2K7VA

Deletions in a surface loop divert the folding of a protein domain into a metastable dimeric form
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
85
structure length
85
Chain Sequence
MVKEVNVPDIVEVTEVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAAAPAKQE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A surface loop directs conformational switching of a lipoyl domain between a folded and a novel misfolded structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Dihydrolipoyllysine-residue acetyltransferase component of p
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k7vA00
1GUGA 1Z7TA 4KI0A 1E2WA 2JEBI 4BA2I 2A68D 1VF5C 5BN4A 1H9SA 2JE6I 2AUJD 3M4YA 3MXUA 1IW7C 4KMUC 3VR2A 1E2ZA 1VCIA 1I6VC 3T51B 3DXJC 2EVBA 1ZKOA 3D4RA 5BN5A 3A7AB 4H44C 2AWOA 2YYZA 1DXMA 5KNBA 4OO1G 5BN3A 2K33A 1Q90A 2PCFB 4IFDH 3H94A 3SE0A 1Y8OB 3A7LA 1FR3A 2EJMA 2BDOA 1TKWB 3ND8A 4HR7B 3M7NA 3OPOA 2O5JC 3OOCA 1SMYC 2BA0A 2R6GA 3VR5A 2Q8IB 2BE5D 2BA1A 1ZYRC 1QJOA 4TKOB 4BA1I 1H9MA 1B9MA 2KCCA 5KNDA 1VF7A 3EQLC 5JEAG 3GQBA 5K36H 1EWHA 2KA7A 3A8KE 3RLFA 2A6HC 4H0LC 2B8GA 4XTCS 2EJGC 3NE5B 1GUTA 4DNRB 4JK1C 1HPCA 1Q1EA 3QIAA 3VR4A 1HQMC 3VR3A 1OXUA 3QG1A 2QF7A 2A6HD 1T5EA 1O78A 5KNCA 1VDZA 3N6RA 3QJYA 1LABA 2E75C 1O7LA 3ND9A 3LWUA 4KN7C 1PMRA 3LNNA 2K7VA 3OW7A 3TZUA 5C0XH 3P20A 3T56B 1FYCA 1BDOA 1V43A 1OXXK 2DNCA 1H9RA 3D31A 1OXTA 3A8JE 4PV1C 2AUKA 1Y8PB 1OXSC 1A6XA 4KHZA 1DD2A 4KN4C 2A69D 3VA7A 2DNEA 5A35A 1ONLA 2E76C 1Y69U 2E74C 2A6EC 2PNRC 1GUSA 3VR6A 4DK0A 1OXVA 2D62A 4DK1A 2ZT9C 3IKJA 3L7ZC 1K8MA 3FMCA 3I4LA 3BDOA 4L8JA 1E2VA 1H9SB 3AB9A 1LACA 2O5IC 2CW0C 1CFMA 3MFYA 4KKTA 3PUXA 1GHKA 1CI3M 4IFDG 3CRKC 1GUOA 4RCNA 4TQUS 1H9KA 3SDZA 3PUZA 1IW7D 3I73A 1K8OA 2NN6H 1IYVA 1H9JA 3PUWA 4JBWA 3PUYA 2K32A 2D5DA 1HCZA 3CRLC 3KLRA 2NN6I 1YNJC 1B9NA 2D2CC 3IFTA 2IT1A 1HTPA 2NN6G 3W3AA 4KKUA 3WDNA 3M85A 3GD7A 2L5TA 4DNTB 2V4DA 5K36G 2LMCB 2JEAI 2EJFC 2JXMB 4LJZC 3U9SA 1IYUA 2F1MA 1G291 1CTMA 1V8QA 1Z6HA 1GHJA 2BE5C 2A69C 2DN8A 2EDGA 3I72A 4I7ZC 4LK1C 3T53B 3PV0A 1GUNA 2PPBC 4G7OC 3HGBA 5C0XG 3BG3A 4G7ZC 1TU2B 2A68C 1Q12A 1YNNC 3FPPA 1Q1BA 4G7HC 1GJXA 1Y8NB 2B8FA 4KKSA 4OO1H 1DCZA 4GZYC 2A6ED 4OGQC 3PUVA 4XIGS 5JEAH 4H13C 4IQZA 3A8IE
chains in the Genus database with same CATH superfamily
2VQFL 1T5XD 3CF5A 4A3DG 1F9PA 1VF5C 4IPDA 2B63H 1H9SA 4NXNQ 1L1OC 1F2YA 1KQSA 2LKVA 2LXKA 3MXUA 2Z4HA 5LHY1 4DV0Q 2L12A 5IP7G 3T51B 5BN5A 3D6CA 3UDFA 1PH7A 2E2JH 1G91A 3S1NH 3M4QA 4DGZA 1YZ6A 1UUPA 3KDFB 3T1HL 3AFPA 1A3UA 3K6OA 3OPOA 4K8JA 2K14A 3VR5A 3HP3A 2Q8IB 3PIP3 3CKIB 1U0LA 4UHVA 5C4ZA 4ZLTF 4YHHL 5CV9A 1STYA 2K5WA 4LF7L 4EQPA 2K4KA 1QILA 1MKHA 1VQOA 4EQOA 2EPBA 1L0WA 1OXUA 2SDFA 2A6HD 1I6HB 1UE6A 4IPCA 1RDPD 4FO2A 4NDXA 4F8MA 1BCPB 1EYCA 2B2UA 3DM1A 4IPGA 5JJKA 3ERQA 3F1ZA 4DAPA 1AE2A 3JC66 2Z1CA 3KBGA 4JPBW 4WRDA 2XIWA 3H3VC 2F3IA 1B7YB 3R93A 2CWPA 3RZOB 2F0EA 4KHPQ 1D5MC 3VYUA 4NPSA 5IWAQ 5JVH3 3R2TA 1EQVA 4R4CA 4NXMQ 1PTOH 1F2LA 1EYGA 2ZM6Q 3A54A 1IW7D 1QOHA 4QB4A 3MEFA 3PUWA 4A93H 1DONA 5ELEA 1KNAA 3H91A 1X3FA 3GTOH 2MPMA 5IGGA 4KKUA 1KL9A 5KYLA 4MHEA 3PO2B 4Z9CB 1RHPA 2F0QA 5FO7B 1SFOH 3IAYA 3GTPH 4GOPC 5I2XA 5ELDA 2WKDA 4I7ZC 2OWOA 2LXJA 3HOWH 4A3LG 4RCOA 3T53B 1Q7YC 2B2YC 4DV4L 5C4XH 1V9PA 3NHHA 3HGBA 4O0AA 1ASYA 1J5EQ 3S24A 1DCZA 4ME5A 4A3JG 3T16A 1B53A 2B63G 2EYFA 3EA6A 2ALYB 1MBYA 1U4LA 1Z47A 1EY4A 4XQNA 4LMQD 3HEJA 1K8GA 2R92B 4IUQA 2Y0SE 4JG2A 1PH8A 5C3EB 4CBVA 4H44C 1Y1WB 1KIXA 3SK4A 1FVIA 4POFA 1TWAB 1ENCA 5IIFA 4J15A 4I7AA 3CCJA 3G6EA 1NUCA 3S1RB 4JBKA 2M00A 1W2BA 4RKLA 4DR6L 1JE4A 1PVOA 1HHVA 2LY7A 1NTGA 4X3KA 3ZYYX 4J1MA 2YU9H 1LV9A 1R9TB 2BOSA 2HDLA 5CV7A 1EUJA 1WVLA 4B3TQ 4CKBA 4GKJL 1SNCA 4IUNA 4JI1Q 2ZTCA 4KHPL 2GVAA 4B3RL 2XGTA 1E7ZA 1GOZA 1SNPA 4DUZQ 2DY8A 2ZXRA 3SK6A 3RZDH 4UY8C 5C44B 1A6XA 2HHHL 3HKSA 3TS0A 1E22A 1OO9B 4X62Q 1R4PB 5ELBA 4DKAC 2F0JA 4EX5A 2CKZB 1RD9D 4DK1A 3L7ZC 3TREA 4BY1H 2JA7G 5FLMH 3K81C 1CKNA 4JVZA 3PF4A 1ILQA 1VQ8A 1UNSA 3J7YW 1PFSA 4RCNA 4EGVA 4Q0FA 3HOVB 1Y1VG 4JI4L 4NKLA 3KLRA 2PQAB 2E8GA 4DUYL 1HNWQ 3DEOA 1PFBA 1XPRA 1SN8A 2MFIA 5A2QE 4BBSH 1PYSB 1I5FA 1JOOA 3GD7A 3QOLA 5D14A 5HURA 4RFBA 5CGKA 4CHTB 2CCZA 4P72A 4LJZC 1STAA 4DK3C 3CU7A 4A3JH 1AFPA 3CPFA 3FPPA 1GJXA 2R7FA 4OGQC 5C44H 4DV6L 5IODA 2VL6A 1EY5A 2NVXH 5FLXE 3DLLA 1Z7TA 4DR4L 3SK5A 5LL6S 3GTPB 1QZHA 3CD6A 3UDXA 4DV1L 2IW3A 1XNQQ 1B3QA 5EKIA 2ZTEA 4ODGA 1MJEA 2EYJA 3A7AB 2N49A 4K8IA 3OMCA 1R9TH 3GDEA 1SYEA 2YYZA 3KLSA 5K5PA 5LMNW 1I4RA 1BF4A 3GV3A 3HOXB 1K83B 2K5HA 2KHIA 4GLXA 2EY5A 1QZGA 1PTOB 1TKWB 3OSOA 1ASZA 4FF4A 3OOCA 3CCVA 3J80E 1ZYRC 2F4IA 3EQLC 1QVGA 1PRTD 1I4XA 3ERSX 1NR4A 2IL8A 3NE5B 4XDXA 5JPMC 4GNXB 4IUTA 5I6YA 4JV5L 3F8TA 2OTLA 3TBIB 4TSSA 3HOVG 4EQ5A 3HOZG 2QILA 1U5KA 3RR5A 1YHBA 4WORA 4UPAA 2O2LD 4DV7L 5FLMG 4DV5Q 2JA6B 3T4AC 4FF2A 4G4KA 4A3KH 2NVYH 2EY1A 5CMDA 5I2YA 1C8CA 3FMCA 4IN3A 4N9PA 3CCMA 1TY0A 4JI2Q 1K3RA 1YVCA 2OCEA 4A3IH 2PI2A 4WJ3M 2M2LA 3I55A 2G9DA 1WTOA 1NMGA 1YI2A 1IBML 4C3IH 1HJPA 2WAQG 4JBWA 5EPJA 1HCZA 4C3JB 1B4OA 1UAPA 1EWCA 2QDBA 3K7AH 2D2CC 4FDBA 4EQNA 2IPKD 3W3AA 1MD2D 2PW5A 3S14B 4DNTB 4F7XA 2V4DA 2Y0SB 1WTVA 1GXDC 4A3FH 1G2TA 2UUBQ 2ATWA 3NBHB 2B3GA 1QUQA 4DA2A 4MZ9A 4OIJA 1SYGA 4DV3L 3A5ZB 1LLRD 3CP0A 1PH9A 2KOLA 3CQZH 1HR0L 4IUPA 4H7BA 3J81c 2A68D 4HCEA 4ZK9B 1VQ5A 4FXKC 5CV4A 4GNXC 1N33L 3M3YH 1PH2A 3S14H 1N34Q 1WTPA 3FEWX 3A55A 1EY0A 4QJFA 3J7ZC 2P5ZX 3J7AF 5C3WA 3K59A 4GOPB 4IUUA 1XWEA 2KHSA 2E2IB 2AWOA 1EY8A 1CQVA 1DOLA 1TWHH 3SGIA 3SE0A 4OWTB 1QVFA 1Y8OB 2Z9HA 1N36L 1PH6A 2CHBD 5FO8B 1MIUA 1SMYC 4RA8A 5KNDA 2EE1A 4FF1A 3RLFA 1XMQL 4H0LC 4DAMA 2HCIA 3S9WA 1JB7A 2E2JB 4K2LA 3BZKA 1A15A 3LWEA 2AWNA 3D3RA 1SE2A 3TP8A 