 3QDJB 1S3KL 2EE6A 1LO4H 3BH9A 3JTSB 1RU9H 4LSQH 3GNML 1IL1A 3A6OA 5J1AB 1IM9D 3HKFA 4K9EC 5F70A 2OP4L 5B38B 5I30L 2YKLH 1OHQA 4I0PB 4HX1B 4HC1A 5EO1B 2K1MA 3VI3F 4L3CB 5J06A 4XB7A 1PSKH 4X7TB 3VGHA 3MODL 5CBEB 4KHXH 3BH8B 1JRHL 3MX0A 3VWKA 4XRCA 2XKUA 3K4DA 3INUH 3D0VB 2A9NH 2IQ9L 1A1OA 4X98A 4YDIL 5IROA 5CEYB 3ULVE 2DD8H 5DWUH 3QPXH 4P5MA 1GIGL 4EUPA 5KS9E 3CH8A 1T80A 1KFAH 4I18C 2I07A 1FAIH 4KI1A 4X6FB 3OKOB 1ZGLM 1YEJH 1RJLA 4M02A 1T1XB 4AM0A 3GBLA 4YHZL 4RMWA 5GRJH 3U6RB 1M7DB 3U2SB 5IWLC 4W68A 1PKQA 3MRKB 1RUQH 3ZE0F 2A73A 4ACPA 4MNGE 4LVOC 5I6XC 4QYOA 3WLBA 3BDBA 3WNOA 4Y4FA 4Y88A 1A47A 1DEEA 3CLFL 2V5RA 5D1ZA 4PJAA 3VWKD 3B83A 4YBLB 4KHTH 3O41A 3MXVL 4PREB 3U0TB 5TGBA 4HKJA 3KYMA 4U1GB 4DZBB 1BQHB 2O26U 5HI5C 1IKNC 4OUOA 4PTTB 5FGCE 3BESR 2YS4A 1TMCB 4KRPD 2C26A 1QP1A 2D7TL 4NQDA 3BKJL 3VXSB 3DNKA 4GMSH 4KVNL 5DMIH 2A83A 4ZUWA 3ARWA 4GT7A 4R2GC 5C3LD 5KVGH 5DUBB 3FRPA 4R97B 5MP6H 3RWCA 1MHPH 3QISA 4AEIL 3D18A 3C08H 4NO0B 2FGZA 4YDVB 1TLKA 5HVHB 1CLOH 3NZHL 4MAUH 2DQDH 1G7PA 3T2QA 1BBDH 3Q6GH 2LABA 4NQEE 2Z35A 4Y4FD 5L88L 1NBVL 2R2CA 1NCBH 1OAUL 4PJXB 3MFFB 5D1ZD 3BEVB 5JOFA 2XZCL 4ONGL 2WIIB 4KWUA 1FP5A 2C3VA 4QCIB 5DEFB 2DKMA 3LPGA 4O2EB 3EJYD 4K71C 1UACL 2XTJC 4NZTL 1GH7A 2YPVH 4XGZB 2HG5A 5HHOA 2DTMH 3GSVA 2Z92B 4LKCB 3M07A 3VGGA 1FG2B 3WIHH 4PRHB 3L5WA 2NLJA 4NQDD 3REVA 1S8DB 5E5UB 4NHCL 3D85B 1BAFL 1FDLH 3PGFH 2Q8AL 3BGMA 4OD1H 1I8KB 2VRAA 1ORSB 1Q72L 3QNZB 1F00I 1PBYA 1VFBB 2D7QA 5GISH 3GK8H 3FN9A 4CMMA 1R3LB 2H32B 3MRMB 3EYFB 1QPPA 1MJJB 2YSSB 1F90L 5F3BA 3LN9A 4NKIH 1IBGH 4Z0XB 2VDPH 5I1CL 1PG7X 2DTSA 3HG1E 1E6OH 3BP7B 3QXTA 3WFHA 1QYGH 5CEZE 4FQ1H 4UDTA 3BXNB 5CIPA 1H0DB 1A4KA 5I1LB 4LSRL 3BKMH 2P48B 5HHOD 5TH2A 3QDGB 3K8LA 3WXVH 4YQXH 2AK1H 2ERJB 5JNYB 5DD3H 4U05A 2EH7H 3VXRE 3BZFB 3D3VB 3K74B 4M48H 1BD2E 3ZKXC 2MOVA 1NBZB 1H3PH 2DYPB 4MCYB 4ODVL 3UAJC 4HGKC 2DKSA 2GYSA 5DJ6B 3KYNA 5DHVB 3KAAA 4ODUB 2Q87A 4M61B 3ULSB 4R26L 1V7ML 4MXVE 2VOTA 1JF5A 4OFVA 5IQ9B 2J8OA 5CD3B 3V6FB 1FNGB 2VLJB 1VERA 3FCTA 1T89C 4Y4KC 1C5BH 2NX5A 4G8EA 1T2JA 3VGEA 5IFJB 5DJAB 3KYOB 1OTSD 4PJGE 4PRPD 4Y16A 4I77H 4Z7VA 2VL5A 2YD9A 2FIRT 3G5VB 1SEBB 5EIIA 2NNAB 4LCCA 5J3HC 3GKWL 1N3NA 5KVDH 3HG1A 4XC3H 5C8JB 3SDCC 3DV4A 3DVFA 1VADB 4N5EC 4J1UB 5C09A 1U0QA 4QHKJ 1V7NL 1BIIB 2XG4A 3KPTA 5T3XD 4LMQI 3CFJA 3TO2B 4HWBL 4NZUH 5IB1B 4DFIA 3VXRA 3IFPB 5ELIA 1IAIM 4JM4H 4XP1L 1B0GB 2DWEA 1OLLA 1AGBB 1FZMA 2NX5D 3CU1A 4P2RE 4RDQF 1D5IH 2W9EL 4Y16D 1ZK9A 3U46A 1CFNA 1OQXA 2O93L 4R7NA 4N9GA 12E8H 3A6BH 3HLAA 2YC1A 2J8UB 3EYQD 5C09D 2VNCA 3EFDH 2DQEH 3SGEI 5IF0A 1OWWA 1MCKA 3L95A 3MA9L 1UH2A 2X4TB 5DD1H 4QXGH 2AKRB 4P57B 1KEMH 2CLRA 3OAUL 3TH4T 3NA4A 5TE7L 4NQCA 3KPPA 1TJHL 4HHAB 3T0DA 2HFEB 3QPQD 4MJ5A 4MD5B 1LEIA 1CFVH 2HVJA 1LHZA 3H9HA 4LHUA 3GIZL 2CIKB 3UBXG 4TRPH 3WNMA 4GW1A 1OF2A 2AXFA 1OAQH 3DX6A 3X11A 3BUTA 3ZDXF 2ZOKA 1KPUA 4R0LC 3QHFH 6CGTA 4UAOB 1N5AA 1FIEA 5JOPE 3PQYE 1HILB 4ODBD 4PY7B 3C5ZA 2EXYC 2HLFC 1PZUB 2NY3C 4R7DB 2QLVB 1XF2B 4HFUL 4YHOH 3BP6B 2GHWB 4NQCD 1U8QA 2WBJA 3S34L 3MJ6A 3PJSA 5DQJB 4M03A 5F7LB 5I8OH 5TDNB 3OKDB 4FXGA 3U36B 4RGNB 1LP9F 3MLTB 1HCFX 3ULUE 3NFSL 4LHUD 5D71H 3VRJA 1C12A 4MQ7A 3MBXH 5E6IB 4ELME 5H35B 4WEUD 1QFWM 1IGML 3EDEA 5F93C 1AGFA 4HC1L 2FRGP 2HH0L 2RFXA 4N0UB 4UV7L 1JK8B 4KKCD 3MO1B 5C2BL 1N26A 1A7BA 4G7YH 4U1JB 4U1NB 4CNIA 1YNTB 5DHXB 1FO0B 3PABA 5J11B 2CLVB 2D7MA 2JJTA 1OTTD 4FRWA 1ZT7B 4Y5VA 2WQRA 5AAWA 3T65A 1MHEB 1UXSB 1IQWH 4ZFOB 3TNNA 2WBJD 3VRIA 4YXKH 3HE6C 4OGAC 3AM8C 3G04A 1DUYB 3OZ9H 4ENEC 1BEYH 4M62H 4H8WH 1WFUA 5CEXB 3HZVB 1WZ1H 4Y4HC 3RVWD 3GSNH 1NLBL 5E8DL 4DW2L 4MXQC 3IFNL 1G7IA 1KNOB 4XXCA 4XPBL 2DQTL 5ICXB 4XXDB 4KKLC 2QJDA 2A6JB 2FR4A 4OCLC 1KCSL 3OHXB 2ZCKH 3SDAC 1D5BA 1W0YT 1RUPH 4LLYA 1AD0A 3ECBB 3D39A 5FAAA 1MOEA 4MD0A 3MRFA 4WCYH 4O4YL 4J3WA 4GRWB 1KGCE 3QWOB 1T1WB 1AO7A 4XBPB 3WHE0 1F58H 1LK3L 3VWJA 4OLXH 3QCUL 4F7TB 2R4SL 1MREH 3AB0C 5ENWB 2MFNA 1OTUC 3TO4B 1U8KA 3ULVL 4R4ND 2ZUVA 3FO0H 1MWAA 4PJEE 3WCYA 4WDIB 4LARH 5GGQL 3V5DB 5ETUB 3EYVA 3ORJA 3FFCB 3O11A 4XCNA 1IARB 1YECH 4G5ZH 5DRNA 5DA4A 4ZSOA 2P46B 2CRZA 2AJXL 3LEVL 2CXKA 5FDYA 1NGQH 3D39D 4FQ2L 9CGTA 1M1SA 4URTB 4HUXB 4L3AA 3VMNA 1SJVA 4JREB 3SKJL 4JZJA 3RPKA 5B3NA 4X7CC 1AO7D 2NY6C 1J8KA 4HKZB 2JJSA 3LS5H 3VWJD 3H0TB 1AE6L 4UT7H 3VXOA 5EU3B 1JZ2A 3LH2L 3RU8L 1EZVX 1J86A 5GGSA 4QHUA 3GMNB 3O6LL 4Q6IB 3QO0B 4HUWA 4P3CH 4LSTH 3A0OA 