1MGSA 1ESFA 3A5UA 1X6OA 4DR1Q 3H0GH 3NQIA 2VQEL 3ND9A 3LNNA 1AEXA 2R93H 3I4OA 1F77A 1EFWA 5CR3A 1K83H 1FGBD 1B3AA 2RKSA 4KHZA 3VA7A 2NVTH 3TZDA 1U4RA 2A6EC 4R4QA 3DHQA 1TWCH 2PNRC 5IWAL 3HRZC 3HOYG 3GV6A 2AQ3B 3HOYB 1K3BC 4UP8A 2UXBL 5M5YB 3AB9A 1LACA 2BH2A 2TSSA 1LT3D 4DR7L 2E2DC 3K57A 2KECA 2YTYA 4JI0Q 5IP9G 2KENA 5FJ8G 4DV3Q 3L9AX 4LF5L 2R7ZB 5M5WH 3VDYA 3MTSA 5J22A 1M8AA 1SYCA 1SYDA 3GTLB 1KAWA 2YTXA 3M85A 2ZJRA 4C3HG 1E24A 1FJGQ 3ICEA 4A76A 4O42A 1JOKA 3PO3G 1C4QA 2A1AA 1HZ9A 2H1EA 2UUCL 1FJGL 3UI2A 4BY7G 1EL0A 1WCMB 1CA5A 1K0RA 2CVRA 3MAQA 1J8IA 3LX0A 3F2BA 5C0XG 1YIJA 1ET6A 1NSNS 4DR3L 3I70A 3DEPA 2KCNA 4A3MB 2H4OA 3I8ZA 5C0XJ 1EEFD 2WFWA 3PUVA 4KHVA 2SNMA 4HAEA 4POGA 3AQQA 4LF8Q 2JEBI 4AYBE 1JWUD 2B2WC 3AYHB 2MNAA 2F0GA 1TY2A 2I5HA 3HFZB 5KYIA 1PTOC 3OIQA 1Q82C 1I50H 1VCIA 2F0DA 1XMQQ 4BBSB 1B8AA 3URYA 2XN9C 2VZAA 3FPUB 5CYUA 1LTRD 3T1YQ 5KNBA 2B29A 5M5XB 4DV2Q 5C3EG 4MTKA 4KLKA 3HG9A 3ND8A 2AQ2B 2ZM6L 3CHBD 1PTOF 1V1PA 3A56A 4ZCKA 1DM0B 4GN3B 4BY1B 4H02A 1MI2A 2EYMA 4I65A 2UUBL 4RHRA 5IGCA 4HEDA 3E0EA 1XTCD 3RD4A 1BCPC 3QIAA 4HJ8A 2KJXA 3GTKB 2R3ZA 5FLXL 1PMRA 3S15H 2UUAL 2NZHA 3WOEA 4DR2Q 2NVXB 5DM73 5C3XA 2AUKA 4CDCC 1CZGA 3Q0AA 4PNYA 1AH9A 2D0OA 2QCPX 2EIFA 5HY6A 3T1HQ 4B3ML 2IX0A 4WJ4A 4OELB 1FNWA 3UDIA 4PZ8A 5C3EH 1FNVA 1K8MA 3BVGA 4DV4Q 3M4OB 2JSOA 1JJCB 2EXDA 3V2TA 2O5IC 1LT4D 4MIUA 4IUVA 5FLXc 1G2SA 4PMCA 3PUZA 2B2TC 1D1IA 4DAYB 5LL6X 5D65A 1IYVA 1SYBA 2PNHA 4AYBB 1JB3A 1VQAA 4DAVA 4PQXA 1Y1WH 2J4XA 2F0KA 1WTXA 5IGEA 1CUKA 4P73A 4Y7NH 2F4VL 3OIPA 2L5TA 1F2ZA 2K05A 1HNZQ 2RCFA 1IYUA 3K5OA 2VQEQ 3HOWG 4A3LH 2NWGA 4KN4C 1V8QA 4YCUA 4XQQA 4DV2L 4C3HB 1EOTA 3I72A 3BVMA 1TS5A 5EPKA 2Q2HA 2R7ZH 1EZ8A 4B3TL 1Y8NB 4GZYC 4OO1H 3C3LA 4B9XA 3NENA 3ER0A 4AH6A 1IKMA 1B50A 4KI0A 1VQHA 4ZKCB 3GP7A 4F87A 2AHOB 5JVG3 2HHHQ 1E2ZA 5EJWA 1I6VC 1L0XB 2EOTA 3D4RA 5J3BA 4FP5D 4C2MB 3RN5A 3OWFA 1CT1D 3I91A 4IFDI 3I4NH 3KOJA 1Q90A 4K5XA 1F9RA 4K0KL 2EJMA 3N52A 1HA5A 2IX3A 3S15B 2KEDA 4A3BB 4GLVB 4K2KA 4IOCA 4JI5Q 2PZWA 1ICFB 5JEAG 3CCSA 3RN2A 4A93G 4RH6A 1O7ZA 2IHFA 1Q8KA 5CV5A 1G6PA 4V0BA 2X6LA 2ZXOA 4QY7A 4AIMA 3VR3A 2NTSA 3QG1A 1I94L 2HT1A 4BY7H 1U4PA 3CMAA 1T5EA 2X6GA 2KEEA 3IL8A 3G7LA 2F0UA 5C0XH 3GTQB 5EPLA 1BDOA 1EY7A 3SK8A 1OXXK 2DNCA 3J81j 4DV5L 1KAAA 3ONAB 1Q8IA 4JI8L 1TWHB 3K8AA 2QEXA 1XYIA 3S2DB 2J0TD 4DV6Q 5KGUA 2E76C 1SBBB 1XXGA 1JJ2A 4JI2L 2FMCA 5BR8L 2FFKB 1BOSA 4KV6A 2CFMA 2CQOA 3J80i 2B63B 1KDAA 1TXYA 1GHKA 2R93G 1CHPD 2A73B 1J6QA 2ZJQA 1ENFA 3KFUA 1PFNA 1AP0A 2K1BA 3AFQA 1L1OA 2D5DA 2OQ0A 1AZQA 4B3RQ 1YNJC 4ZUIA 5I9OA 3P7JA 3IFTA 2NN6G 1P16A 3RNUA 3PF5A 1UE5A 4X62L 2GVBA 3W2DA 4X66Q 2L1BA 3T13A 3KF8A 1J9OA 5M5WB 1A62A 1F9SA 4G7ZC 1F9QA 3HOUH 3F2UA 2AKWB 4IO9A 4E6IA 5FK9C 4UP7A 1VQFA 1JMCA 3FKIH 3UE0A 4A75A 1HXYD 4A3IB 1N33Q 3A0JA 3QO2A 1UEBA 2OQKA 4FVMA 4GKKL 2QA4A 4BBRB 2SNSA 4JI3L 3NXWA 3RLOA 2NUCA 2EVBA 1PH3A 5IOCA 2QDLA 3A74A 5JPNC 1IL2A 4GN4B 2JA8G 5JJZA 3S2HH 5NUCA 1QE6A 2M9VA 4RG1A 5IYDG 1JCKB 1EIHA 3FP9A 3E5SA 2N88A 4TRDA 3GTQH 2NYZD 1VF7A 2G5DA 1B1ZA 1QG7A 5CV8A 4OHJA 1TWFH 5DM63 2C35B 2NBFA 4LWCA 3EVQA 4R9WA 3QOJA 2E5LL 5IY0A 3J80c 5JJIA 2IJ0A 2L55A 5TSSA 1CKOA 1VDZA 4A3EH 1LABA 4QL5A 4L5SA 1EY6A 1LUZA 2F0VA 2HQEA 5IGFA 1Q81C 4B3SQ 2FINB 2RSNA 3HOXH 3CC7A 3R8BA 3S2HB 1SYFA 1WTQA 2KBNA 5CBAE 4GOPA 1TWGH 2E74C 4CKCA 1GO3E 1CQFA 4C3JG 2F0HA 2Q8TA 2HD3A 2RDGA 3GTGB 4YCVA 4HN7A 4K6DA 1KHIA 1NMFA 3PIPA 1PZKD 2F0TA 1PH5A 5I6WA 1HNXL 1HH2P 1PH1A 1GUOA 3Q6SA 1A0IA 4TQUS 3I73A 3EJIA 5FOBB 1PTOD 2NN6H 3PUYA 5E7NA 5JAVA 4GKKQ 3I4MG 1EIYB 5ELFA 3G71A 1LO5D 1N34L 4DXFA 1HTPA 2N78A 3F2CA 4X64L 4JI6L 1HZCA 1BUVT 3W1GA 4KK7A 1VQPA 2J7ZA 1SE3A 1BBWA 4X64Q 3V05A 4JI6Q 2N3SA 2DN8A 2I0QA 1EEID 1GUNA 1VS0A 1X3GA 3I2ZA 3K80C 4C3JH 4G7HC 3S16B 1G8ZD 4A3GH 3X3MA 1EIFA 2HIXA 4MN3A 5C6AA 3PO2G 2UXCL 1CSQA 1YHQA 2VNUD 5EAYA 2JE6I 4YY3L 4JBMA 2EYHA 4KD4A 3JAMi 2A5HA 2FMMA 1SXTA 1KNEA 2EY2A 5DNFA 4KMUC 4JYAL 1X54A 1JR0D 2NVYB 1SR3A 3D4WA 1ZKOA 2PMZB 2MP1A 1HFGA 1D8LA 4LFAQ 4XXEA 4AQYL 4OO1G 2Q2TA 1K28A 2JQOA 2WINB 3RZDB 4X6AH 5J39A 4A3IG 2BDOA 4HR7B 1XMOQ 2BE5D 1N32Q 1D7QA 5T1IA 4OEMB 2MGSA 1A8VA 2WP8J 3BYYB 3A8KE 4BY7B 4CJ1B 4HIMA 2KHJA 3GTKH 1TS3A 4Q5VA 2UXDL 1RTNA 4N9TA 4HIOA 2QKIC 1I3QH 1SMYD 4YWKA 1NR2A 1RTOA 2X69A 2UUAQ 2UXDQ 1O78A 4C56C 1CZWA 3CC2A 3FRPB 2IX1A 3PIO3 4JV5Q 4P71A 4LW1A 3BZDB 2XSCA 4HTHA 1I3QB 2F0WA 3TEHB 4JI4Q 2DNEA 4IALA 3J81L 2UUCQ 1LTBD 2VW9A 5IT9E 3KF6B 2UU9Q 2ZT9C 3IKJA 1LTLA 4HMJA 5D3DA 3ZJYC 3BDOA 1Y1VB 3NELA 5IT9L 4LF4L 1DOKA 1PLFA 1VQBA 1EIGA 2ICIA 5EBCA 4FNFA 2CW0C 4OIKA 4C1NI 1EU4A 1F2MA 3OMGA 2JA7B 4A3DH 2PI2E 3PCOB 5JEAJ 1SE4A 3QR8A 3WOFA 5G3LF 3WDNA 1VQLA 1KC8C 1ESRA 4DR4Q 3KUPA 1W6JA 4K5VA 2EJFC 1PHJA 1QNKA 4KD3A 3ULPA 2A69C 4DV1Q 3AMUA 4LF6Q 2K5QA 3CC4A 2PPBC 1G51A 2YTVA 3EBEA 4A93B 4X3UA 4J8QA 4A3GB 2Q2IA 3A8IE 1GUGA 3L2PA 2SEBD 3I4MB 4OONA 5E3FA 2JA8B 1VQMA 5AFWA 4A3CG 4B3MQ 5AJ3Q 1RODA 4B9WA 3Q22A 1ILPA 1EY9A 1VQEA 3BDCA 1J5EL 3MZ5A 3PSIA 4R4IA 2PCFB 3H94A 3TDQA 2F3VA 3KF6A 2LS01 3NWSA 3R3OA 3KF8B 2UU9L 1B9MA 3CCEA 1QUQB 3VYTA 3STBC 3DUZA 1SMXA 3JAME 1QCBD 4LF8L 1I94Q 1UEAB 2R7ZG 3PMFA 1SSOA 3K0YA 4JBJA 1Q3LA 4XT3B 3G4SA 1M90C 2OEOA 3MXPA 1PDQA 4DN4M 5KNCA 2WAQB 1ML0D 2YV5A 2K50A 3D4DA 3PO3B 1GD7A 2AMCB 1BCPD 4QIWE 1IBMQ 3UE1A 3K58A 2BDNA 1GUSA 5GAGC 1OXVA 3I7FA 4GKJQ 1S5DD 4DR6Q 5I4DA 3FHWA 2NVQB 5GAHC 1LTTD 3HKZE 1IHZA 1VQ6A 4DUZL 1UWVA 4DPGA 4LFBQ 1LM0A 4LF6L 2H5XA 1JQYD 4CJ2C 1JWMD 3QB3A 4NXNL 3FDTA 4GNXA 2JA9A 1CA6A 1PRTF 2WACA 4OXPA 1L2FA 2KUMA 3H3VH 1VQGA 1BBUA 2LMCB 3DWAA 4ALPA 3MWYW 3J7AV 1CTMA 2L11A 5M3MH 3I90A 1R4QB 4BXXH 1O7YA 2B2VC 1A2UA 1ICWA 4LFCQ 1YJNA 2CQAA 1WD1A 4PMWA 2L15A 4JI3Q 4ABNA 1CM9A 3TQYA 1PZJD 1CKNB 1WOCA 1RKNA 2AUJD 2JN4A 1RL2A 4A3EB 1LTSD 1T9HA 3Q24A 4K14A 2RF4A 4YCWA 1BQQT 2PZUA 1U4MA 2D0PA 2OF1A 3G6JB 2AQ1B 4RHSA 1KRTA 3CPWA 1B44D 4F88A 3RLNA 4DU9A 3S1MH 1E0BA 4LUVA 1STBA 3TP7A 3T1YL 2A8VA 2HDMA 3NBHA 3BDLA 3VYSA 1X65A 2E2HH 4TKOB 3MHBA 3DMUA 2I46A 2PQEA 2RQXA 5K36H 1PFMA 2Z6KA 2EJGC 3S1MB 5ELNA 4JI7L 5GADC 1IKLA 4DF7A 1L0YB 3MFGA 2QEJC 4R4TA 4RWSC 2K6AA 3EROA 3MXGA 3N6RA 5M3FH 3S1QH 5HGQA 5M3FB 4JOIA 1NNXA 5IE8A 1OXTA 1KD1C 4NXML 1AN8A 2IHEA 2MUYA 2N55A 5IYCH 1G6ZA 1STHA 4DR2L 1I4GA 4X65L 1WD0A 1I4QA 4R8IA 3K5NA 4TVAB 1V1QA 3TN2A 4A4IA 3H6MA 1VQCA 4HMIA 5M3MB 5C4JB 1V1OA 1BO0A 5E4WC 3M3YB 4PZ6A 2D9UA 5ELCA 3PUXA 4BWGB 2ID0A 1H9KA 4LAAA 4XYQA 2N8NA 1H9JA 2B2WA 3AU7A 3CRLC 4JCVE 1PRTB 3C1EA 4NB3A 4FF3A 2Z0SA 1B9NA 4QIWB 2F3WA 5DAUA 1WJJA 4LF4Q 2NZ1D 5ELOA 1PXUA 3I4NG 1NCVA 3H09A 4Y52H 1P8LA 3HOXG 2BE5C 1IXRA 1O7IA 2OT2A 2XRQD 3HKZB 3S2DH 4IQZA 4R8NA 4A3FG 2VB2X 3MVVA 4ZKBB 1WI5A 4NMZA 2JP1A 3L0OA 5I9PA 5LMNQ 1TT2A 2F52A 3EIVA 3VR2A 4CJ0B 3CW2C 1SNQA 2RHQB 3WWVA 1HQRD 4KTAA 2XVSA 5FJ8H 1PA6A 3HOZH 1LT6D 5BN3A 2K33A 1BCPF 4A3CH 4APVA 1KLUD 1SDFA 4DR7Q 2Z6BA 3MEHA 2BA0A 2BA1A 2K03A 4YWLA 1BR9A 2C5CA 2NVQH 1B70B 3M4OH 1X56A 5ISRA 3PIOA 4OL7A 4HJ5A 1HPCA 4RGTA 4WFN3 1TS4A 2B2TA 1W3SA 4L63B 1X3QA 2R7DA 1IL8A 3DWQA 2E75C 4IJHA 1JE5A 5KRUA 2K7VA 2QW7A 1MSHA 4A3BG 1UE1A 3K5LA 2PZTA 3PGZA 1V43A 4CDEC 1H9RA 3A8JE 3KJOA 1IBKL 2A69D 5IYBG 1HNWL 4DK0A 3O13A 2F0NA 2OTJA 3I4LA 1LTID 1GUWA 1TQOA 3KJPA 4KKTA 1CFMA 1YEZA 1GVPA 1NJIC 4RGMA 5COYA 1MJCA 3NEMA 2NTTA 3E6ZX 2EZVA 1SEBD 3SDZA 2VUMG 2ICEC 4HSPA 5C4HA 3NPPA 2PO4A 4DR1L 3BVZA 2RSOA 2B2UC 3KLSX 4DR5Q 1XNRL 4QUFA 5GAEC 4A3JB 4O1NA 3KK7A 3S17H 4C3HH 2E5LQ 2I5MX 1YNJD 3NTHA 1G291 1KABA 1N9WA 4LK1C 3OYYA 4Y7NB 4UDUC 2A74C 5H1SE 3NWTA 1XMOL 1N32L 1Q1BA 4KKSA 4RKBA 4XIGS 2VUMB 1Z9FA 4BA2I 4QGUA 4IZ8A 5IGBA 4DAYA 3S17B 1HR0W 4A3EG 2RDFA 1KRSA 1VQIA 1S5BD 5M3MG 3H15A 2PQAA 1CHQD 2L4NA 4LUOA 2JA7H 2C9OA 4HJ7A 3M4PA 4DXGA 2B2YA 4CDDC 1N36Q 4HJAA 3GQBA 4OX9L 1SJHD 3CCUA 5M5XH 1Y1VH 1BKBA 2A6HC 4XTCS 1UE7A 5T1GA 4QQBX 1I6HH 1S3OA 1M1KC 5EQ0A 1II3A 2QF7A 1JJGA 3U4ZA 2PMZE 2ES2A 3CMEA 1VMPA 4QMGA 3GTJB 5KEEA 1SNDA 2JA8H 2I5LX 1S40A 4MTNA 4LFAL 1HA6A 3H0GB 4L6TB 1DD2A 5IP7H 1ET9A 5EKLA 1Q86C 3D6WA 5C44G 4B3SL 1Y69U 1BVSA 2HUGA 1HZAA 2JK8A 2V1CC 4XYOA 2R92H 3GO5A 1EQQA 3OHXC 3RUZA 1C9OA 4AQYQ 3P1HA 1IZ6A 4QF4A 4DV0L 2DGYA 1D2BA 2O4XA 4U673 1YHAA 4BXXG 5IT9c 4X65Q 1HRJA 4QCLA 1D1KA 5GROA 4BS9A 5AJ3L 4UAIA 1N8RC 2CW0D 2HCCA 1STGA 1WCMH 4YHHQ 5FO9B 3GTGH 1Z6HA 1GHJA 5JOBA 4KJOA 1TS2A 1U9RA 3PV0A 1Q46A 1YNNC 3GTOB 5LMUQ 4BBSG 3G48A 2VXWA 3DWPA 3Q23A 3E9IA 4KJNA 4OWXB 2VB3X 1E2WA 3SHLA 1S5ED 4K5WA 5CBEE 3U4VA 5DEHA 3B6YA 3M4YA 3NBIA 5C4JH 3TP5A 4OWWB 1FNUA 3KYHC 3M7GA 4L5TA 1D5ZC 1ZXTA 3K7UC 1WCMG 4C3IB 2K75A 4WJWA 1STNA 3A7LA 2F0PA 1HUMA 2CWAA 4B08A 1C0AA 4JW0A 1AW7A 2KCCA 2PYKA 4KY5A 3OTOQ 4YIJA 3R2IA 1QWYA 2KA7A 3NQTA 1DZ1A 3HOZB 3CCLA 1SNMA 3DM3A 1GUTA 2E2IH 4DNRB 1H95A 1WTHA 1VQKA 3NTIA 2K5VA 1S5FD 5C0XI 2MQHA 3QJYA 3I56A 3STBD 1CKMA 1E1TA 4X66L 4JI5L 1PZID 1XX8A 3MC0B 3P20A 3T56B 1VQ9A 1Y1WG 2DY7A 4HIDA 1YITA 2K04A 3S1NB 4K0KQ 3KLWA 4XQJA 2KCTA 1Y14B 1ONLA 2KCMA 4NW2A 3C2PA 1PYWD 1DJRD 3VR6A 1AE3A 2D62A 3C46A 3NTKA 4A3FB 1H9SB 2DUDA 2FJ2A 2E2HB 5IYDH 1AZPA 1VQ4A 1S72A 5HGTA 1XPUA 4UP9A 4A3BH 4IFDG 3CRKC 4XT1B 2F03A 5G3LD 5E1FA 4OX9Q 5DLQE 4IFDJ 4LUZA 4A3MG 4FXGC 5C5LA 1JC7A 2HIVA 4CKEA 1MSGA 3P75A 1QNUA 1OTCA 2RBMA 1NY4A 4P74A 4JI8Q 3TMEA 3TRZA 4DFAA 1WTWA 4LF9Q 2IWHA 1X55A 2Y0SG 3U9SA 3BYTB 4HIKA 4JYAQ 5BR8Q 1I4HA 4BY1G 3J80L 2CH4W 3L3OC 1HFNA 3VYRA 3HOUB 2JYOA 1LT5D 2A6ED 4GS3A 3ITPA 5JEAH 2VS1A 4H13C 3FKIG 2EQSA 1ZEQX 3S1QB 3K0XA 5BN4A 3NSWA 4ID6A 3TS2A 2A19A 1VQDA 2BH8A 1EFID 2IY5B 1M4VA 3X3NA 1SROA 3HS0C 1ENAA 3OW2A 2L0CA 3F2DA 1JWSD 5CORA 1PH4A 4LF5Q 2JA6H 3HOVH 5KIXA 5EKKA 4J6HA 2K5NA 1PRTC 1K8AC 1FR3A 1HNXQ 5IGDA 2R6GA 1DYQA 4BA1I 1QJOA 5M9OA 1RF2D 4YWMA 2NZOA 2VY3A 1EWHA 1VQJA 3HZXA 2F0MA 4A3KG 4DUYQ 4P75A 1VQ7A 2WKCA 2MO0A 1HTLD 4C1NK 1S5CD 3BZCA 3NUCA 3Q8DA 2Z4IA 4OO1I 2K5DA 3KDFA 2JA5G 1JT8A 2EY6A 5LMUL 4ZQ3A 3PO3H 5C5MA 2F0FA 2I07B 3IFDA 1SAPA 4ZRZA 1IBKQ 1EYDA 1FYCA 1S4ZA 1IYJB 4PV1C 2F4VQ 5IYCG 2UXCQ 1W6KA 3CCRA 4FYDA 5D3IB 1A63A 1D6EC 3H0GG 4R1JA 3SXHA 4L5QA 1YBYA 1C48A 2ENBA 2XTIA 4N8FA 4LF9L 5F2DA 4RGOS 1HNZL 4FXDA 3V96A 3S1RH 1CK1A 1CI3M 4ZYSA 2XWJB 2R92G 1HZBA 4O2DA 2F0LA 1K8OA 4DNIA 4RGNA 2K32A 3ULJA 2JA5H 1SJED 3C1FA 1TWAH 3BS1A 1XNQL 1EYAA 2GN5A 2KQ3A 1SRUA 1IBLL 4K6LA 3TSSA 2ZTDA 5K36G 4JI1L 1VMCA 3I4MH 2G9HD 2EDGA 2EXZA 1KTKA 4NP5A 2DJGC 1TIID 4ZAIA 1KDBA 1TU2B 2A68C 4IPHA 5EBDA 1B2TA 1NBWA 3JAMc 3W5OA 2WV6D 2WB1B 4PG3A 5C4XB 3U9OA 1K0SA 4KN7C 5CV6A 1SE8A 1STEA 5CC4A 2LSSA 4C3IG 3VA5A 1EOVA 1IW7C 4DV7Q 1MHWC 3DXJC 4X3SA 4M8AA 3U58A 4LF7Q 2TMPA 3SR1A 3GTMB 2JJQA 1I4PA 1EU3A 2L9HA 2HQLA 1DXMA 1XTDA 3UDGA 4R4OA 1NE3A 4CDFC 4IFDH 2PW7A 3BU2A 3E0JA 2MJ8A 3CCQA 3M7NA 3H3VI 1EZ6A 2O5JC 2WIIB 4KY6A 3GTJH 4U68A 1H9MA 2LFNA 2ASBA 2K01A 3HOYH 3I4NB 1LTAD 3EFXD 3KBXA 1QB5D 3MXNB 2Z8LA 3I3CA 4C2MH 2NVTB 1WTRA 3VR4A 1HQMC 1HUNA 1RIPA 2XRSD 2YU9B 1I50B 4IJLA 3HKZG 1TVXA 4GN5A 3SVMA 2EYOA 3OW7A 3TZUA 1RJTA 2K28A 3OTOL 2R61A 5GQOA 1OXSC 4LFBL 5A35A 3D0FA 2F0OA 3OWEB 1JOQA 2VQFQ 1YNND 3GTMH 1O80A 2EYPA 4G57A 4L8JA 4IOAA 2FHTA 3ULLA 2B2VA 3MFYA 1EQTA 3PO2H 2VUMH 5M3FG 2QGQA 1HR0Q 2JA6G 2WAQE 5JJLA 2WB1G 5C4XG 1X9NA 3GTLH 2XWBB 4DK6C 3FVQA 4ZUJA 4LNQA 4IURA 3S16H 1K73C 4A3DB 3D8GA 1A3VA 2IT1A 2Q8RE 4ULLA 1XPOA 4V190 3HOUG 3HOWB 1EQRA 4QUCA 4HJ9A 3IRBA 2GA4B 2F1MA 3W1BA 3J81E 4DR3Q 1SFOB 1V1PB 5FKAC 1L1OB 3CQZB 1SNOA 1TWCB 4G7OC 2JA5B 1Q12A 3TP6A 1WYDA 3RMHA 5A2QL 3MXNA 4EVOA 2Z6KC 3J81i 2R93B 1TR5A 