1KN2H 3TYFA 4U6YA 1JF1A 4H1LA 5DS8A 5LKNA 1YN7A 4QRSA 4JFEB 3DHJA 3JWDH 3NPZB 5FO8A 3KPLA 2A1WL 3VJ6B 4J3OC 3MLSL 5L7XH 5ANME 1J9CT 1RMFH 4DUVA 4OLZL 4LNRA 3LSOA 4HWUA 3VWKC 4Z95H 1QHPA 3ARPA 3BKYL 2ZPKL 4U33A 4WFEE 1Q0XL 3OKMB 4KUZL 3L5IA 4U6XA 3VI4E 1FQ9C 4KRLB 4J3XA 1MIMH 2X9YA 4OQTA 1DQQB 5D7JB 4KPHL 3BD5A 4WHYG 1AGCB 3P4OB 4KRPC 1H3XA 3BGFC 3H3KA 3HI1A 3VGAB 4G3YH 1MJ7L 5T3XL 3ARGB 1IAII 3UC0H 1KGCD 3FQTB 4F15C 4HXAH 2X4SB 2VN4A 4D2NA 1F8TH 1KLUB 3DRTB 4LEXH 2XFXA 3CMOL 5C07D 4TOYL 4Y4FC 5T1DH 1B2WL 1FVDB 4PD4K 4B7IA 4HGWB 4BSJA 1JNHA 5D1ZC 2QQLL 3F7VA 2AK4E 5FF6B 4X4YB 2F15A 4WVRA 5D2LE 4XP6H 1WC7B 4OCXL 5GRUH 5INDA 1CF8L 1MNUH 4BSVA 5MI0C 5IQ7H 1PAMA 5ESAA 4MA8H 2CPCA 1I7TB 4HIJA 3C09C 1TVHA 2UV3A 2R23B 2QSCL 3KR3H 1RIHL 2ITCA 1MCBA 3UTQB 2GTZA 1FFRA 1U6AL 1I1RA 1X5HA 2HJKA 1JPFA 1FNEA 2XY1A 4PJFA 5I8KL 4QF1A 4X0KB 3MCLL 5KG9B 4JFHE 2DIBA 4M43L 3FT2A 4RGMB 1JVKA 4J23A 1UB5A 2VAAB 1S5IH 1TPXB 1WWBX 3H9SE 2XA8H 3TBYA 2DIJA 1N59B 4JQVA 1II4E 3P9LB 4QHLB 4PJDA 1TITA 1G9ML 1W0VB 1GOHA 5ISZA 4JB9H 1TCRA 3QZWB 3TWCL 4WUUE 4JRYE 5T1KD 2AK4A 1OCWL 4E0RA 4O02H 4DKAA 1FJ1B 2NY5H 5HYFA 4MB5A 3KLAA 3NABH 4QRPB 3FKUS 3IJYB 1ZEAL 5I1IL 2MHAA 3FO1B 4BK4A 3G6AB 3ZMRA 2P8PB 1QFWI 3WD5H 4AL8L 5MEOB 5CJQL 4F37F 4LQFL 3SGJA 1JWSA 3TIEB 2B1HH 4WTZA 5GS0L 4AYFA 1CLYL 1U91B 4JY5H 1IMHC 3VFRA 4D0DB 5HYSG 4PLKD 5DHVH 4YIQB 4P2CG 1OTSC 2J3SA 5K9KA 1GPOL 1ZLUH 3RWHA 5ISZD 5DYOB 1C08A 4WU7B 4RFOL 1BF8A 2NY4B 3GHBL 2QTEA 4PJ7B 3RAJH 2NY0D 3T0VA 4DOHB 3H7BA 4HS6A 1HYSD 5EC2A 5BOPA 4NWUL 5JHLL 3RL1B 1J5OH 5KTEL 3GDBA 1D9KA 1WAAF 1JHKL 5GRVL 2EDYA 1MPAL 4NQSA 1FZJA 3MBEA 1FSKB 2DM2A 4GG6B 4WWKA 5F1IA 4PPTA 3QEQA 3UO1L 5BV7B 4JRYA 4HKBB 4IM8A 5L2KA 3STBA 1I4FA 1IGYA 3DXAA 4X6EB 1CZ8H 2NYYD 4Y5XA 2R4RH 1UXWB 5EUOA 3TBVB 5C08E 4Y16C 1T03L 1F5WA 3N85H 2PF6A 1Q9OA 4I13B 2EIZB 4LCCC 3RVUD 1G9NL 2HKHH 4RWYH 4NSKA 2G75B 1WBYB 3MLUL 3LEYH 1EFQA 2BC4A 2Q86A 3BE1H 3EYQC 1MCFA 4N8PA 4R8WL 2IG2H 1OARH 2CJUH 5HHVL 1FFNA 5MENA 2IFFL 4X8JB 1CGTA 1D9KD 1NSNH 5F1NB 2JCCA 4Z7WE 5AWNH 3BT2L 1A0QL 4GO6B 1YPZF 3KYKL 3MBED 3CXHJ 1C1EH 1CVSC 1ZLSH 4WWKD 3BIAX 4RAVA 5SV3A 3QEQD 3SPVB 5L2KD 2J5LC 3GB7B 3DXAD 5KANG 3QPQC 4P4KB 2ICEA 1BIHA 2WM0A 3VG9C 1A6ZB 5HJ3B 1ZVSA 3ULUL 1BM3H 4PLOB 1F6FB 4BH8A 4NQVB 1XCTB 1T5WB 4JG1L 5FYKH 2BCKB 4OM1H 3QDMD 1KLFA 4MNQA 1RHHA 3QXDA 3V5KA 3DRQB 3OGOE 3GMQA 1OP3H 43C9A 5MEND 4KZDL 5DRWB 1KTKE 1HSBB 1G9MC 2Z8SA 4LCYA 2JTDA 1WCQA 4KVCH 4NRXB 2BNUA 1IGJA 3E6FA 3VMPA 3GMOA 1GZQB 4APQB 3TCXA 4TTDD 5EBMB 5GGRB 3EYOA 1P7QD 5IVXE 1MWAL 2PYEA 5F44A 1DQLH 2D7PA 5DVKA 4H5SA 1LO3H 4IOSD 2HN7B 3TEUA 1QRNA 4IMLA 4ZAKA 4WNQA 1KN4H 3QULA 2OXGA 3LS4L 3ZDYE 4WV1A 1HH6A 4JZNA 4P2QB 2ADGB 4MNQD 4Y5YC 4KKCC 5CLTA 2R0ZH 1GZPB 4OKVB 4X4ZA 3MRNA 3RA7L 2XN9E 4P9HL 2SEBB 3MACH 2FB4L 3CUPA 5HGHB 2R0KL 4E41B 3UJJL 1OTTC 2OTWB 4E42B 4O00A 1G9EA 2EDQA 3I6GA 5C0EA 2GTWA 2WBJC 5HHNB 5HPMB 4JN2B 2PYED 1XZ0A 3IVKB 2ZJSH 1HDMB 4CDGC 4D0CB 3TA3A 1FRGL 4M7JH 1FO0H 2VH5H 3TBWA 1QRND 2IPKB 4ZAKD 5C70A 5DEGA 3RVWC 5JR1H 1RV6X 2NZIA 5I15H 3LKOB 4I4WB 2CDFB 1QBMH 1UZ6E 2JK5A 5GJSH 1I9EA 2FEEI 5B22A 3Q5OA 3KDMA 1IAIL 5DQ9B 4JFXA 2E9BA 1DJSA 4F9PA 2V9TA 3NGBB 1ONQB 1XF5B 2E27L 4M93B 2OCFD 4Y5VC 1RZ8B 3MQIA 4OQTL 4CW1B 4XP4L 3VE0A 3U0PA 1BQLL 4WHTA 1KXVC 3W9DA 3OTTA 4AEFA 3FOMA 3BYYA 3TPUA 2BNQB 1Y6MR 4L8BA 3NIGE 5DVNA 2XZQH 3AXLB 1QZ1A 3JWNC 4F7PA 1QVOB 4EDWL 3GI8H 2R29H 3TA3D 2CIIA 3NFNB 4M6AA 4XTRD 2ARJA 4LPWA 3HNSL 3DSNA 1P2CB 5BXFB 3C60B 1XIWB 4HZAA 3X14B 2OBGA 1DN2A 4BFIB 4EQ3A 4YX2H 2V5MA 4R4NC 3C9NB 2XWTB 4Z76A 1OD9A 4PJHA 2XPGB 4XXCC 2XQBH 3BRDA 3WYRA 2DLIA 4HZLB 2KL6A 4G42A 1CQKA 5E1AB 5TPWL 2Y72A 1GC1H 4POUB 3E8UL 1HH9B 1U8OB 3PV6B 5IV2A 1HHKA 1KCVH 2I25N 3VFSB 1YY8A 1A5FL 1XF3A 5GIRA 2ESVB 3IAGC 1NEZB 3EDFA 2CO7B 1DBJL 3VWJC 3LDBC 3BD4A 4W70A 4DKEL 1XGPA 3ELAT 1MCLA 1P1ZB 2VLMD 1OAKL 1A3RL 5HYQB 5HGDA 3OKLA 1MLBB 1EPFA 4Z6AT 4WO4A 3D25A 1IGFL 3D5OF 5F1OB 4S1SL 5FFLA 5TJWK 2NY2D 4Y1AE 1DN0A 5E94A 2EC9T 3I75B 3QXUA 4MVBD 4K8RD 1QFWL 1QSFA 5E1HB 4ZD3L 3IKCA 4OZGA 1FG9C 2C3WA 3LKSB 3QUKA 4JZJC 3LQZB 1FH5L 3L3JB 3U4AA 3B6SB 4LSVL 2HVKA 4Q9QH 5D7LE 4CN6A 5E00B 4Z5RB 2JJSC 4DN4L 4NBXB 1K4CA 3MZTA 1NFDB 3IF1B 5ICYA 1I3RB 2YA0A 3Q3GA 3ETBF 2AEIT 3Q1SL 3VA2C 4U31A 3OBAA 2B5IC 3RPIB 3SKMA 3MNWA 5TQ2L 5JO5B 2Y7QB 2YR3A 2BOCB 3BPNB 4L9DA 2V9QA 4GUPA 4WO4D 4M7LT 4Z7QF 2PYFB 3VXME 3TIDB 1A1NB 1N2RA 