1C7YA 5IP9H 3MA2B 3K5MA 2B39A 4MNOA 3NK9A 4M1UB 5E4XA 5IYBH 2OXPA 3BJUA 2EYLA 1DGSA 3LGJA 3RZOH 2RCNA 1X3EA 4RMFA 4PMBA 2Q2UA 4JI7Q 2ZJPA 4JOIC 2SOBA 2UXBQ 1BXTA 1PV4A 3E9HA 4CGYB 3SEBA 1GKHA 2WB1E 4BBRG 1JICA 1YJ9A 1IBLQ 5M5YH 2RVLA 2B8GA 3E3XA 1XJVA 2F0SA 4GLAC 2RDHA 4HCSA 1PYBA 3CAMA 1TWGB 4JK1C 1CSPA 1Q1EA 1SLJA 4ME3A 5EGTA 4JI0L 1A3TA 4AYBG 1O7LA 3LWUA 2RHSB 3J7A5 3NP8A 4ILWA 1YNXA 3U50C 3D31A 1BBXC 3JAML 1KXLA 2XNAC 1Y8PB 2DJFC 2RA4A 2MO1A 2MHVA 4LFCL 4A3MH 1QVCA 1K9MC 3QWNA 1TWFB 4JC0A 5L37A 1E3PA 1E2VA 4BBRH 1A2TA 1FGUA 1ZYRD 4S3SA 1BNZA 2ZXPA 3AEVA 2NB0A 2BCOA 1WFQA 3FKIB 2CH4A 1NAPA 4KY7A 1JORA 1EWIA 1KDCA 2KVMA 1RCVD 3K7AB 1FD7D 2NN6I 1D5XC 4X3TA 5J1ZA 1VQNA 1LTGD 1KLGD 1LYLA 4A3GG 2FXQA 1E1OA 2JEAI 2K52A 1FL0A 2JXMB 4DR5L 1XNRQ 4YY3Q 1YJWA 1X3PA 4HSVA 4L5RC 3EN2A 1X32A 4N8X1 4RAUC 3CXCA 5LMNL 1GM5A 1DOMA 4A3KB 3BG3A 2B8FA 2F0IA 4PZ7A 3PQIA 3M9BA 4P2CB
chains in the Genus database with same CATH topology
1T5XD 1F9PA 1VF5C 1H9SA 1F2YA 2LKVA 3MXUA 5LHY1 2Z4HA 2L12A 3T51B 5BN5A 3D6CA 1G91A 4DGZA 1UUPA 1A3UA 3K6OA 3OPOA 4K8JA 3VR5A 3HP3A 2Q8IB 3PIP3 3CKIB 5C4ZA 4ZLTF 5CV9A 1STYA 2K5WA 4EQPA 1QILA 4EQOA 2EPBA 1OXUA 2SDFA 2A6HD 1I6HB 1RDPD 4FO2A 4NDXA 4F8MA 1BCPB 1EYCA 2B2UA 3DM1A 3ERQA 4DAPA 2Z1CA 3KBGA 4WRDA 2XIWA 3H3VC 3R93A 3RZOB 2F0EA 1D5MC 3VYUA 5JVH3 3R2TA 1EQVA 1PTOH 1F2LA 3A54A 1IW7D 1QOHA 4QB4A 3PUWA 1DONA 5ELEA 1KNAA 3H91A 2MPMA 5IGGA 4KKUA 5KYLA 4MHEA 3PO2B 4Z9CB 1RHPA 2F0QA 5FO7B 3IAYA 5I2XA 5ELDA 2WKDA 4I7ZC 4RCOA 3T53B 2B2YC 3NHHA 3HGBA 1DCZA 4ME5A 3T16A 1B53A 2EYFA 3EA6A 1MBYA 1U4LA 1Z47A 1EY4A 4XQNA 4LMQD 3HEJA 2R92B 4IUQA 5C3EB 4CBVA 1Y1WB 4H44C 3SK4A 1TWAB 1ENCA 5IIFA 1NUCA 3S1RB 2M00A 4RKLA 1JE4A 1HHVA 2LY7A 4X3KA 3ZYYX 4J1MA 1LV9A 1R9TB 2BOSA 2HDLA 5CV7A 1WVLA 4CKBA 1SNCA 4IUNA 1GOZA 1SNPA 2DY8A 2ZXRA 3SK6A 5C44B 1A6XA 1OO9B 1R4PB 5ELBA 2F0JA 1RD9D 4DK1A 3L7ZC 1ILQA 1UNSA 3J7YW 4RCNA 4EGVA 4Q0FA 3HOVB 4NKLA 3KLRA 3DEOA 1PFBA 5A2QE 1JOOA 3GD7A 3QOLA 5D14A 5HURA 4RFBA 5CGKA 4CHTB 4LJZC 1STAA 3CU7A 1AFPA 3FPPA 1GJXA 4OGQC 5IODA 1EY5A 5FLXE 1Z7TA 3SK5A 5LL6S 3GTPB 2IW3A 5EKIA 4ODGA 2EYJA 3A7AB 4K8IA 3OMCA 1SYEA 2YYZA 3KLSA 5K5PA 1BF4A 1I4RA 3GV3A 3HOXB 1K83B 2EY5A 1PTOB 1TKWB 3OSOA 4FF4A 3OOCA 3J80E 1ZYRC 2F4IA 3EQLC 1PRTD 1I4XA 1NR4A 2IL8A 3NE5B 4XDXA 5JPMC 4IUTA 5I6YA 3TBIB 4TSSA 2QILA 4WORA 2O2LD 2JA6B 3T4AC 4FF2A 4G4KA 2EY1A 5CMDA 5I2YA 1C8CA 3FMCA 4IN3A 4N9PA 1TY0A 2M2LA 2G9DA 1WTOA 4JBWA 5EPJA 1HCZA 4C3JB 1B4OA 1UAPA 1EWCA 2QDBA 2D2CC 4EQNA 2IPKD 3W3AA 1MD2D 2PW5A 3S14B 4DNTB 4F7XA 2V4DA 2Y0SB 1WTVA 1GXDC 1G2TA 4DA2A 4OIJA 1SYGA 1LLRD 2KOLA 4IUPA 4H7BA 2A68D 4HCEA 4ZK9B 4FXKC 5CV4A 1WTPA 3FEWX 3A55A 1EY0A 3J7AF 5C3WA 3K59A 4IUUA 1XWEA 2KHSA 2E2IB 2AWOA 1EY8A 1CQVA 1DOLA 3SE0A 1Y8OB 2CHBD 5FO8B 1SMYC 4RA8A 5KNDA 2EE1A 4FF1A 3RLFA 4H0LC 2HCIA 3S9WA 2E2JB 4K2LA 1A15A 3LWEA 2AWNA 1SE2A 3D3RA 3TP8A 1MGSA 1ESFA 3NQIA 3ND9A 3LNNA 1AEXA 1F77A 5CR3A 1FGBD 1B3AA 2RKSA 4KHZA 3VA7A 3TZDA 1U4RA 2A6EC 3DHQA 2PNRC 3HRZC 3GV6A 2AQ3B 3HOYB 5M5YB 3AB9A 1LACA 2TSSA 1LT3D 2E2DC 3K57A 2KECA 3L9AX 2R7ZB 3MTSA 5J22A 1M8AA 1SYCA 1SYDA 3GTLB 3M85A 4C3HG 4O42A 1JOKA 1C4QA 2H1EA 3UI2A 1EL0A 1WCMB 1CA5A 2CVRA 3MAQA 1J8IA 3LX0A 5C0XG 1ET6A 1NSNS 3I70A 3DEPA 2KCNA 4A3MB 2H4OA 3I8ZA 5C0XJ 1EEFD 4KHVA 3PUVA 2SNMA 4HAEA 2JEBI 1JWUD 2B2WC 2F0GA 1TY2A 5KYIA 1PTOC 3OIQA 1VCIA 2F0DA 4BBSB 3URYA 2XN9C 3FPUB 5CYUA 1LTRD 5KNBA 5M5XB 3HG9A 3ND8A 2AQ2B 3CHBD 1PTOF 1V1PA 3A56A 1DM0B 4BY1B 1MI2A 2EYMA 4I65A 4RHRA 5IGCA 4HEDA 1XTCD 3RD4A 1BCPC 3QIAA 2KJXA 3GTKB 2R3ZA 5FLXL 1PMRA 3WOEA 2NVXB 5DM73 5C3XA 2AUKA 1CZGA 3Q0AA 4PNYA 2QCPX 2IX0A 1FNWA 1FNVA 1K8MA 3BVGA 3M4OB 2JSOA 3V2TA 2O5IC 1LT4D 4MIUA 4IUVA 1G2SA 4PMCA 3PUZA 2B2TC 1D1IA 5LL6X 5D65A 1IYVA 1SYBA 4AYBB 1JB3A 4DAVA 4PQXA 2J4XA 2F0KA 1WTXA 5IGEA 3OIPA 2L5TA 1F2ZA 2K05A 1IYUA 3K5OA 2NWGA 4KN4C 1V8QA 4XQQA 4C3HB 1EOTA 3I72A 3BVMA 1TS5A 5EPKA 1EZ8A 1Y8NB 4GZYC 4OO1H 3C3LA 4B9XA 1IKMA 1B50A 4KI0A 4ZKCB 3GP7A 4F87A 5JVG3 1E2ZA 5EJWA 1I6VC 1L0XB 2EOTA 3D4RA 4FP5D 4C2MB 3OWFA 1CT1D 3I91A 4IFDI 1Q90A 4K5XA 1F9RA 2EJMA 3N52A 1HA5A 2IX3A 3S15B 2KEDA 4A3BB 4K2KA 2PZWA 5JEAG 4RH6A 1O7ZA 5CV5A 4V0BA 2X6LA 2ZXOA 3VR3A 2NTSA 3QG1A 1U4PA 1T5EA 2X6GA 2KEEA 3IL8A 3G7LA 2F0UA 5C0XH 3GTQB 5EPLA 1BDOA 1EY7A 3SK8A 1OXXK 2DNCA 1KAAA 1Q8IA 3ONAB 1TWHB 1XYIA 3S2DB 2J0TD 5KGUA 2E76C 1SBBB 1XXGA 2FMCA 2FFKB 1BOSA 4KV6A 2B63B 1KDAA 1GHKA 1CHPD 2A73B 1ENFA 1PFNA 1AP0A 2K1BA 2D5DA 1AZQA 1YNJC 4ZUIA 5I9OA 3P7JA 3IFTA 2NN6G 3W2DA 2L1BA 3T13A 3KF8A 1J9OA 5M5WB 4G7ZC 1F9SA 1F9QA 3F2UA 4E6IA 5FK9C 1HXYD 4A3IB 3QO2A 4FVMA 4BBRB 2SNSA 3NXWA 2NUCA 2EVBA 5IOCA 5JPNC 5JJZA 5NUCA 1QE6A 2M9VA 1JCKB 1EIHA 3E5SA 2N88A 4TRDA 2NYZD 1VF7A 1B1ZA 1QG7A 5CV8A 4OHJA 5DM63 2NBFA 4R9WA 3EVQA 3QOJA 2IJ0A 2L55A 5TSSA 1VDZA 1LABA 1EY6A 2F0VA 2HQEA 5IGFA 2FINB 2RSNA 3R8BA 3S2HB 1SYFA 1WTQA 5CBAE 4CKCA 2E74C 1CQFA 4C3JG 2F0HA 2Q8TA 2RDGA 3GTGB 4HN7A 4K6DA 1PZKD 2F0TA 5I6WA 1GUOA 3Q6SA 4TQUS 3I73A 3EJIA 5FOBB 1PTOD 2NN6H 3PUYA 5JAVA 5ELFA 1LO5D 4DXFA 1HTPA 1BUVT 4KK7A 2J7ZA 1SE3A 3V05A 2DN8A 1EEID 1GUNA 3S16B 4G7HC 1G8ZD 3X3MA 4MN3A 5C6AA 2VNUD 2JE6I 2EYHA 4KD4A 2A5HA 2FMMA 1SXTA 1KNEA 2EY2A 5DNFA 4KMUC 1JR0D 2NVYB 3D4WA 1ZKOA 2PMZB 2MP1A 1HFGA 4XXEA 4OO1G 2WINB 3RZDB 5J39A 2BDOA 4HR7B 2BE5D 5T1IA 2MGSA 3BYYB 2WP8J 4BY7B 3A8KE 4CJ1B 1TS3A 4Q5VA 1RTNA 4N9TA 2QKIC 1SMYD 1NR2A 1RTOA 2X69A 1O78A 4C56C 1CZWA 3FRPB 2IX1A 3PIO3 3BZDB 2XSCA 4HTHA 1I3QB 2F0WA 2DNEA 4IALA 3J81L 1LTBD 5IT9E 2ZT9C 3IKJA 4HMJA 5D3DA 3BDOA 1Y1VB 5IT9L 1DOKA 1PLFA 2ICIA 1EIGA 5EBCA 4FNFA 2CW0C 4OIKA 4C1NI 1EU4A 1F2MA 3OMGA 2JA7B 5JEAJ 1SE4A 3WOFA 5G3LF 3WDNA 1ESRA 3KUPA 1W6JA 4K5VA 2EJFC 1QNKA 