5KSUA 3QCVL 4X9GA 1AR1D 4BQBA 3P9WB 4P59L 1QSFD 1H15B 3F7RA 1S9XA 4DAGL 4WENB 5JDSB 3I2CL 2G5BA 4NRZA 4G8GB 5DJ0B 5HBBA 1JMZA 4LLDB 4I48A 4AQOA 1LO4L 4ONOA 1RU9L 4LSQL 4PJIA 4ZPVA 4ZNCD 3EGSA 1R6VA 2RR3A 2YKLL 5MERB 1G0DA 1OVZA 4V1DA 4UU9B 3FQRB 3JV6A 3U9UB 1PSKL 1MI5E 1X7QB 4KHXL 5C0DA 1JNNH 1IGTA 1HIMH 1FZOB 3INUL 3QFJA 4M9OA 1DVFA 5LGKA 2GITA 2A9NL 3KPRB 2AVGA 1HWHB 5EBLB 3LAFA 1MFEH 4L8DA 3WMSA 2BOBA 3DX9A 2DD8L 5DWUL 3TP4A 3QPXL 4IHOB 4W6YB 4DCQB 3OMZA 5C0GA 4L8CB 2X4QA 4IDJH 1KFAL 1FAIL 4XH2B 4DVBB 1YEJL 1OSZB 2EEDA 4N5UA 1ADQH 3KXFD 1HXYA 3K0WA 5BJTB 1QSEA 3GSNA 5GRJL 4F7CB 1RUQL 4V1DD 1BFVH 4QRTB 2VTFA 1M7IB 1QQDA 4ZDHA 1QLFB 2QKIA 2AGJH 2YWZA 1EFXB 4O5LH 3QFJD 4KHTL 5IBUB 1DVFD 1N6QH 1T5XB 4LPCA 5FXCH 1J1PH 1J0YA 2NW3B 5DZLA 3V6BR 3WFCH 1AXSA 2IANB 1V8HA 4XP9H 5FO9B 5ID1B 3MJ8B 2IBZX 4ZFGH 1KXTB 5JXEA 2FO1A 1NKRA 4Z0BH 2X10A 4GMSL 5DMIL 1K8IB 4GXVH 1LK2A 1UADC 4OLUH 2VQUA 5KVGL 3RIAF 1NGXB 4ORGA 4XMLH 2HA1A 5MP6L 4Q6YA 1MHPL 4PLKC 4PRDB 1QSED 4PRIE 3C08L 5E8OA 1FGNH 1CLOL 3MRRB 4MAUL 2DQDL 1BBDL 3Q6GL 4NM8H 2J88H 1I7RA 3CZJA 3PE9A 4LNVA 1NCBL 3BZEB 5T5NF 4K7PX 2NY0C 1HYSC 5HGGS 3B5HA 2D0FA 3DHMA 4TYUA 4M5ZH 3GSOA 1LO2H 4LSUH 5DJYA 2YPVL 2DTML 5AAMA 5EH1A 5DSCA 3NH7H 2AEQH 3WIHL 3QDJA 4RGOH 3SGJC 1RI8A 5JXED 1Y0LB 1QEWB 4PRAB 5DJXB 4NFBA 5EU5A 3JTSA 2VE6B 1FDLL 3PGFL 2NYYC 4MQXD 5J1AA 1R24B 4OD1L 5H94A 4WW2F 5GISL 3GK8L 4D9RE 1TQBC 5C7XH 5EBGA 4X7TA 3RVUC 4HIIB 5HYJD 2B39A 1CVRA 5IFHH 5DVMA 4NKIL 1IBGL 5KSBB 2VDPL 3KS0J 2CUHA 2FEEL 1E6OL 3UYOD 1QYGL 1H5BA 5BOZG 2FBJH 4FQ1L 1T66D 3WSQH 1D9KC 5IBLD 3BKML 3ZYIA 1QSZA 4BK5A 1MAJA 3MBEC 1Z9OA 3WXVL 5FUCE 5GRZA 4PJXE 4YQXL 4OAWA 3QDJD 4WWKC 4X6FA 2AK1L 2IBZY 3PWLB 2QADB 5DD3L 1EMTH 2EH7L 4P5TB 4XNYH 4M48L 2EC8A 3PG2A 1OB1B 4QOKB 5FV2A 4DVRH 2AJVH 3VRLF 1T1XA 5L8KB 4Y5XC 1F11A 1H3PL 4WI6A 3U6RA 3U2SA 3R0MA 4UOJA 4PRHE 1FVEA 1JPGB 1MRFH 1YDPB 4R3SA 1KXQE 4FTVA 3WS6A 1S9YA 4K7PY 5TE6H 3EYUH 2E7MA 4FQHB 4PJBA 4LVOB 4PREA 3U0TA 1AKJB 1JYXA 4DZBA 1BQHA 1P4BH 4NN5B 1CDHA 4PTTA 1C5BL 1OWRM 1MJUH 3C2AH 4QXWA 1IKFH 1Z0MA 1S7QA 4QTIH 5C86A 5DJ8B 2VSCA 1RUAH 3ZT7A 2XZAH 2B1AH 3VXSA 5M7QA 1YUHA 5CS7A 4JFZH 4I77L 4NN6C 2DOCA 3DX8B 4TTDC 3I6KA 5DUBA 5KVDL 5J1TC 4XC3L 2AJZA 3QIWB 4OZFB 2M1KA 4NO0A 4YDVA 4XAKD 1J8HE 2V5TA 3EJZD 3P30H 4ZNEE 5EDXA 3HR5B 4FTVD 3BEVA 3D3VE 2VB5A 2WIIA 3PP3K 5F9OH 2OI9C 4NZUL 5DEFA 5CLWA 2EYSB 4Q7DA 3IXAB 4MLSA 3WDIA 4JM4L 5F7YC 4XGZA 1I8MB 1D5IL 2YEZA 1Z2KA 1WICA 4K2UH 2Q1EA 4LKCA 1FG2A 3PIQB 4OFDA 2FBOJ 5F97E 3VXSD 1WWCA 2XTJB 1NEUA 2APWA 5IB3B 1CFSB 1KB9J 4QXUH 4MWFA 5LAXB 12E8L 3A6BL 4NO0D 4C4KT 5LVEA 2QSTA 3EFDL 2DQEL 1R3LA 3Q5TA 4YE4H 5A2FA 3MRMA 3UTSB 3EYFA 4AG4H 2YSSA 2NY1B 4RBPK 4ZAKC 1X5IA 3RRQA 3V5HA 3SDXB 4Z0XA 4WV1C 4AEHH 2CR6A 5DD1L 4QXGL 4JFQB 1ITCA 1KEML 1OAYH 4IS6B 2NZ9D 1NDMB 5I1LA 2H3NB 4I2XA 4HQQH 1W72H 3QDGA 5F88A 1CFVL 4ZNEA 1N64H 2CDEB 3UJIL 3HAEB 2CKNA 2IH1B 4TRPL 2F54B 2ED7A 2NTSP 1WIPA 1OAQL 2DYPA 2PNDA 4YNYB 4F57H 2AJSH 3TA3C 4OZIF 4NBZB 2FIKB 3QHFL 4XTRC 3ZKXB 1FNAA 2OQJA 3ULSA 4M61A 3DVGB 4HFWA 3OB8A 4F2MA 3MUZ1 4NCC1 3V6FA 1DANU 1FNGA 1DFBH 3RVTD 3EOAB 2QEJA 2VLJA 3VU2A 4YHOL 3ROLA 4U7SA 4ZS7H 3TBSB 4F9PC 5I73C 1LE5B 1NCTA 4GKOA 3FB8A 1INQB 1E6JH 5I8OL 3QDGD 3S36X 3KYOA 4XAWH 4S0TD 5JW4M 2XICA 4BELD 2P5WE 5F9DC 3D6GA 2D4FA 5D71L 3G5VA 5IVNA 1SEBA 1U8LB 2IALB 3MBXL 4HK3N 5IEKA 3QYCA 5FYKE 2KH2B 3AU1B 1PKOA 2CLZB 3HZKA 2FGWH 4J1UA 4YHNA 2DICA 4PGEB 4OD2B 4G7YL 3V2AR 1J1XH 4NO5A 4X6CF 3PDOA 2OJEB 5SWZA 2FL5B 4UQ3B 1IAKB 3WE6B 4I1NB 3SDCB 3UTTB 4X7EC 2NTFB 3S7GA 3ARQA 1ZOXA 3MGTB 2VLJD 3IFPA 1MAMH 1IQWL 2MKLC 1AGBA 4YXKL 2DMKA 4WW1B 3OZ9L 1REIA 2QHRH 2D3VA 1BEYL 3QCTH 2NY2C 4M62L 4A2LA 4H8WL 3V95A 3VFPB 4CAGA 1S9KC 3IDIB 3DOSA 2L7UA 4MVBC 4K8RC 2R8SH 1WZ1L 3GSNL 4OCWH 3JXAA 3WUWG 2J8UA 5GXBB 4N0RA 1UH3A 3H3BC 3CU7A 4RGNE 1X5YA 1D6EB 5SWZD 1XR9B 2X4TA 5KN5B 1ZGLP 3S35H 2ZCKL 5IMKB 5DHYA 1RUPL 4N0UE 5JQ6H 4TUKH 1KIPB 3W9EA 5DFVD 3RHWK 1BHGA 4WO4C 4WCYL 1WV7T 1XAUA 5EC1A 5IHBA 1DUZB 5L0QC 4XCYA 5K9JH 2NCMA 5INCB 1DBAH 1F58L 4NKQB 1AR1C 4OLXL 3ZYJA 3HZMB 1MREL 4HAFA 2X40A 4HWEH 3GMMA 1LO0H 3FO0L 4AEEA 1MEXH 1NGPH 3FB5B 5IMMB 4LARL 5FUOH 3QFDA 2FWOB 3AUVA 1YECL 1WLHA 4G5ZL 4XCCH 4ZO7A 4PY7A 3PP3H 4LCWB 1T7VA 4R7DA 4X9IA 4R0LB 3B43A 1EUTA 4WI2A 3LB6D 5K59F 5FYKD 1NGQL 2EIDA 1BFSA 2YOCA 2AI0H 5GS2H 4KV5E 2FECI 5I71C 1U9KA 4X6DA 5MEPB 4LCIH 3RFZC 3MLTA 