4KD3A 2A69C 3AMUA 2K5QA 2PPBC 4A93B 4X3UA 4J8QA 4A3GB 3A8IE 1GUGA 2SEBD 3I4MB 5E3FA 2JA8B 5AFWA 1RODA 4B9WA 3Q22A 1ILPA 1EY9A 3BDCA 3MZ5A 2PCFB 3H94A 3TDQA 2F3VA 2LS01 3NWSA 3R3OA 1B9MA 3VYTA 3DUZA 3JAME 1QCBD 1UEAB 3PMFA 1SSOA 3K0YA 4XT3B 1Q3LA 2OEOA 3MXPA 1PDQA 4DN4M 5KNCA 2WAQB 1ML0D 3D4DA 3PO3B 1BCPD 3K58A 2BDNA 1GUSA 1OXVA 1S5DD 5I4DA 2NVQB 1LTTD 1IHZA 1JQYD 4CJ2C 1JWMD 3QB3A 3FDTA 1CA6A 1PRTF 2WACA 2KUMA 2LMCB 3DWAA 3MWYW 3J7AV 1CTMA 2L11A 3I90A 1R4QB 1O7YA 2B2VC 1A2UA 1ICWA 2CQAA 1WD1A 4PMWA 4ABNA 1CM9A 1PZJD 1RKNA 2AUJD 4A3EB 1LTSD 3Q24A 4K14A 1BQQT 2PZUA 1U4MA 2OF1A 3G6JB 2AQ1B 4RHSA 1B44D 4F88A 4DU9A 1E0BA 1STBA 3TP7A 2HDMA 3NBHA 3BDLA 3VYSA 4TKOB 3MHBA 3DMUA 2I46A 2PQEA 2RQXA 5K36H 1PFMA 2EJGC 3S1MB 1IKLA 4DF7A 1L0YB 3MFGA 2QEJC 4RWSC 2K6AA 3EROA 3MXGA 3N6RA 5M3FB 1OXTA 1AN8A 2MUYA 2N55A 1G6ZA 1STHA 1WD0A 1I4GA 1I4QA 4R8IA 3K5NA 3TN2A 3H6MA 4HMIA 5M3MB 5C4JB 1V1OA 1BO0A 5E4WC 3M3YB 5ELCA 2D9UA 3PUXA 4BWGB 2ID0A 1H9KA 4LAAA 4XYQA 3AU7A 1H9JA 2B2WA 1PRTB 3CRLC 3C1EA 4FF3A 1B9NA 4QIWB 2F3WA 5DAUA 2NZ1D 1PXUA 1NCVA 3H09A 2BE5C 2OT2A 2XRQD 3HKZB 4IQZA 4R8NA 2VB2X 3MVVA 4ZKBB 4NMZA 2JP1A 5I9PA 1TT2A 3VR2A 4CJ0B 1SNQA 1HQRD 4KTAA 2XVSA 1LT6D 5BN3A 2K33A 1BCPF 1KLUD 1SDFA 3MEHA 2BA0A 2BA1A 2K03A 1BR9A 2C5CA 5ISRA 4OL7A 1HPCA 4RGTA 4WFN3 1TS4A 2B2TA 4L63B 1X3QA 3DWQA 1IL8A 2E75C 5KRUA 2K7VA 1MSHA 3K5LA 2PZTA 1V43A 1H9RA 3A8JE 2A69D 4DK0A 3O13A 2F0NA 3I4LA 1LTID 1GUWA 1TQOA 4KKTA 1CFMA 4RGMA 5COYA 2NTTA 3E6ZX 2EZVA 1SEBD 3SDZA 2ICEC 4HSPA 5C4HA 3NPPA 2PO4A 3BVZA 2RSOA 2B2UC 3KLSX 4QUFA 4A3JB 4O1NA 3KK7A 1YNJD 3NTHA 1G291 1KABA 4LK1C 4Y7NB 4UDUC 2A74C 3NWTA 1Q1BA 4KKSA 4RKBA 4XIGS 2VUMB 4BA2I 4IZ8A 5IGBA 4DAYA 3S17B 2RDFA 1S5BD 1CHQD 2L4NA 2C9OA 4DXGA 2B2YA 3GQBA 1SJHD 2A6HC 4XTCS 5T1GA 5EQ0A 1II3A 2QF7A 1VMPA 4QMGA 3GTJB 5KEEA 1SNDA 1HA6A 3H0GB 4L6TB 1DD2A 1ET9A 5EKLA 3D6WA 1Y69U 2HUGA 4XYOA 3GO5A 3OHXC 3RUZA 3P1HA 4QF4A 1D2BA 2O4XA 4U673 1HRJA 4QCLA 1D1KA 4BS9A 4UAIA 2CW0D 2HCCA 1STGA 5FO9B 1Z6HA 1GHJA 5JOBA 4KJOA 1TS2A 1U9RA 3PV0A 1YNNC 3GTOB 2VXWA 3DWPA 3Q23A 4KJNA 2VB3X 1E2WA 3SHLA 1S5ED 4K5WA 5CBEE 5DEHA 3M4YA 3NBIA 3TP5A 1FNUA 3M7GA 1D5ZC 1ZXTA 4C3IB 4WJWA 1STNA 3A7LA 2F0PA 1HUMA 4B08A 1AW7A 2KCCA 2PYKA 4KY5A 4YIJA 3R2IA 1QWYA 2KA7A 3NQTA 1DZ1A 3HOZB 1SNMA 1GUTA 4DNRB 3NTIA 1S5FD 5C0XI 3QJYA 1PZID 1XX8A 3MC0B 3P20A 3T56B 2DY7A 2K04A 3S1NB 4XQJA 1ONLA 4NW2A 3C2PA 1PYWD 1DJRD 3VR6A 2D62A 3C46A 3NTKA 4A3FB 1H9SB 2FJ2A 2E2HB 1AZPA 5HGTA 4IFDG 3CRKC 4XT1B 2F03A 5G3LD 5E1FA 4IFDJ 4FXGC 5C5LA 1JC7A 4CKEA 1MSGA 3P75A 1QNUA 2RBMA 3TMEA 4DFAA 1WTWA 2IWHA 3U9SA 3BYTB 1I4HA 3J80L 3L3OC 1HFNA 3VYRA 3HOUB 2JYOA 1LT5D 2A6ED 3ITPA 5JEAH 4H13C 1ZEQX 3S1QB 5BN4A 3NSWA 4ID6A 1EFID 1M4VA 3X3NA 3HS0C 1ENAA 2L0CA 1JWSD 5CORA 5KIXA 5EKKA 4J6HA 1PRTC 1FR3A 5IGDA 2R6GA 1DYQA 4BA1I 1QJOA 5M9OA 1RF2D 1EWHA 3HZXA 2F0MA 2WKCA 1HTLD 4C1NK 1S5CD 3NUCA 2Z4IA 4OO1I 2K5DA 2EY6A 4ZQ3A 5C5MA 2F0FA 2I07B 3IFDA 1SAPA 4ZRZA 1EYDA 1FYCA 1S4ZA 4PV1C 1W6KA 4FYDA 5D3IB 1D6EC 3SXHA 1C48A 2ENBA 5F2DA 4RGOS 4FXDA 3V96A 1CK1A 1CI3M 4ZYSA 2XWJB 2F0LA 1K8OA 4RGNA 2K32A 1SJED 3C1FA 3BS1A 1EYAA 2KQ3A 4K6LA 3TSSA 5K36G 1VMCA 2G9HD 2EDGA 2EXZA 1KTKA 4NP5A 4ZAIA 1TIID 1KDBA 1TU2B 2A68C 5EBDA 1B2TA 2WV6D 2WB1B 5C4XB 3U9OA 4KN7C 5CV6A 1STEA 5CC4A 4C3IG 3VA5A 1IW7C 3DXJC 4X3SA 4M8AA 3GTMB 2TMPA 3SR1A 1I4PA 1EU3A 2L9HA 1DXMA 4IFDH 2PW7A 3E0JA 2MJ8A 3M7NA 1EZ6A 2O5JC 2WIIB 4KY6A 4U68A 1H9MA 2LFNA 2K01A 3I4NB 1LTAD 3EFXD 3KBXA 1QB5D 2Z8LA 3I3CA 2NVTB 1WTRA 3VR4A 1HQMC 1HUNA 2XRSD 2YU9B 1I50B 1TVXA 3SVMA 2EYOA 3OW7A 3TZUA 1RJTA 2K28A 2R61A 1OXSC 5A35A 2F0OA 3OWEB 1JOQA 1YNND 1O80A 2EYPA 4G57A 4L8JA 2FHTA 2B2VA 3MFYA 1EQTA 2XWBB 3FVQA 4ZUJA 4IURA 4A3DB 3D8GA 1A3VA 2IT1A 2Q8RE 4ULLA 4V190 3HOWB 4QUCA 2GA4B 2F1MA 3J81E 1SFOB 1V1PB 5FKAC 3CQZB 1SNOA 1TWCB 4G7OC 2JA5B 1Q12A 3TP6A 3RMHA 5A2QL 3MXNA 4EVOA 2R93B 1TR5A 3MA2B 3K5MA 2B39A 3NK9A 4M1UB 5E4XA 2OXPA 2EYLA 4PMBA 2SOBA 1BXTA 4CGYB 3SEBA 1JICA 2RVLA 2B8GA 2F0SA 2RDHA 4HCSA 1TWGB 4JK1C 1Q1EA 5EGTA 1A3TA 1O7LA 3LWUA 3NP8A 4ILWA 3D31A 1BBXC 3JAML 2XNAC 1Y8PB 2RA4A 2MHVA 3QWNA 1TWFB 1E2VA 1A2TA 1BNZA 1ZYRD 4S3SA 2ZXPA 2NB0A 2BCOA 3FKIB 1NAPA 4KY7A 1JORA 1KDCA 2KVMA 1RCVD 3K7AB 1FD7D 2NN6I 1D5XC 4X3TA 5J1ZA 1LTGD 1KLGD 2JEAI 2JXMB 1X3PA 4HSVA 1X32A 4RAUC 1DOMA 4A3KB 3BG3A 2B8FA 2F0IA 4P2CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUG A;  1Z7T A;  4KI0 A;  1E2W A;  2JEB I;  4BA2 I;  2A68 D;  1VF5 C;  5BN4 A;  1H9S A;  2JE6 I;  2AUJ D;  3M4Y A;  3MXU A;  1IW7 C;  4KMU C;  3VR2 A;  1E2Z A;  1VCI A;  1I6V C;  3T51 B;  3DXJ C;  2EVB A;  1ZKO A;  3D4R A;  5BN5 A;  3A7A B;  4H44 C;  2AWO A;  2YYZ A;  1DXM A;  5KNB A;  4OO1 G;  5BN3 A;  2K33 A;  1Q90 A;  2PCF B;  4IFD H;  3H94 A;  3SE0 A;  1Y8O B;  3A7L A;  1FR3 A;  2EJM A;  2BDO A;  1TKW B;  3ND8 A;  4HR7 B;  3M7N A;  3OPO A;  2O5J C;  3OOC A;  1SMY C;  2BA0 A;  2R6G A;  3VR5 A;  2Q8I B;  2BE5 D;  2BA1 A;  1ZYR C;  1QJO A;  4TKO B;  4BA1 I;  1H9M A;  1B9M A;  2KCC A;  5KND A;  1VF7 A;  3EQL C;  5JEA G;  3GQB A;  5K36 H;  1EWH A;  2KA7 A;  3A8K E;  3RLF A;  2A6H C;  4H0L C;  2B8G A;  4XTC S;  2EJG C;  3NE5 B;  1GUT A;  4DNR B;  4JK1 C;  1HPC A;  1Q1E A;  3QIA A;  3VR4 A;  1HQM C;  3VR3 A;  1OXU A;  3QG1 A;  2QF7 A;  2A6H D;  1T5E A;  1O78 A;  5KNC A;  1VDZ A;  3N6R A;  3QJY A;  1LAB A;  2E75 C;  1O7L A;  3ND9 A;  3LWU A;  4KN7 C;  1PMR A;  3LNN A;  2K7V A;  3OW7 A;  3TZU A;  5C0X H;  3P20 A;  3T56 B;  1FYC A;  1BDO A;  1V43 A;  1OXX K;  2DNC A;  1H9R A;  3D31 A;  1OXT A;  3A8J E;  4PV1 C;  2AUK A;  1Y8P B;  1OXS C;  1A6X A;  4KHZ A;  1DD2 A;  4KN4 C;  2A69 D;  3VA7 A;  2DNE A;  5A35 A;  1ONL A;  2E76 C;  1Y69 U;  2E74 C;  2A6E C;  2PNR C;  1GUS A;  3VR6 A;  4DK0 A;  1OXV A;  2D62 A;  4DK1 A;  2ZT9 C;  3IKJ A;  3L7Z C;  1K8M A;  3FMC A;  3I4L A;  3BDO A;  4L8J A;  1E2V A;  1H9S B;  3AB9 A;  1LAC A;  2O5I C;  2CW0 C;  1CFM A;  3MFY A;  4KKT A;  3PUX A;  1GHK A;  1CI3 M;  4IFD G;  3CRK C;  1GUO A;  4RCN A;  4TQU S;  1H9K A;  3SDZ A;  3PUZ A;  1IW7 D;  3I73 A;  1K8O A;  2NN6 H;  1IYV A;  1H9J A;  3PUW A;  4JBW A;  3PUY A;  2K32 A;  2D5D A;  1HCZ A;  3CRL C;  3KLR A;  2NN6 I;  1YNJ C;  1B9N A;  2D2C C;  3IFT A;  2IT1 A;  1HTP A;  2NN6 G;  3W3A A;  4KKU A;  3WDN A;  3M85 A;  3GD7 A;  2L5T A;  4DNT B;  2V4D A;  5K36 G;  2LMC B;  2JEA I;  2EJF C;  2JXM B;  4LJZ C;  3U9S A;  1IYU A;  2F1M A;  1G29 1;  1CTM A;  1V8Q A;  1Z6H A;  1GHJ A;  2BE5 C;  2A69 C;  2DN8 A;  2EDG A;  3I72 A;  4I7Z C;  4LK1 C;  3T53 B;  3PV0 A;  1GUN A;  2PPB C;  4G7O C;  3HGB A;  5C0X G;  3BG3 A;  4G7Z C;  1TU2 B;  2A68 C;  1Q12 A;  1YNN C;  3FPP A;  1Q1B A;  4G7H C;  1GJX A;  1Y8N B;  2B8F A;  4KKS A;  4OO1 H;  1DCZ A;  4GZY C;  2A6E D;  4OGQ C;  3PUV A;  4XIG S;  5JEA H;  4H13 C;  4IQZ A;  3A8I E; 
#chains in the Genus database with same CATH topology
 2VQF L;  1T5X D;  3CF5 A;  4A3D G;  1F9P A;  1VF5 C;  4IPD A;  2B63 H;  1H9S A;  4NXN Q;  1L1O C;  1F2Y A;  1KQS A;  2LKV A;  2LXK A;  3MXU A;  2Z4H A;  5LHY 1;  4DV0 Q;  2L12 A;  5IP7 G;  3T51 B;  5BN5 A;  3D6C A;  3UDF A;  1PH7 A;  2E2J H;  1G91 A;  3S1N H;  3M4Q A;  4DGZ A;  1YZ6 A;  1UUP A;  3KDF B;  3T1H L;  3AFP A;  1A3U A;  3K6O A;  3OPO A;  4K8J A;  2K14 A;  3VR5 A;  3HP3 A;  2Q8I B;  3PIP 3;  3CKI B;  1U0L A;  4UHV A;  5C4Z A;  4ZLT F;  4YHH L;  5CV9 A;  1STY A;  2K5W A;  4LF7 L;  4EQP A;  2K4K A;  1QIL A;  1MKH A;  1VQO A;  4EQO A;  2EPB A;  1L0W A;  1OXU A;  2SDF A;  2A6H D;  1I6H B;  1UE6 A;  4IPC A;  1RDP D;  4FO2 A;  4NDX A;  4F8M A;  1BCP B;  1EYC A;  2B2U A;  3DM1 A;  4IPG A;  5JJK A;  3ERQ A;  3F1Z A;  4DAP A;  1AE2 A;  3JC6 6;  2Z1C A;  3KBG A;  4JPB W;  4WRD A;  2XIW A;  3H3V C;  2F3I A;  1B7Y B;  3R93 A;  2CWP A;  3RZO B;  2F0E A;  4KHP Q;  1D5M C;  3VYU A;  4NPS A;  5IWA Q;  5JVH 3;  3R2T A;  1EQV A;  4R4C A;  4NXM Q;  1PTO H;  1F2L A;  1EYG A;  2ZM6 Q;  3A54 A;  1IW7 D;  1QOH A;  4QB4 A;  3MEF A;  3PUW A;  4A93 H;  1DON A;  5ELE A;  1KNA A;  3H91 A;  1X3F A;  3GTO H;  2MPM A;  5IGG A;  4KKU A;  1KL9 A;  5KYL A;  4MHE A;  3PO2 B;  4Z9C B;  1RHP A;  2F0Q A;  5FO7 B;  1SFO H;  3IAY A;  3GTP H;  4GOP C;  5I2X A;  5ELD A;  2WKD A;  4I7Z C;  2OWO A;  2LXJ A;  3HOW H;  4A3L G;  4RCO A;  3T53 B;  1Q7Y C;  2B2Y C;  4DV4 L;  5C4X H;  1V9P A;  3NHH A;  3HGB A;  4O0A A;  1ASY A;  1J5E Q;  3S24 A;  1DCZ A;  4ME5 A;  4A3J G;  3T16 A;  1B53 A;  2B63 G;  2EYF A;  3EA6 A;  2ALY B;  1MBY A;  1U4L A;  1Z47 A;  1EY4 A;  4XQN A;  4LMQ D;  3HEJ A;  1K8G A;  2R92 B;  4IUQ A;  2Y0S E;  4JG2 A;  1PH8 A;  5C3E B;  4CBV A;  4H44 C;  1Y1W B;  1KIX A;  3SK4 A;  1FVI A;  4POF A;  1TWA B;  1ENC A;  5IIF A;  4J15 A;  4I7A A;  3CCJ A;  3G6E A;  1NUC A;  3S1R B;  4JBK A;  2M00 A;  1W2B A;  4RKL A;  4DR6 L;  1JE4 A;  1PVO A;  1HHV A;  2LY7 A;  1NTG A;  4X3K A;  3ZYY X;  4J1M A;  2YU9 H;  1LV9 A;  1R9T B;  2BOS A;  2HDL A;  5CV7 A;  1EUJ A;  1WVL A;  4B3T Q;  4CKB A;  4GKJ L;  1SNC A;  4IUN A;  4JI1 Q;  2ZTC A;  4KHP L;  2GVA A;  4B3R L;  2XGT A;  1E7Z A;  1GOZ A;  1SNP A;  4DUZ Q;  2DY8 A;  2ZXR A;  3SK6 A;  3RZD H;  4UY8 C;  5C44 B;  1A6X A;  2HHH L;  3HKS A;  3TS0 A;  1E22 A;  1OO9 B;  4X62 Q;  1R4P B;  5ELB A;  4DKA C;  2F0J A;  4EX5 A;  2CKZ B;  1RD9 D;  4DK1 A;  3L7Z C;  3TRE A;  4BY1 H;  2JA7 G;  5FLM H;  3K81 C;  1CKN A;  4JVZ A;  3PF4 A;  1ILQ A;  1VQ8 A;  1UNS A;  3J7Y W;  1PFS A;  4RCN A;  4EGV A;  4Q0F A;  3HOV B;  1Y1V G;  4JI4 L;  4NKL A;  3KLR A;  2PQA B;  2E8G A;  4DUY L;  1HNW Q;  3DEO A;  1PFB A;  1XPR A;  1SN8 A;  2MFI A;  5A2Q E;  4BBS H;  1PYS B;  1I5F A;  1JOO A;  3GD7 A;  3QOL A;  5D14 A;  5HUR A;  4RFB A;  5CGK A;  4CHT B;  2CCZ A;  4P72 A;  4LJZ C;  1STA A;  4DK3 C;  3CU7 A;  4A3J H;  1AFP A;  3CPF A;  3FPP A;  1GJX A;  2R7F A;  4OGQ C;  5C44 H;  4DV6 L;  5IOD A;  2VL6 A;  1EY5 A;  2NVX H;  5FLX E;  3DLL A;  1Z7T A;  4DR4 L;  3SK5 A;  5LL6 S;  3GTP B;  1QZH A;  3CD6 A;  3UDX A;  4DV1 L;  2IW3 A;  1XNQ Q;  1B3Q A;  5EKI A;  2ZTE A;  4ODG A;  1MJE A;  2EYJ A;  3A7A B;  2N49 A;  4K8I A;  3OMC A;  1R9T H;  3GDE A;  1SYE A;  2YYZ A;  3KLS A;  5K5P A;  5LMN W;  1I4R A;  1BF4 A;  3GV3 A;  3HOX B;  1K83 B;  2K5H A;  2KHI A;  4GLX A;  2EY5 A;  1QZG A;  1PTO B;  1TKW B;  3OSO A;  1ASZ A;  4FF4 A;  3OOC A;  3CCV A;  3J80 E;  1ZYR C;  2F4I A;  3EQL C;  1QVG A;  1PRT D;  1I4X A;  3ERS X;  1NR4 A;  2IL8 A;  3NE5 B;  4XDX A;  5JPM C;  4GNX B;  4IUT A;  5I6Y A;  4JV5 L;  3F8T A;  2OTL A;  3TBI B;  4TSS A;  3HOV G;  4EQ5 A;  3HOZ G;  2QIL A;  1U5K A;  3RR5 A;  1YHB A;  4WOR A;  4UPA A;  2O2L D;  4DV7 L;  5FLM G;  4DV5 Q;  2JA6 B;  3T4A C;  4FF2 A;  4G4K A;  4A3K H;  2NVY H;  2EY1 A;  5CMD A;  5I2Y A;  1C8C A;  3FMC A;  4IN3 A;  4N9P A;  3CCM A;  1TY0 A;  4JI2 Q;  1K3R A;  1YVC A;  2OCE A;  4A3I H;  2PI2 A;  4WJ3 M;  2M2L A;  3I55 A;  2G9D A;  1WTO A;  1NMG A;  1YI2 A;  1IBM L;  4C3I H;  1HJP A;  2WAQ G;  4JBW A;  5EPJ A;  1HCZ A;  4C3J B;  1B4O A;  1UAP A;  1EWC A;  2QDB A;  3K7A H;  2D2C C;  4FDB A;  4EQN A;  2IPK D;  3W3A A;  1MD2 D;  2PW5 A;  3S14 B;  4DNT B;  4F7X A;  2V4D A;  2Y0S B;  1WTV A;  1GXD C;  4A3F H;  1G2T A;  2UUB Q;  2ATW A;  3NBH B;  2B3G A;  1QUQ A;  4DA2 A;  4MZ9 A;  4OIJ A;  1SYG A;  4DV3 L;  3A5Z B;  1LLR D;  3CP0 A;  1PH9 A;  2KOL A;  3CQZ H;  1HR0 L;  4IUP A;  4H7B A;  3J81 c;  2A68 D;  4HCE A;  4ZK9 B;  1VQ5 A;  4FXK