3LS5L 5KSVB 3BVNB 5H35A 4UT7L 1SJHB 4X6BB 2CD0A 5J13C 3V7MA 3K8KA 3C87A 5I9QB 2A0LD 1JK8A 3MO1A 5IFAH 4GRWE 5EO0A 4PRBB 3S98A 5CJ5A 4P3CL 4LSTL 5F96H 4UI2A 4RBPH 1KN2L 4YHKH 3R1GH 4U1NA 1YNTA 2AS5M 1FO0A 2VZTA 1RJZA 3IFLH 5E8PA 4FQXB 4OGZA 5IHLB 3JWDL 1KC5H 3D1MC 1NMCB 1MHEA 1UXSA 1F13A 2IGFH 2P8LA 1UWXK 4J6RH 2BY0A 5L7XL 4U7MA 1RMFL 1U8JB 2AJ3A 3FFCE 1R0AH 1F3DH 1HNFA 4Z95L 1GXEA 4RGND 4XI5D 1DVFC 4RFNB 3K1KC 2IFGA 4ZUUA 5CEXA 3GMRA 4CL7A 1ZA6A 1MIML 3DO7A 3ALPA 1ZHNA 3SKNA 1UM6H 3A67H 1F4YH 5EFIA 4ODTH 4OUUA 3PHQB 1KNOA 4G3YL 2ATKB 2NXZD 3VW3H 1MLCB 1R5WB 3UC0L 1HNGA 1M71B 1X5JA 4HXAL 2G9HA 3VDCA 3K7UA 4W81A 5FEBA 3QEGH 2VDMH 1F8TL 5FYLE 3MV8A 4LEXL 3KHQA 3MRGA 1NMAH 5T1DL 3RVVD 2R2EB 2IF7A 3SDAB 4Y0GA 3QWOA 1T1WA 4P99A 5FECB 4CKVX 4JFEE 4XP6L 1A6AB 5GRUL 4HS8H 4F7TA 1VACB 1MNUL 3FQUA 1SYSB 4O51B 5IQ7L 3TO4A 4R6UA 3ULVF 4LSPH 4MA8L 1AIFA 3VFUB 5HHPA 4WDIA 4LLAA 5JXEC 5E9DA 1HI6B 5HHMB 1OOAA 2A2QT 1A9EA 3AB0B 3KR3L 4HUMB 4JFOB 5ETUA 5KS9F 4L4JA 4U3HA 3TNMB 4MQXC 5ACZA 4PRNB 5SX4H 1G6RB 4WHCA 4NN7C 3QA3A 4MXWH 3GO1H 3MV8D 4HUXA 4ZFFA 5DC0A 2AQ3A 3CDGB 4KJQD 5J57B 5D8JH 4OZHA 4FFWD 2FHCA 2GAZB 4RMUA 4LRNH 4HKZA 3ESUF 4LAQH 4P23A 3MCKB 4F58H 2H6PB 1U95A 1T66C 5IBLC 1A7OH 1S5IL 5EU3A 3V0VB 4OV6F 2XA8L 1BJ1H 3TO4D 1EHNA 2X70B 4F7MA 4TSAH 3GMNA 1YEEH 1X5FA 4Q6IA 2Y5TB 3HC0B 3QO0A 5E9DD 5T5NG 5EUKA 3QJFB 6FABH 4JB9L 3NN8B 4TQEH 4O02L 2NY5L 4K3DH 3NABL 3T0AA 3VJ6A 3VDAA 4LLWA 4ELKB 2UY7A 1IL1B 4JPKH 4UNTA 1I3GH 3WD5L 5IP4A 1RFDH 2EDLA 4P23D 5D5MA 1H5BC 2W59A 3JWDC 4YHMH 1KPVB 3VFOA 4NZRH 3OAYK 4AK1A 5TE4H 1DQQA 2B1HL 5CKAA 5JMOC 4XRCB 5D7JA 4ERSH 4PGDB 1FZKB 4JY5L 3V7AG 3P4OA 2MCG1 3PHSA 1A1OB 4X98B 1FORH 5EULV 1RJCA 4JO1H 3K8MA 5T3ZH 4KRPB 4EUPB 4GSDH 4TNVF 3OWEA 3BGFB 3RAJL 3T2PA 1C8PA 2X4SA 3EJZC 5IT2H 1J5OL 3DRTA 4M6NH 4E9LA 3WNPA 1FVDA 4F15B 2D03H 3K2UH 4YBLC 1PKQB 3MRLA 1CLCA 3T04D 1ZMYA 1PD6A 5FF6A 2WWKO 1WC7A 4P5KA 4QYOB 3VGDA 4OCSH 3VXUB 3QQ4B 4Y4FB 1BBJA 4QRPE 1XEDA 4OZFH 4PJAB 4GBXA 3F7PC 1EJ6A 1BOYA 1CZ8L 1DCLA 2R4RL 2OYPA 3MLRH 3T4AB 5A2LH 4Q9CA 3KPSB 1F6LL 2FNBA 1PX4A 1AGDB 4JVUA 2VLRA 3CAFA 5MI0B 5HDBE 3N85L 3MLVH 2HKHL 4RWYL 3STZA 3LKNA 1Z3GH 1PZ5A 4NQDB 3LEYL 4LRIA 1ADQA 1L0YA 3BE1L 2ZUSA 2IG2L 5IK3B 4KU1A 1OARL 2CJUL 1UWXH 4GAGH 1NSNL 1XT5A 1AC0A 4NBYB 4ZO9A 5AWNL 4BH7A 4X0KA 2D2OA 5FUCC 3I02B 3D18B 3PF2A 1GHFH 3GFUA 1C1EL 4WHYH 4MXVF 1ZLSL 1C5CH 4PJ7E 2P24A 2VAAA 4DOHE 2NZ9C 3EUUA 2CUMA 1E28A 5JOFB 4GBXD 4W6WB 2C3VB 2O5ZH 5CCKH 1N59A 3SE9H 4EI6A 5JA8B 1RIVH 4QHLA 1YJDH 1M6OB 2VLRD 4GW4A 1W0VA 4KDVA 4GG6E 4PJGF 1IC5H 5HHOB 4GJTB 3GSVB 4JKMA 2WBWB 1BM3L 2D0HA 1S7VB 1FJ1A 4R9HA 5FYKL 4OM1L 1WZMA 1YN6A 2YZ8A 3IJYA 1QLEH 2VUOA 3FO1A 1B88A 3G6AA 4GKNA 4O2FB 5DMGD 1NCCH 3BGMB 3WDHA 3S5LG 2IPTH 3O45A 5MEOA 4S2SB 4JM2F 4KVCL 3HAEH 4NC2B 4RIRB 5EO9A 1F4WH 4G8IA 3RVTC 1FGVH 3TIEA 4OBSA 4U1MA 2FECL 1U91A 3DETD 4QNPE 4I3RH 3WFHB 1DQLL 4KJWD 3K46A 4WEMB 1LO3L 4X7SH 2G2RB 5DYOA 3VCLB 5TH2B 1SJXA 1KN4L 3BWAA 3T3PF 4PRPB 1TXKA 1CDBA 3RL1A 2VWEE 1FLTX 2R0ZL 3UTZA 3REWA 4RA0C 3MACL 5HY9B 3IXTA 1MCDA 5BS0E 1B9ZA 5D6DA 4Z18A 5CP3H 4NHUB 4K94C 4PG2A 3W5MA 5F7MC 3KYNB 2MMXA 1JZ8A 2V2TA 3NCBB 4HKBA 1KB5B 2A77H 5DJCA 3UEZA 4LAJH 3BPCA 4NC1C 4HLZG 5IB4A 1WIUA 3LPFA 4U6VH 2ZJSL 1JTPA 3IJSA 3IRPX 3TBVA 5CGMA 4D8PB 4M7JL 4HGMA 1FO0L 2VH5L 4U1KB 4IRZH 2EIZA 4RAHA 4ZODA 1WBYA 5JR1L 1A6VH 2EDNA 5I15L 4ZFOL 1QBML 2XACC 5GJSL 4NKOA 3ZHKA 2VL5B 1Q9LB 2AAVA 4LCCB 4RMQA 5F1NA 3VFTB 3KWWB 4OF5A 3NPSC 5E6YA 1B90A 4GAYB 1SJEB 2ZUYA 3DV4B 3K80A 4L3EE 5C09B 4WRLA 3RY5A 4EVNA 1PDKA 2QV2A 2VLKB 4CADA 4P2QE 2VJXA 3OAYH 5BO1H 2Q3ZA 2UWEA 4JFDA 3RTQA 1CXEA 1LQSR 3GB7A 3CFJB 5C0CB 5DFVC 1YYLH 3VXQB 3B9KD 3MFGB 3OSKA 3DYPA 3LMJH 1KSRA 5GPRA 2XZQL 4LCUB 5HJ3A 3GI8L 2R29L 4RQQB 4E41E 1FZMB 2J5LB 1JWUB 3ULUF 1RZJH 5GJTH 4MSWB 5IGXH 4JZOB 4YX2L 3VG9B 1I1CA 4ELMF 5L6YH 3DRQA 3IDNA 3U46B 3P73B 2GCYA 2VDOH 4KUCF 2XQBL 2J4WH 5BCAA 5GSRA 2Z31D 3L3DA 4NRXA 1GC1L 4OIAA 3LB6C 1GZQA 2CKBB 3RKPA 3RTQD 4JFDD 4JJ5A 5EBMA 2G60H 5GGRA 2KKQA 2DJUA 1KCVL 2VZSA 4C56E 1ZHKB 3FQXA 4CBPA 4NQCB 4FMKA 1OGAE 3FO9A 3KPPB 3P0VH 5DGRA 2IPUK 2AV7A 1CLZH 2NPLX 2FJGB 5FYJD 1LEIB 1IC1A 1CDGA 2WIMA 4P2QA 2BNQE 1QFHA 2A0LC 4LHUB 1GZPA 3O2VH 1OF2B 5HGHA 3M1BA 4LLMB 3DX6B 4ZUTB 5IIEA 4P46D 4Y5YB 3BISA 2ZOKB 1KPUB 4X9FA 2OTWA 5CZKA 1U3JA 3MRPB 1OP9A 4UIMB 5HHNA 4DQOH 2IJ0C 4K3EH 4LVEA 3CMGA 1A1MB 1UC6A 3IVKA 