C;  5CV4 A;  4GNX C;  1N33 L;  3M3Y H;  1PH2 A;  3S14 H;  1N34 Q;  1WTP A;  3FEW X;  3A55 A;  1EY0 A;  4QJF A;  3J7Z C;  2P5Z X;  3J7A F;  5C3W A;  3K59 A;  4GOP B;  4IUU A;  1XWE A;  2KHS A;  2E2I B;  2AWO A;  1EY8 A;  1CQV A;  1DOL A;  1TWH H;  3SGI A;  3SE0 A;  4OWT B;  1QVF A;  1Y8O B;  2Z9H A;  1N36 L;  1PH6 A;  2CHB D;  5FO8 B;  1MIU A;  1SMY C;  4RA8 A;  5KND A;  2EE1 A;  4FF1 A;  3RLF A;  1XMQ L;  4H0L C;  4DAM A;  2HCI A;  3S9W A;  1JB7 A;  2E2J B;  4K2L A;  3BZK A;  1A15 A;  3LWE A;  2AWN A;  3D3R A;  1SE2 A;  3TP8 A;  1MGS A;  1ESF A;  3A5U A;  1X6O A;  4DR1 Q;  3H0G H;  3NQI A;  2VQE L;  3ND9 A;  3LNN A;  1AEX A;  2R93 H;  3I4O A;  1F77 A;  1EFW A;  5CR3 A;  1K83 H;  1FGB D;  1B3A A;  2RKS A;  4KHZ A;  3VA7 A;  2NVT H;  3TZD A;  1U4R A;  2A6E C;  4R4Q A;  3DHQ A;  1TWC H;  2PNR C;  5IWA L;  3HRZ C;  3HOY G;  3GV6 A;  2AQ3 B;  3HOY B;  1K3B C;  4UP8 A;  2UXB L;  5M5Y B;  3AB9 A;  1LAC A;  2BH2 A;  2TSS A;  1LT3 D;  4DR7 L;  2E2D C;  3K57 A;  2KEC A;  2YTY A;  4JI0 Q;  5IP9 G;  2KEN A;  5FJ8 G;  4DV3 Q;  3L9A X;  4LF5 L;  2R7Z B;  5M5W H;  3VDY A;  3MTS A;  5J22 A;  1M8A A;  1SYC A;  1SYD A;  3GTL B;  1KAW A;  2YTX A;  3M85 A;  2ZJR A;  4C3H G;  1E24 A;  1FJG Q;  3ICE A;  4A76 A;  4O42 A;  1JOK A;  3PO3 G;  1C4Q A;  2A1A A;  1HZ9 A;  2H1E A;  2UUC L;  1FJG L;  3UI2 A;  4BY7 G;  1EL0 A;  1WCM B;  1CA5 A;  1K0R A;  2CVR A;  3MAQ A;  1J8I A;  3LX0 A;  3F2B A;  5C0X G;  1YIJ A;  1ET6 A;  1NSN S;  4DR3 L;  3I70 A;  3DEP A;  2KCN A;  4A3M B;  2H4O A;  3I8Z A;  5C0X J;  1EEF D;  2WFW A;  3PUV A;  4KHV A;  2SNM A;  4HAE A;  4POG A;  3AQQ A;  4LF8 Q;  2JEB I;  4AYB E;  1JWU D;  2B2W C;  3AYH B;  2MNA A;  2F0G A;  1TY2 A;  2I5H A;  3HFZ B;  5KYI A;  1PTO C;  3OIQ A;  1Q82 C;  1I50 H;  1VCI A;  2F0D A;  1XMQ Q;  4BBS B;  1B8A A;  3URY A;  2XN9 C;  2VZA A;  3FPU B;  5CYU A;  1LTR D;  3T1Y Q;  5KNB A;  2B29 A;  5M5X B;  4DV2 Q;  5C3E G;  4MTK A;  4KLK A;  3HG9 A;  3ND8 A;  2AQ2 B;  2ZM6 L;  3CHB D;  1PTO F;  1V1P A;  3A56 A;  4ZCK A;  1DM0 B;  4GN3 B;  4BY1 B;  4H02 A;  1MI2 A;  2EYM A;  4I65 A;  2UUB L;  4RHR A;  5IGC A;  4HED A;  3E0E A;  1XTC D;  3RD4 A;  1BCP C;  3QIA A;  4HJ8 A;  2KJX A;  3GTK B;  2R3Z A;  5FLX L;  1PMR A;  3S15 H;  2UUA L;  2NZH A;  3WOE A;  4DR2 Q;  2NVX B;  5DM7 3;  5C3X A;  2AUK A;  4CDC C;  1CZG A;  3Q0A A;  4PNY A;  1AH9 A;  2D0O A;  2QCP X;  2EIF A;  5HY6 A;  3T1H Q;  4B3M L;  2IX0 A;  4WJ4 A;  4OEL B;  1FNW A;  3UDI A;  4PZ8 A;  5C3E H;  1FNV A;  1K8M A;  3BVG A;  4DV4 Q;  3M4O B;  2JSO A;  1JJC B;  2EXD A;  3V2T A;  2O5I C;  1LT4 D;  4MIU A;  4IUV A;  5FLX c;  1G2S A;  4PMC A;  3PUZ A;  2B2T C;  1D1I A;  4DAY B;  5LL6 X;  5D65 A;  1IYV A;  1SYB A;  2PNH A;  4AYB B;  1JB3 A;  1VQA A;  4DAV A;  4PQX A;  1Y1W H;  2J4X A;  2F0K A;  1WTX A;  5IGE A;  1CUK A;  4P73 A;  4Y7N H;  2F4V L;  3OIP A;  2L5T A;  1F2Z A;  2K05 A;  1HNZ Q;  2RCF A;  1IYU A;  3K5O A;  2VQE Q;  3HOW G;  4A3L H;  2NWG A;  4KN4 C;  1V8Q A;  4YCU A;  4XQQ A;  4DV2 L;  4C3H B;  1EOT A;  3I72 A;  3BVM A;  1TS5 A;  5EPK A;  2Q2H A;  2R7Z H;  1EZ8 A;  4B3T L;  1Y8N B;  4GZY C;  4OO1 H;  3C3L A;  4B9X A;  3NEN A;  3ER0 A;  4AH6 A;  1IKM A;  1B50 A;  4KI0 A;  1VQH A;  4ZKC B;  3GP7 A;  4F87 A;  2AHO B;  5JVG 3;  2HHH Q;  1E2Z A;  5EJW A;  1I6V C;  1L0X B;  2EOT A;  3D4R A;  5J3B A;  4FP5 D;  4C2M B;  3RN5 A;  3OWF A;  1CT1 D;  3I91 A;  4IFD I;  3I4N H;  3KOJ A;  1Q90 A;  4K5X A;  1F9R A;  4K0K L;  2EJM A;  3N52 A;  1HA5 A;  2IX3 A;  3S15 B;  2KED A;  4A3B B;  4GLV B;  4K2K A;  4IOC A;  4JI5 Q;  2PZW A;  1ICF B;  5JEA G;  3CCS A;  3RN2 A;  4A93 G;  4RH6 A;  1O7Z A;  2IHF A;  1Q8K A;  5CV5 A;  1G6P A;  4V0B A;  2X6L A;  2ZXO A;  4QY7 A;  4AIM A;  3VR3 A;  2NTS A;  3QG1 A;  1I94 L;  2HT1 A;  4BY7 H;  1U4P A;  3CMA A;  1T5E A;  2X6G A;  2KEE A;  3IL8 A;  3G7L A;  2F0U A;  5C0X H;  3GTQ B;  5EPL A;  1BDO A;  1EY7 A;  3SK8 A;  1OXX K;  2DNC A;  3J81 j;  4DV5 L;  1KAA A;  3ONA B;  1Q8I A;  4JI8 L;  1TWH B;  3K8A A;  2QEX A;  1XYI A;  3S2D B;  2J0T D;  4DV6 Q;  5KGU A;  2E76 C;  1SBB B;  1XXG A;  1JJ2 A;  4JI2 L;  2FMC A;  5BR8 L;  2FFK B;  1BOS A;  4KV6 A;  2CFM A;  2CQO A;  3J80 i;  2B63 B;  1KDA A;  1TXY A;  1GHK A;  2R93 G;  1CHP D;  2A73 B;  1J6Q A;  2ZJQ A;  1ENF A;  3KFU A;  1PFN A;  1AP0 A;  2K1B A;  3AFQ A;  1L1O A;  2D5D A;  2OQ0 A;  1AZQ A;  4B3R Q;  1YNJ C;  4ZUI A;  5I9O A;  3P7J A;  3IFT A;  2NN6 G;  1P16 A;  3RNU A;  3PF5 A;  1UE5 A;  4X62 L;  2GVB A;  3W2D A;  4X66 Q;  2L1B A;  3T13 A;  3KF8 A;  1J9O A;  5M5W B;  1A62 A;  1F9S A;  4G7Z C;  1F9Q A;  3HOU H;  3F2U A;  2AKW B;  4IO9 A;  4E6I A;  5FK9 C;  4UP7 A;  1VQF A;  1JMC A;  3FKI H;  3UE0 A;  4A75 A;  1HXY D;  4A3I B;  1N33 Q;  3A0J A;  3QO2 A;  1UEB A;  2OQK A;  4FVM A;  4GKK L;  2QA4 A;  4BBR B;  2SNS A;  4JI3 L;  3NXW A;  3RLO A;  2NUC A;  2EVB A;  1PH3 A;  5IOC A;  2QDL A;  3A74 A;  5JPN C;  1IL2 A;  4GN4 B;  2JA8 G;  5JJZ A;  3S2H H;  5NUC A;  1QE6 A;  2M9V A;  4RG1 A;  5IYD G;  1JCK B;  1EIH A;  3FP9 A;  3E5S A;  2N88 A;  4TRD A;  3GTQ H;  2NYZ D;  1VF7 A;  2G5D A;  1B1Z A;  1QG7 A;  5CV8 A;  4OHJ A;  1TWF H;  5DM6 3;  2C35 B;  2NBF A;  4LWC A;  3EVQ A;  4R9W A;  3QOJ A;  2E5L L;  5IY0 A;  3J80 c;  5JJI A;  2IJ0 A;  2L55 A;  5TSS A;  1CKO A;  1VDZ A;  4A3E H;  1LAB A;  4QL5 A;  4L5S A;  1EY6 A;  1LUZ A;  2F0V A;  2HQE A;  5IGF A;  1Q81 C;  4B3S Q;  2FIN B;  2RSN A;  3HOX H;  3CC7 A;  3R8B A;  3S2H B;  1SYF A;  1WTQ A;  2KBN A;  5CBA E;  4GOP A;  1TWG H;  2E74 C;  4CKC A;  1GO3 E;  1CQF A;  4C3J G;  2F0H A;  2Q8T A;  2HD3 A;  2RDG A;  3GTG B;  4YCV A;  4HN7 A;  4K6D A;  1KHI A;  1NMF A;  3PIP