4RGNC 4XI5C 1W72A 3EAKA 4OI9A 4Q9QL 1U8QB 2WBJB 3U83A 3PJSB 4H0IA 2IPKA 4YUEH 1JPSH 2FYYB 1SQ2N 3SE3A 1XGUA 1L0XA 4ODWB 4FXGB 3GSWB 1P7KB 3LKOA 5SX5K 4PJCA 4RAUA 4PJEF 1CTOA 1LD9B 2ESVE 1S7XB 5GHWH 4ZYKA 2NXZC 1AGFB 2BNRA 2DL9A 3EHBD 3RDTA 1XF5A 4NZDA 5J11C 1RZ8A 5LGJB 3U30C 4CNIB 2IH3B 4K23H 2BNQA 3S3JA 2DQFB 2J8HA 3RVVC 3P4NA 4Y5VB 5HHQA 3PHOA 1HWGB 3AXLA 3T65B 1QVOA 2CK2A 3BQUA 1ZT4B 1U3ZA 3VRIB 1U8HA 2GSGB 5GGVY 1P2CA 5BXFA 3C60A 1XIWA 3G04B 3X14A 3MYJA 3WEXA 3C9NA 4U1LA 4HZLA 3IU4H 4TVPH 2BNRD 4Z7UF 1YEHH 3RDTD 3VD4A 3NMEA 5IW6B 5E1AA 1N0LA 1JNNL 1HIML 4MX7B 4KI5D 1NFDE 2F5AH 2BDNH 2PCPB 1U8OA 1MFEL 3PV6A 2YZ1A 2BNQD 4KJQC 3VFSA 5I76B 3TFKD 4FFWC 4WTWA 2X1QA 2PW2A 4EJ1C 5KZCB 1XGYH 3D39B 1NEZA 1G7MA 3BQUD 4IDJL 4U0RB 1PLGH 1BZ7B 4MD0B 3VFGH 3C60D 1XIWD 1GC1C 4JG0H 1VESA 1G6RH 5ESQB 3VI4F 4X5WB 1XF4B 1ADQL 3TO4C 1IE5A 1AO7B 1P1ZA 1H8OA 2FJHB 1MAKA 4ZO6A 4S10A 3RVXD 1IJ9A 2EYTB 3R0NA 5HYQA 2VXVH 3LDBB 4UILH 4G8GE 1BFVL 4KTEH 1U8KB 5C0AA 2AGJL 3GBNH 2DAVA 1C7SA 3WNKA 3ZKSD 4BZ1H 4O5LL 1AH1A 2Y06H 1N6QL 4LP4A 1U42A 3OKKA 3EYVB 3B9AA 3JWOH 3SJVD 3G6JE 3OX8A 3I75A 3T3ME 1J1PL 3VFWA 3BSZH 3WFCL 1HXMB 4JREC 4HD9A 3LQZA 4XP9L 3J8F7 3UZEA 1C5DB 4P23C 5HYIA 4ZFGL 4Z5RA 4Z0BL 1GOGA 4GXVL 1KTLB 4OGYH 3KPRE 1RY7B 4OLUL 5D2LF 5M94B 3JBG7 1SEQH 4XMLL 3RL2B 3IF1A 2ZWLT 3T77A 1FGNL 5JORB 2M26A 4NM8L 2J88L 2VKXA 5C0AD 2BOCA 4K07A 3ZHLA 3A6CH 4OLEA 1H9VA 2VXUH 2PYFA 5GGSB 4QHUB 1MCWM 4NOBA 3TIDA 1A1NA 2B5IB 4GRMA 4HUWB 1FE8H 1QPXA 5I1AB 3TYFB 4CVXA 4U6YB 1NC4A 2HRLA 4H1LB 5DS8B 2BSED 4M5ZL 3FMGH 5DDHA 1LO2L 4LSUL 4Y8DC 4LKXA 1R5IB 5EN2A 3TH3T 5FO8B 3KPLB 5EIQA 3TYGH 3HFMH 3NH7L 2AEQL 3NCJH 4LPVA 4RGOL 4XMKH 5MHSD 4CU6A 4IOFD 4PGCB 5C07B 2H9GB 2Y36H 4EUPH 4LVNC 3WUWB 1NQBA 4LNRB 1W2KT 4F37K 4ZXBB 2IANE 3S37H 5MERA 4TULH 4XBEH 2F58H 3FQRA 3U1SH 3U9UA 5C7XL 3TF7C 1HZHH 1X7QA 2L4OA 5IFHL 1YY9D 1JHLH 2ZG1A 5F7DB 1FZOA 3HI1B 4JY6B 4WJ5B 4OIIH 1ZANH 3JV4B 4M7KH 3WXWH 2FBJL 1FYTA 5EBLA 5EU7E 1NC4D 3WSQL 3TESA 4QRRA 5BRZE 5FM4A 1HINH 4WI4A 4DCQA 5KAQF 2GEEA 3MRCB 3UBXA 2ARJQ 1B4RA 1AQDB 2DQCH 4XH2A 1FIGH 2XFXB 4DVBA 1EMTL 3TT3H 1JNHB 4XNYL 1JI1A 1SY6A 3F7VB 4GBXC 4BFGA 4DVRL 2AJVL 1XGRB 5SX5H 4F7CA 5J9PB 4X99A 2MCPH 1TZIA 1K3ZA 3IT8D 1SM3H 4NOFA 5INDB 4BSVB 5CBAB 2WWMD 1M7IA 1MRFL 3GZKA 3IDXH 2BXZA 2EDTA 5ESAB 3EOYG 4HIJB 3UBXI 5B39B 4LRIC 5TE6L 3EYUL 4JPWH 3AMKA 1T5XA 3BIKA 1F4XH 1FYTD 2ITCB 1P4BL 5CZVH 1HCVA 2NW3A 4JLRA 3I9GH 4M6MH 5T1KB 2ORBH 4QRRD 3VXTA 1MJUL 4U2ZA 1UM4H 3C2AL 1IKFL 1N6UA 2HJKB 4QTIL 3VG0H 1JPFB 1FNEB 5ID1A 1WT5A 1RUAL 2XZAL 5CWSB 2B1AL 5KSBE 1HHIB 2IAMA 1K8IA 4JFZL 4ZOCA 4QF1B 1TPXC 2JB5H 1NGXA 3DETC 5DUPH 3O6MH 3TJEH 4PRDA 1V3KA 3FT2B 1R3JB 5CMAB 3IETB 5I16A 1UB5B 4KJWC 2CDGB 1JGVH 1EBAA 3P30L 3GHEH 5L2JB 2BJMH 3TBYB 2WUBH 1T7ZA 2OR9H 2AV1B 3QUMB 3GSUA 2YRPA 1S7UA 5F9OL 3SOBH 3UX9B 2J7LA 1OT1A 5ISZB 5SV4A 1TCRB 2HT3D 4HAGA 5IMOB 4M3KB 4E0RB 5A1AA 2NY0B 4YBHA 4GS7B 4Z7WF 4K2UL 2LU4A 4Y8AA 4WI8A 4HDIA 1Y0LA 1QEWA 5DJXA 4XT1C 3TJHD 2IAMD 2ZUXA 1HKFA 1G7LB 2VE6A 2OR7A 4DGYH 1RK1B 5DC9B 1R24A 4QXUL 4HMCA 5SX4I 2XNAB 2HMID 2W9LA 3BHBA 4YE4L 1K85A 4AG4L 3SKUD 4YK4C 5CGYD 5KSBA 3IGAB 4AEHL 2UZIH 1KB5H 1OAYL 5F7FA 1C08B 5IOPB 2YN5A 2NY7L 1FCGA 4YAQA 1ROWA 4G6FD 4HQQL 3H7BB 5D6DC 1W72L 4PG2C 1T7YA 3EO0B 3V4VH 2DWDA 5DEZA 3DROB 3T0XA 4QRQA 3PWLA 1D9KB 1N64L 2YD6A 3UJTH 4P5TA 4NQSB 4X4XB 4YHYC 3MV7A 1KBGH 2KDGA 4QOKA 2YK1H 3KPQA 2ZG2A 2ZKHH 1F45A 4F57L 4KXZH 5F1IB 5IVXF 4I3SH 5HPOA 3O0RH 3QG7H 2AJSL 4HMDA 5L2KB 1JPGA 3DXAB 2EDBA 2XTJE 4Y5XB 3QEHA 1KIRA 1EAPA 3JZ7A 2V2XB 4N1CA 4FQHA 2N7BA 1YMMA 4KKNA 1DFBL 1WTLA 5D7IA 1TTFA 4F7EB 4ZS7L 4JKKA 3WL9B 4ISVB 4Z77A 1CE1H 2VN7A 3UTSE 3QDMB 3SN6N 2Q86B 1E6JL 2W38A 4XAWL 5EA0H 3SDXE 1FFNB 5MENB 4IRSA 2QADD 4YLQT 1GGBH 2JCCB 1OW0A 1KJMA 4P5TD 2VR5A 3RTQC 3DX8A 4YJZL 3MV7D 4QOKD 4GQ9H 4HBCH 2JJWA 3ROOB 3QIWA 4LFHG 2R9HD 4RAVB 3QR2A 4U1SB 4LEOB 2FGWL 4NN6B 4N8VG 4BFBD 1P7QB 1J1XL 2E6JA 1HHHB 3MROB 3HR5A 3ARVA 2ICEB 3WIFA 1U93A 2CKBH 5T3ZD 1BMGA 1YMMD 1ZVSB 2R1YA 3SKOB 1MAML 2EC9U 3C6LD 1UZ6F 4PLJD 3FL7A 2V7NA 2OI9B 4MNQB 4DZ8B 2QHRL 3GMQB 43C9B 4IRSD 3QCTL 1YEKH 5DK2B 3BZ4A 1OP5K 2GJZB 3K4AA 3RUGE 5IB3A 4OI8A 4LCYB 2R8SL 2ZSWA 3O8XB 3GSQB 3QIWD 1O5DT 1IGJB 4OCWL 5LAXA 3GMOB 4L8SC 2E7HA 5ADOH 3NIGF 5CKGA 2KBGA 1WZLA 4YFLF 3UTSA 4PY8J 5ICZA 2PYEB 5AZ2H 4MZ2A 1YC7A 2ZCLH 4BQ9A 3S35L 4H5SB 1OAXH 5JQ6L 1UT9A 4TUKL 4ZAKB 1NDMA 4WNQB 1Z9SA 2H3NA 3DYOA 4WV1B 1UKSA 4JZNB 1I85A 3EHBC 4FP8H 5K9JL 3MRNB 2CDEA 5DR5H 1DBAL 3HAEA 3CUPB 2IH1A 2OSLA 2F54A 4HWEL 4YNYA 3LIZH 4G9FA 1WWWX 1LO0L 4WI5A 5D7SH 1MEXL 3I6GB 1NGPL 2GTWB 1ZLVK 5FUOL 3UTSD 5EORH 2VDLH 2WQ8A 2NY1D 3DVGA 2L0DA 3SE3C 3SO3C 4XCCL 4Z7NE 1JZ5A 4KMQA 4OFIA 3NAAH 1XGTB 3EOAA 3QXVA 4RRPG 3IDJB 2AI0L 3RWGB 1E4WH 5DVOA 3TBSA 4CN4A 1NUFA 2YD7A 3RDTC 1PG7W 3RIFK 2YPKB 2JK5B 1UA6H 1A3QA 3AS3A 4PJ5B 4LCIL 3ARDD 5CP3A 3KDMB 4KI5C 4UB0H 2JELH 1DQJB 4JFXB 4AH2A 4P3DB 2AJUH 2F19H 2F54D 1DLFH 4PIRF 4G9FD 3TFKC 2P4AB 4MMZC 3VFNA 4CU7A 1LO5B 3BQUC 5IFAL 3W9DB 4PGEA 3FOMB 5F96L 3C60C 1XIWC 3QI9A 4L8BB 2OJEA 4HULB 1A21A 3R1GL 4OIBA 4YHKL 3V8CA 2FL5A 3UTTA 2XV6B 3KLSA 4F7PB 2NTFA 3IFLL 3SCMA 1VGEH 3MV9E 2EE2A 4PV8B 2IBGA 3RVXC 1ZS8A 2ARJB 2PO6A 1KC5L 4N1HB 2IGFL 5I1DA 4PS4H 4YDKH 1WBZA 1P6FA 4J6RL 4ZUVB 1UEMA 1JWMB 2YPLE 3L5JA 1R0AL 4LDEB 4LCWE 3IDIA 4G42B 1FL5B 3DUSB 3CPLB 5GZND 2ILLA 1X5XA 1UM6L 3A67L 3G5YB 1F4YL 3ZTJG 2X42A 4ODTL 2APTA 3QI9D 3VW3L 1XR9A 4DUWA 1YY8B 1S78D 1PG7H 1XF3B 2FEDD 3H2WA 3UTTD 3GRWH 3SCMD 5KN5A 5IMKA 1NCUA 3UTPD 5DD5H 2PO6D 4ZPTB 3VDBA 4FZ8H 1NGYA 3QEGL 2VDML 3MOQA 2MQCA 1S9WB 1KIPA 1XGPB 1NMAL 5IMLA 1K2DA 2R1XA 4P49A 4XCEB 3GIVB 3UP1A 4PGJA 5J12B 5INCA 5EWIH 3MR9B 4GKSB 4HS8L 3U4EA 3HZMA 4GOSA 3D25B 2RBLA 5L0QB 3O4LA 3CFCH 5DT1H 4LSPL 4EZMA 3EW3B 3RNQA 5IJKA 5FDWB 3FB5A 3WO3B 4IOFC 1QSFB 3IKCB 4OZGB 4LASH 3QUKB 1NPUA 4QEGA 4P2OB 2ED9A 3DUHA 4LCWA 2VUYA 4JGUA 5FK9A 3LCYA 2HVKB 3TT1H 5D96B 5IHZA 3AFLA 4MXWL 4FQIH 3GO1L 4MJIE 5GRXG 3CCHA 1CE6A 1XF1A 1CD0A 1IEBA 2VDQH 5D8JL 2WBKA 1YY9C 4P2YA 4PD4J 3C5SB 3QUZB 4LRNL 5ITBH 3SKMB 4LAQL 3FN0H 3MNWB 1WSST 5E2VH 4F58L 2OTUA 2A74B 5DD0H 1A7OL 1SJHA 1CN4A 5I75C 1V3LA 1JF6A 5C0RH 2QHLA 3O4LD 1N2RB 5KSUB 4TSAL 1YEEL 5C0BA 2X6MA 2EDOA 4C58B 1M05B 2V17H 6FABL 1D3CA 4NFCA 1IFHH 2G5BB 4TQEL 1RZKH 4FQXA 5KANI 4K3DL 2DRUA 4PTUB 5FO7A 3WO4B 2WWMC 2JJVA 4PJIB 4ZPVB 3KXFB 1PVHA 3CH1A 5E95B 4M00A 3KG5A 4XC1H 1U8JA 4JPKL 5HHME 3P2TA 1CR9H 1I3GL 3MUHL 1RFDL 5H2BB 4V1DB 1FL6A 1B3JA 3UPAA 1JPST 4YHML 4L4VA 4PGBA 4NZRL 3WBDA 1NCDH 5TE4L 5C0DB 1IGTB 4ERSL 5E08H 4JFFB 1DVFB 1N0XH 3MNZA 2GITB 2UVEA 1ZLVH 1RSFA 3FONA 5EU4A 5FUZH 5C0BD 1FORL 3DX9B 1HQ4A 1T1ZB 4JO1L 1MLCA 1R5WA 3LVEA 1RULH 5T3ZL 3WUZA 5C0GB 4HJGA 5AYQA 2X4QB 1JUFA 1M71A 4GSDL 4FQXD 3CVHB 4IRJB 5IT2L 1CIUA 3WN5A 4M6NL 4FQQA 3S3PA 3U48A 2D03L 3K2UL 1A8JH 2R2EA 3E6HB 5J89A 1UWGH 5FECA 1NC2B 1AC6A 3EO1B 3UYRH 1P9MA 3OAZK 4OCSL 4ZDHB 2HT3C 3WDJA 4L4VD 1VACA 1U3HB 4DKDC 4O51A 4R4FH 3WIIH 5JW4R 2CRIA 3VFUA 3MLRL 1V5JA 3FO2B 4OJFH 4RX4A 5JIKA 4KH2A 1RK0B 2DJSA 1NBQA 1HI6A 3CZFB 2E7CA 2IAMC 3AAZB 5F21B 4LDOB 4JFOA 4PJXF 3TJHC 3QUMH 4KQ4H 3MLVL 1AXSB 4TUOB 3TNMA 2BY3A 4XPTH 1Z3GL 1MCEA 1G6RA 2KZ1B 2HAZA 1LP9A 3EKCA 1DQDH 2P5EA 2HMIC 5LQBH 4GAGL 4ODXA 2XKNB 2OS7A 5C3TA 3G9AB 1T21A 5CGYC 1GHFL 2GAZA 4ODHH 4W4OA 4B50A 4TVPD 1JCKA 1ZXQA 1C5CL 1FAKT 2VABA 2H6PA 3QEUB 1KJ3H 5HYJB 3G08B 5C0JB 4KK8D 2DQJH 2O5ZL 5CCKL 2X70A 4RX4D 3SE9L 3BN9C 1RIVL 3HC0A 3RWJA 3UDWA 1PKQE 1YJDL 3QJFA 3FTGB 5B8CA 1F6AA 1IC5L 4POYA 3NN8A 4ZG1A 4PJAE 3DGGB 2YD3A 4NFDA 3RKDC 3VD9A 5EU5B 1TDQA 1TVBA 1QLEL 2P5ED 4ELKA 2D0GA 3TC9A 1BGXH 1KLGA 2AQ1A 2F53D 1NCCL 5H94B 3VH8G 4ETQA 5HDLA 1J0JA 1IILE 2RIKA 1QBAA 5D70H 1F4WL 2RB8A 35C8H 4NQDE 1FGVL 2PTTB 1KPVA 3IS1X 1FZKA 4PGDA 4JO4H 4F33A 4YH6A 1BJMA 4I3RL 2OZ4H 3ILQD 4LIQH 7CGTA 2E9WA 1H5BB 5KW9H 4FOMA 2QADC 4ESKA 4X7SL 1EO5A 4P5TC 4ZO8A 4WGVB 3CFKB 5EU6A 2R9HC 2EICA 4OAWB 1X9QA 3OKNA 2Y25A 3S4SB 2RAMA 1F11B 2FX9H 4WI3A 5HHOE 3QUYA 5I1GH 4PR5B 3OR7A 4BM7A 2YRLA 4P9MH 1FVEB 3VXUA 3QQ4A 2ZSVB 4X7FC 4R3SB 4NN5C 4FTVB 4PLJC 2A77L 1B0RB 1FN4B 1S9YB 4KRNA 3T4AA 3KPSA 4PJBB 4U6VL 1AGDA 4OCRH 4IRSC 4L4TA 5H37H 1OW0C 2LVCA 4IRZL 4JQXA 1GVIA 4YC2B 1S7QB 4MNGB 4PGZA 3QIWC 5EU6D 1A6VL 1KJVB 1NDGB 1YUHB 2BSTA 4KGLA 1KF9B 3UXFA 1CS6A 5IK3A 4O9HH 3I6KB 1D5XB 2AJZB 2CK0H 3I02A 4J8RB 1EO8H 2RJMA 3CX5J 3QUYD 5KVMC 1JZ4A 1CGWA 2OMNA 5D72H 4PRPE 2R69H 2EYRA 3VXUD 1DEDA 5BO1L 3ISWA 5FYKU 1U3YA 2DF3A 1YYLL 5BVPH 5IKCB 1NH6A 3KPSD 4XVUD 3L9RB 3LMJL 1JV5B 4PB0H 3DECA 4L4TD 1M6OA 1QFUH 4CN1A 4LSDA 2J12B 1VGKB 2YEZB 1RZJL 5GJTL 5IGXL 1MCSA 3WFZA 5T3XE 2K9UA 1S7VA 3QWQB 2PKDA 1A2YA 1U8MA 5JW3H 4QRUB 5L6YL 1VDGA 2VDOL 5D1QD 4O2FA 1OD7A 2J4WL 3Q5YA 1YJDC 3CDCA 2NY1C 2NX5E 4MWFB 5IJVB 1FL3A 1A7RH 4S2SA 4LMQE 5JW4Q 1C7TA 4RIRA 3HB3D 1T0PB 3OAZH 3FB7A 3V5HB 4Z7VE 1F3JB 1CT8B 1CXLA 2G60L 1HKLH 3ZO0A 4HMEA 1I85C 1EEYB 1YNLH 1VFAB 3ARDC 1JP5A 5F7NC 3FOLB 5C09E 1DDHA 4OF6A 3P0VL 2E8YA 4U0QB 4I2XB 2G2RA 1CLZL 3VCLA 3NIDE 5F88B 2H1PH 1UENA 1WCBA 4PRPA 4DKFH 1U8IB 2BVEA 4OF7A 1V3MA 1YNKH 1G7HB 5C6TH 3B3IA 4J4PA 3MXWH 2GQHA 3O2VL 5HY9A 5FB8A 3WHXB 4HIXH 2XA3A 4NHUA 3MRDA 1BPVA 1BVLA 1IEAA 1RD6A 5SWQB 2H2PD 5I19H 1T0NB 5F1SA 2OQJB 2VISB 4HFWB 1KB5A 4DQOL 4F2MB 4K3EL 1QKZH 3U7WH 4D94A 2VZOA 3PXHA 1BD2B 1T0MA 3ROLB 4D8PA 1MY7A 1N8ZB 4U1KA 1JHTB 4YUEL 3FB8B 1JPSL 5IBTH 2D31A 5GZNC 5LBSH 5DD6B 4IOIB 1Q9LA 5IEKB 4J4PD 3MREB 3V0WH 3VFTA 3KWWA 4NQCE 3QI9C 5GHWL 5TF1H 4GAYA 4F3FB 1SJEA 2FEDC 3HZKB 3SCMC 4YHNB 3GSRB 2VLKA 3LRSA 4Y19D 2PO6C 3IJHB 4M4PA 4NO5B 3PDOB 3BRGC 3NPSB 5SWZB 3BW9B 4HKXB 2YUWA 4K23L 4MQSB 4NUJB 5C0CA 1A6WH 3VXQA 4C59B 4NP4H 3T2NH 4KV5F 1T6WA 4K8RH 3EJJX 3IDMA 4LCUA 4RQQA 4KXZI 4U7KA 4N9OB 4M6OH 1JWUA 1YEIH 3OKYA 1JN6A 5FM5O 4MSWA 4MA1B 5DI8A 4JZOA 3AC0A 3H3PH 1GRWA 3UCRA 2XQYK 3I50H 5EB9A 4XWOD 4LF3B 3P73A 5IW3A 4CVUA 5K9QG 4GRWF 3IU4L 4TVPL 1YEHL 4NO2A 3RY4A 4JDVB 1RZJC 2VLKD 1ERNA 2F5AL 1WGOA 4KK6D 2CKBA 2BDNL 4UV4H 5C0CD 3QXAB 2WSKA 4MD4A 4DGIH 5JHDD 2YD1A 5DHYB 1ZHKA 1XGYL 1FNLA 2LTQB 1PLGL 5HDQH 3W9EB 3VFGL 4FQLH 1WAAA 4JG0L 2FJGA 5DURB 5EC1B 1G6RL 1QBLH 1T2QH 1WWAX 3RWDB 3RI5K 4XCYB 1PW3A 4KKBD 3V8OA 2XOTA 5IJKC 3SE8H 1HHJA 2VXVL 3MRBA 2W60B 4UILL 2J6EH 5FM5M 4KTEL 4LLMA 4GFTB 3LD8B 4CMHC 1P4IH 1L0QA 3GBNL 3GMMB 4ZUTA 5HI4D 2H2SD 4Y5YA 3WFDH 3X3FH 3KVQA 1UJ3B 2ZZUT 4BZ1L 2YUXA 4HBQA 4Q97A 2Y06L 3QFDB 3QBTB 3MRPA 1J10A 3JWOL 4UIMA 1GSMA 5J6HB 4WY7H 3BSZL 2IBBA 1A1MA 4K7FB 3MTRA 1PGRB 4WFFD 1P4LA 2A6IB 1OT2A 3M8OH 1BVKA 2JLLA 15C8H 1MH5B 1QA9A 4OGYL 2FYYA 1YPZA 4X6DB 1DQMH 1SEQL 4ODWA 3GSWA 1P7KA 5I17A 1ZHBA 4NPYA 5I9QC 3QNYA 4YZFF 2VIRB 3D39E 4UINH 1LD9A 2EKSA 1HSAB 1S7XA 2OLDA 1D6VH 3A6CL 2VXUL 4FQXC 4LPTA 5EO0B 4H26A 5LGJA 5B38G 1AO7E 1NMCC 1FE8L 2NXZB 3MLZH 1I1AB 2IH3A 3FMGL 5FGRA 1RJZB 4XNZB 3UYPA 2DQFA 5E8PB 4LL9A 3F8UB 4NJ9H 3BMVA 4ELMB 1MRDH 3TYGL 1AY1H 3HFML 3NCJL 5E2UL 2P8LB 3DMMA 1KG0A 1ZT4A 4RFNC 5E4EC 3U30B 2EEBA 4XMKL 2GSGA 3X12B 2Y36L 4ZOBA 2AJ3B 3T09A 3DVNB 4CVZB 3CVHH 3QP3A 1CBVH 3DJ9A 4OZ4A 3RX5A 4ZUUB 4ZSOE 5F7WC 1CICA 1RZGB 3GMRB 3S37L 1ZA6B 4TULL 3OXSB 4XBEL 4GMTH 2F58L 3U1SL 3DO7B 4DGVH 2NXYD 1HZHL 1ZHNB 3SKNB 1BF2A 3AVEA 1IQDA 5IW6A 5AYUH 3P4MA 1JHLL 5EFIB 2Z8WC 2MNUA 4ZMAT 1YZZA 4OUUB 4MX7A 3FFDB 4OIIL 3B8YA 1ND0A 1ZANL 4E5XB 4M7KL 3PWUA 3WXWL 3KS0H 1AFVH 3WN5C 2PCPA 1NUGA 1EJOH 4OQ1A 3D69A 3V6OA 4YPGA 5I76A 3O3UN 1HINL 2G9HB 4JO3H 4MAYA 4OSUH 2N4IA 1R3KA 4W6XB 1G7JA 2DQCL 3DMMD 3MV8B 1BZ7A 5EPMA 1IGIH 1P9MC 1FIGL 3MRGB 3TT3L 1UZ8B 3TLRA 4UTBH 4HH9B 5ESQA 1CXKA 4DWHA 4X5WA 1XF4A 4KK8C 4L1DA 5F89B 4PLNC 2FJHA 1BP3B 3BEWB 1N5YH 3LKPA 2EYTA 1CICD 2MCPL 1SM3L 3U7AA 3FQUB 3IDXL 1S7WA 3MYZA 2WZPD 2WMPA 5C2UB 5C07E 2PW1A 1AIFB 3IFOA 5HHPB 4WEBH 5E9DB 4MS8D 1ULVA 4JPWL 1A9EB 3GRWA 4K3GA 4MNHB 1ZLUK 1F4XL 1Q38A 5CILH 3QH3A 5DFWH 5CZVL 1G1YA 3I9GL 1HXMA 2QR0A 3NACH 4G6KH 2ORBL 4M6ML 5ACZB 1UM4L 3QIBA 4W4OC 3RWIB 4MAYD 2DM7A 3QA3B 5KZCD 3VG0L 1NGZA 2A6DA 3B5TA 1C5DA 4JHWH 4ZFFB 2ADIB 1KTLA 1KJ2H 4OZHB 3NIFE 2JB5L 4ONFH 3JWOC 5HVWA 5IEHB 5DUPL 3RL2A 3RZWA 3O6ML 3TJEL 3ILQC 4P23B 2PTVA 3HNTH 4M1CD 4PG9B 3V4UH 1JGVL 1U95B 3UDWC 5JORA 5FCUH 1QHOA 3GHEL 3OJVC 4PJ9A 2BJML 5B8CC 2WUBL 1GAFH 2X9WA 5HDBF 2OR9L 2YMXH 1JE6A 1OPGH 4LHQB 3HRZB 4Y7MA 4F7MB 1CFTB 1NUNB 5CJOH 3SOBL 2EXWD 1RVFH 5EUKB 5I1AA 7FABH 3JTTA 4KTDH 1SBBA 1ITBB 1R5IA 3QIBD 4OB5H 3V0AC 3RP1A 2VZVA 5HYEA 4LLWB 1SMOA 4PGCA 5C07A 2H9GA 5TDOA 2OMBA 5D1XA 5EIVA 3MRQB 3WUWA 4PJ7F 4M7ZC 5B3JE 3B5GA 1O7VA 4DGYL 4Z7UB 2BFVH 4ZXBA 5D5MB 1P5UA 3VFOB 1NLDH 4LVNB 1MVUA 1EAJA 1YQ2A 4PJFE 4PJ9D 1UCBH 4NNXA 3BGAA 4GG6F 5F7DA 3DURB 2JB6B 4JY6A 4WJ5A 3BDYH 2UZIL 3JV4A 3KJ4B 1KB5L 3OG4B 3CNKA 5B21A 3CFBB 3DBXA 3DSFH 1SBSH 2MQ3A 2IQAB 1U8NA 3QUYC 3MRCA 3V4VL 4NYLA 1AQDA 1OP3K 4G6JH 5D1XD 4JR9H 3UJTL 4PJDE 5ISZE 1KBGL 5A2JH 1Z9MA 3MRLB 2WLYA 2YK1L 1HN1A 1XFPA 1XGRA 3P4LA 4ZXBD 4XVUC 2ZKHL 3SE4A 5J9PA 4P5KB 4I3SL 3EJYC 3O0RL 1BBJB 3QG7L 5CBAA 4GBXB 4JQXC 3KNBA 3BPOC 1EZVY 3CXDH 5B39A 4NUGH 2AEWA 2Y5EA 4O2CA 2VLRB 3BUYA 4WI7A 3SQBA 2OK0H 4G7VH 3STZB 5T1KA 3LKNB 5D2LB 1PZ5B 3PGDB 1CE1L 3NCEB 2LAAA 4XVSH 4JKPH 3D2UA 3IDYC 5CWSA 5EA0L 3PGCB 3HB3C 5A3ID 1F3DJ 2RCSH 3IB4A 1HHIA 1GGBL 4BH7B 5AD0A 1UVQA 1A3LH 3GKZA 2JKXA 4GQ9L 4HBCL 1UKQA 4HCRH 5CMAA 1R3JA 2E7BA 3IETA 4JRXA 2P24B 4JDTH 2CDGA 1PY9A 4NGHH 3VFVA 1E28B 2B8OT 5L2JA 2DQHH 2W1NA 2AV1A 1MCRA 1IZKA 1KCLA 3QUMA 4PFEA 4EI6B 3U0WH 2CKBL 4RSVA 2EDEA 4GW4B 1AQKH 5D9SB 2EZ0D 4J3UA 3RBGA 1IC7H 5IMOA 3QEQE 1NANH 1Q1JH 4LIQE 5L2KE 3DXAE 1YN6B 1FYHB 3F7YB 1U41A 3D2UD 3H9SB 2H2PC 4YDJB 1FPTH 2EO9A 4JKWA 4GKNB 5EUOE 1YEKL 1G7LA 3O45B 2ATPA 4X4MA 1RK1A 5H8DA 4EI5A 5EO9B 3W11D 4JRXD 4G8IB 3QDME 2LFGA 2XNAA 4XPGH 5ADOL 5CEZH 1QRKA 3W0WA 4U1MB 5MENE 2XYCA 5E03A 1ED3B 2JCCE 5AZ2L 2QQQA 3IGAA 2ZCLL 3L3GA 3LOWA 3ZDZE 1L7TH 2HTLD 4N0YH 1OAXL 5A40E 4J4PC 4K94H 5L9DH 4HH8A 5FOBA 1G6VK 4YK4B 1TZGH 5IOPA 3BWAB 3FHAA 1T4KA 3BRFA 2ZUQC 3EO0A 4FP8L 2Q8BH 3DROA 3KYAA 4MYWB 4D0BA 3UTZB 3REWB 5DR5L 5JMRA 3IXTB 1UM5H 4X4XA 2W07A 2BVYA 3UPRA 4AT6A 5M95B 4QHMA 4EI5D 3OL2A 2C4XA 3LIZL 1BJ1J 2V2TB 4MJ4A 5D7SL 1Z5LB 4MNQE 2OZ4A 4HUNB 4YHYB 1QR1B 5DJCB 3W0WD 3BPCB 5EORL 2VDLL 3B9KB 1B4JH 3MV11 3ZE1F 1KYOK 5IB4B 1Y18B 1EHAA 3IJSB 2V2XA 4RNRB 4XWOC 3NAAL 2WP3O 4F7EA 3MUY1 3WL9A 1E4WL 4ISVA 3QDMA 1U58A 1UA6L 4HUVB 2PYEE 4NKOB 3O2DA 5HI5D 4M4RA 5GGTH 4UB0L 2JELL 3LZFH 1X5KA 4KJYB 2DMBA 25C8H 1A9BB 2Z31B 4FABH 2AJUL 5C08B 2F19L 2JF1A 2ZCHH 1QRNE 5TQ0H 1DLFL 3ROOA 3X3GH 4EVNB 5GZOD 1EVUA 2BMKB 4H20H 4CADB 4U1SA 4LEOA 4XNMA 4R2GD 2O5XH 1AR2A 2UWEB 4JFDB 3RTQB 5IB2B 2X4UA 1P7QA 3AS2A 3E0GA 1HHHA 2Y4SA 3MROA 4K7PH 4KKBC 1VGEL 3SKOA 3OR6A 1EHLH 1TTGA 4A6YH 4PS4L 4YDKL 3EO9H 5HI4C 2H2SC 3IDNB 1MCOH 4WW2A 5EOTA 4DZ8A 1WQVT 2VC2H 2GCYB 5DK2A 4DEPC 2GJZA 5GSRB 3L3DB 4P46B 3O8XA 3GSQA 4D9LH 3T4YA 4IIQA 2F9BT 4PJ5E 4JJ5B 2VXQH 4FQPA 4P4RB 3P9MB 1BZQK 4F8TA 4R4BA 1P7HL 4U4BA 1UB6B 1PG7L 3L3HB 3BOVA 4YO0A 4L8SB 3GRWL 3FQXB 1XCQA 3FO9B 5DD5L 4MJ6A 2AV7B 1YA5A 3MV01 4FZ8L 3PWPA 5KOVC 1BWWA 5D2NA 1JRHI 1EO7A 2YBRA 5DMJB 3W81A 2ADJA 5IVXB 5EWIL 4OLWH 3M1BB 3CX5K 1NFDF 5IIEB 4ZTOH 3O8XD 3CFCL 3HZYA 5DT1L 2VITA 4YHLH 2VLME 2WANA 4FG6D 4PJHE 1S7TA 1T83A 4LASL 1CXFA 3R8QA 3DARA 5HD8D 5IB5A 3WFBH 5I2IB 2MTPA 1MHHB 2VXTH 2EDXA 1UG9A 1W72B 3TT1L 3C5JB 1XGTA 2X4OA 3O9WA 3NCFB 4JHAH 4S1DD 4C83B 4FQIL 3PWPD 5BZWA 4ZOAA 3IDJA 3RWGA 1XGUB 1JZ6A 2NXYC 3SO3B 3SO5A 5FKPB 4TSBH 5HDOA 2VDQL 2YPKA 4PJ5A 4PJCB 3OJ2C 5ITBL 4RAUB 2P45B 3FN0L 1JNLH 1DQJA 4ZYKB 5E2VL 4P3DA 1CGSH 2BNRB 3HUJF 3RDTB 5DD0L 3G6JF 2QQKH 3T3MF 5C0RL 5J6GB 1A7PH 4HF5H 3C8DA 1LO5A 1K6QH 3DMMC 4MA7H 2BHZA 3PV7A 2V17L 2A6KB 4Z7OF 1IFHL 3P4NB 5HHQB 1F2XK 3PHOB 1RZKL 3BQUB 5FGSA 4PV8A 1U8HB 2VMFA 1BQUA 1CICC 3SGDH 3O9WD 5CJBA 1IZJA 3MYJB 3WEXB 3WKNA 4ZUVA 3QDAA 1QSFE 4XC1L 4OZGE 1JWMA 1FVCA 1CR9L 3QIUA 4U1LB 4WFGD 4PJ5D 4RZCB 4XMPH 4P0DA 5ID0A 43CAA 3U9PH 3PDGA 4MS8C 2VL4A 1UWEH 1FL5A 1RJYB 3DUSA 1NCDL 3V6OC 3CPLA 4H25A 5E08L 1T22B 1P53A 5AG9A 4MAYC 1N0XL 2K3TA 3G5YA 4NCC2 3SJVB 4U0RC 5FUZL 4NC0B 1JGUH 1RULL 1X6NA 2PW2B 2XXCB 5F1KC 1G7MB 1MCJA 5F9AC 3HS0B 4M1CC 3TV3H 4ZPTA 1EEZA 2R2BA 4GAFB 4TVSa 5BMFH 5KVFH 1KULA 1S9WA 4XP5H 4D9QD 2VDKH 1NCWH 2IADB 3QIUD 1DE4B 4NNYB 1X5LA 2OJZH 3SDDB 5DRZA 4TTGA 4XCEA 1UWGL 3GIVA 4EDXB 2VQ1A 1CU4H 2EXWC 3RNKB 4OZIA 3UYRL 3MR9A 4C4KO 1AGEB 4GKSA 1M4KA 5C0AB 4XNUH 1QFPA 1ZHLB 5AG8A 4R4FL 3QIBC 4PJIE 3WIIL 3KXFE 3HTLX 3MJ9H 3OKKB 4OJFL 4FA8A 3T0WA 5FDWA 3PWJA 3OX8B 3VFWB 1TTUA 2IEPA 4V1DE 5FA4A 3QUML 4KQ4L 1DR9A 3WJLA 4P2OA 4XPTL 3LN5B 1T04B 2FD6H 4TNWK 3QFJE 5HSFA 5FM8A 1DQDL 2HT2D 5LQBL 4PJ9C 4Y1AB 3S36H 2ID5A 2J6EA 3QZWG 2X05A 3C5SA 3QUZA 4ODHL 3T77B 3V52H 3N1PC 4BUHA 2MWCA 3ZTJH 3L7FB 2A74A 4XZUB 1I9RH 3MRIB 1KJ3L 3VFMA 3K81A 4X6CA 3ARRA 2PXYA 4N90D 4U6HA 3CFDB 3PWVB 2C3XA 2DQJL 4GRMB 2Q6WB 1QSEE 4CVXB 1NC4B 4OLYH 1M05A 5D1XC 5DDHB 5I75B 4LKXB 5KSBF 5EN2B 4LLUA 4P2OD 2GJ6D 2HKFL 3T0EA 4YR6A 3VD5A 4ZXBC 1DZBA 4N0CD 3NFPA 4PTUA 3RWFA 2HT4D 3KXFA 1BGXL 3RHWF 1R3HA 1Y6NR 3TZVA 1JGEB 2JIXA 3QUZD 3ALWA 5H2BA 4AJ0A 4JRWA 5D70L 3PUCA 1RZKC 1XH3B 3HE6D 3KJ6H 35C8L 4XX1E 2DN7A 2BVOA 5DK0B 1S7RA 3IU3A 1JI2A 4KAQH 3HRPA 2PXYD 4JO4L 2OZ4L 4JFFA 4HG4K 3Q48A 4LIQL 3SGKA 5KW9L 5C1MB 5J0BA 2NW2B 1FYTB 5A3IC 3O6FD 3WS3A 1I1YA 2Y07H 3LN4A 1GL4B 4QRRB 1T1ZA 2GUOB 2WP3T 3T0ED 5HYJE 3UBXB 3B8SA 1MI5B 3CVHA 8FABB 4LGSB 3SE4C 4IRJA 3RBSA 3BIBX 3L5HA 2Q76A 4OF3A 4K3HA 3TZVD 2FX9L 2JIXD 3E6HA 3NOIA 4X99B 1TZIB 5I1GL 2DM4A 1A6TA 1ORQB 3SDYH 1NC2A 1OSPH 3LHPH 1SVCP 3EO1A 1KACB 3ZL4H 1RZIB 2EDWA 2EZ0C 4P9ML 3PP4H 3QDJE 3G6DH 1U3HA 3D87B 3GUTB 3ZSTA 3L3KA 2XWBB 2F8XC 4JFFD 3MMEB 2ZOLB 3FO2A