A;  1PZK D;  2F0T A;  1PH5 A;  5I6W A;  1HNX L;  1HH2 P;  1PH1 A;  1GUO A;  3Q6S A;  1A0I A;  4TQU S;  3I73 A;  3EJI A;  5FOB B;  1PTO D;  2NN6 H;  3PUY A;  5E7N A;  5JAV A;  4GKK Q;  3I4M G;  1EIY B;  5ELF A;  3G71 A;  1LO5 D;  1N34 L;  4DXF A;  1HTP A;  2N78 A;  3F2C A;  4X64 L;  4JI6 L;  1HZC A;  1BUV T;  3W1G A;  4KK7 A;  1VQP A;  2J7Z A;  1SE3 A;  1BBW A;  4X64 Q;  3V05 A;  4JI6 Q;  2N3S A;  2DN8 A;  2I0Q A;  1EEI D;  1GUN A;  1VS0 A;  1X3G A;  3I2Z A;  3K80 C;  4C3J H;  4G7H C;  3S16 B;  1G8Z D;  4A3G H;  3X3M A;  1EIF A;  2HIX A;  4MN3 A;  5C6A A;  3PO2 G;  2UXC L;  1CSQ A;  1YHQ A;  2VNU D;  5EAY A;  2JE6 I;  4YY3 L;  4JBM A;  2EYH A;  4KD4 A;  3JAM i;  2A5H A;  2FMM A;  1SXT A;  1KNE A;  2EY2 A;  5DNF A;  4KMU C;  4JYA L;  1X54 A;  1JR0 D;  2NVY B;  1SR3 A;  3D4W A;  1ZKO A;  2PMZ B;  2MP1 A;  1HFG A;  1D8L A;  4LFA Q;  4XXE A;  4AQY L;  4OO1 G;  2Q2T A;  1K28 A;  2JQO A;  2WIN B;  3RZD B;  4X6A H;  5J39 A;  4A3I G;  2BDO A;  4HR7 B;  1XMO Q;  2BE5 D;  1N32 Q;  1D7Q A;  5T1I A;  4OEM B;  2MGS A;  1A8V A;  2WP8 J;  3BYY B;  3A8K E;  4BY7 B;  4CJ1 B;  4HIM A;  2KHJ A;  3GTK H;  1TS3 A;  4Q5V A;  2UXD L;  1RTN A;  4N9T A;  4HIO A;  2QKI C;  1I3Q H;  1SMY D;  4YWK A;  1NR2 A;  1RTO A;  2X69 A;  2UUA Q;  2UXD Q;  1O78 A;  4C56 C;  1CZW A;  3CC2 A;  3FRP B;  2IX1 A;  3PIO 3;  4JV5 Q;  4P71 A;  4LW1 A;  3BZD B;  2XSC A;  4HTH A;  1I3Q B;  2F0W A;  3TEH B;  4JI4 Q;  2DNE A;  4IAL A;  3J81 L;  2UUC Q;  1LTB D;  2VW9 A;  5IT9 E;  3KF6 B;  2UU9 Q;  2ZT9 C;  3IKJ A;  1LTL A;  4HMJ A;  5D3D A;  3ZJY C;  3BDO A;  1Y1V B;  3NEL A;  5IT9 L;  4LF4 L;  1DOK A;  1PLF A;  1VQB A;  1EIG A;  2ICI A;  5EBC A;  4FNF A;  2CW0 C;  4OIK A;  4C1N I;  1EU4 A;  1F2M A;  3OMG A;  2JA7 B;  4A3D H;  2PI2 E;  3PCO B;  5JEA J;  1SE4 A;  3QR8 A;  3WOF A;  5G3L F;  3WDN A;  1VQL A;  1KC8 C;  1ESR A;  4DR4 Q;  3KUP A;  1W6J A;  4K5V A;  2EJF C;  1PHJ A;  1QNK A;  4KD3 A;  3ULP A;  2A69 C;  4DV1 Q;  3AMU A;  4LF6 Q;  2K5Q A;  3CC4 A;  2PPB C;  1G51 A;  2YTV A;  3EBE A;  4A93 B;  4X3U A;  4J8Q A;  4A3G B;  2Q2I A;  3A8I E;  1GUG A;  3L2P A;  2SEB D;  3I4M B;  4OON A;  5E3F A;  2JA8 B;  1VQM A;  5AFW A;  4A3C G;  4B3M Q;  5AJ3 Q;  1ROD A;  4B9W A;  3Q22 A;  1ILP A;  1EY9 A;  1VQE A;  3BDC A;  1J5E L;  3MZ5 A;  3PSI A;  4R4I A;  2PCF B;  3H94 A;  3TDQ A;  2F3V A;  3KF6 A;  2LS0 1;  3NWS A;  3R3O A;  3KF8 B;  2UU9 L;  1B9M A;  3CCE A;  1QUQ B;  3VYT A;  3STB C;  3DUZ A;  1SMX A;  3JAM E;  1QCB D;  4LF8 L;  1I94 Q;  1UEA B;  2R7Z G;  3PMF A;  1SSO A;  3K0Y A;  4JBJ A;  1Q3L A;  4XT3 B;  3G4S A;  1M90 C;  2OEO A;  3MXP A;  1PDQ A;  4DN4 M;  5KNC A;  2WAQ B;  1ML0 D;  2YV5 A;  2K50 A;  3D4D A;  3PO3 B;  1GD7 A;  2AMC B;  1BCP D;  4QIW E;  1IBM Q;  3UE1 A;  3K58 A;  2BDN A;  1GUS A;  5GAG C;  1OXV A;  3I7F A;  4GKJ Q;  1S5D D;  4DR6 Q;  5I4D A;  3FHW A;  2NVQ B;  5GAH C;  1LTT D;  3HKZ E;  1IHZ A;  1VQ6 A;  4DUZ L;  1UWV A;  4DPG A;  4LFB Q;  1LM0 A;  4LF6 L;  2H5X A;  1JQY D;  4CJ2 C;  1JWM D;  3QB3 A;  4NXN L;  3FDT A;  4GNX A;  2JA9 A;  1CA6 A;  1PRT F;  2WAC A;  4OXP A;  1L2F A;  2KUM A;  3H3V H;  1VQG A;  1BBU A;  2LMC B;  3DWA A;  4ALP A;  3MWY W;  3J7A V;  1CTM A;  2L11 A;  5M3M H;  3I90 A;  1R4Q B;  4BXX H;  1O7Y A;  2B2V C;  1A2U A;  1ICW A;  4LFC Q;  1YJN A;  2CQA A;  1WD1 A;  4PMW A;  2L15 A;  4JI3 Q;  4ABN A;  1CM9 A;  3TQY A;  1PZJ D;  1CKN B;  1WOC A;  1RKN A;  2AUJ D;  2JN4 A;  1RL2 A;  4A3E B;  1LTS D;  1T9H A;  3Q24 A;  4K14 A;  2RF4 A;  4YCW A;  1BQQ T;  2PZU A;  1U4M A;  2D0P A;  2OF1 A;  3G6J B;  2AQ1 B;  4RHS A;  1KRT A;  3CPW A;  1B44 D;  4F88 A;  3RLN A;  4DU9 A;  3S1M H;  1E0B A;  4LUV A;  1STB A;  3TP7 A;  3T1Y L;  2A8V A;  2HDM A;  3NBH A;  3BDL A;  3VYS A;  1X65 A;  2E2H H;  4TKO B;  3MHB A;  3DMU A;  2I46 A;  2PQE A;  2RQX A;  5K36 H;  1PFM A;  2Z6K A;  2EJG C;  3S1M B;  5ELN A;  4JI7 L;  5GAD C;  1IKL A;  4DF7 A;  1L0Y B;  3MFG A;  2QEJ C;  4R4T A;  4RWS C;  2K6A A;  3ERO A;  3MXG A;  3N6R A;  5M3F H;  3S1Q H;  5HGQ A;  5M3F B;  4JOI A;  1NNX A;  5IE8 A;  1OXT A;  1KD1 C;  4NXM L;  1AN8 A;  2IHE A;  2MUY A;  2N55 A;  5IYC H;  1G6Z A;  1STH A;  4DR2 L;  1I4G A;  4X65 L;  1WD0 A;  1I4Q A;  4R8I A;  3K5N A;  4TVA B;  1V1Q A;  3TN2 A;  4A4I A;  3H6M A;  1VQC A;  4HMI A;  5M3M B;  5C4J B;  1V1O A;  1BO0 A;  5E4W C;  3M3Y B;  4PZ6 A;  2D9U A;  5ELC A;  3PUX A;  4BWG B;  2ID0 A;  1H9K A;  4LAA A;  4XYQ A;  2N8N A;  1H9J A;  2B2W A;  3AU7 A;  3CRL C;  4JCV E;  1PRT B;  3C1E A;  4NB3 A;  4FF3 A;  2Z0S A;  1B9N A;  4QIW B;  2F3W A;  5DAU A;  1WJJ A;  4LF4 Q;  2NZ1 D;  5ELO A;  1PXU A;  3I4N G;  1NCV A;  3H09 A;  4Y52 H;  1P8L A;  3HOX G;  2BE5 C;  1IXR A;  1O7I A;  2OT2 A;  2XRQ D;  3HKZ B;  3S2D H;  4IQZ A;  4R8N A;  4A3F G;  2VB2 X;  3MVV A;  4ZKB B;  1WI5 A;  4NMZ A;  2JP1 A;  3L0O A;  5I9P A;  5LMN Q;  1TT2 A;  2F52 A;  3EIV A;  3VR2 A;  4CJ0 B;  3CW2 C;  1SNQ A;  2RHQ B;  3WWV A;  1HQR D;  4KTA A;  2XVS A;  5FJ8 H;  1PA6 A;  3HOZ H;  1LT6 D;  5BN3 A;  2K33 A;  1BCP F;  4A3C H;  4APV A;  1KLU D;  1SDF A;  4DR7 Q;  2Z6B A;  3MEH A;  2BA0 A;  2BA1 A;  2K03 A;  4YWL A;  1BR9 A;  2C5C A;  2NVQ H;  1B70 B;  3M4O H;  1X56 A;  5ISR A;  3PIO A;  4OL7 A;  4HJ5 A;  1HPC A;  4RGT A;  4WFN 3;  1TS4 A;  2B2T A;  1W3S A;  4L63 B;  1X3Q A;  2R7D A;  1IL8 A;  3DWQ A;  2E75 C;  4IJH A;  1JE5 A;  5KRU A;  2K7V A;  2QW7 A;  1MSH A;  4A3B G;  1UE1 A;  3K5L A;  2PZT A;  3PGZ A;  1V43 A;  4CDE C;  1H9R A;  3A8J E;  3KJO A;  1IBK L;  2A69 D;  5IYB G;  1HNW L;  4DK0 A;  3O13 A;  2F0N A;  2OTJ A;  3I4L A;  1LTI D;  1GUW A;  1TQO A;  3KJP A;  4KKT A;  1CFM A;  1YEZ A;  1GVP A;  1NJI C;  4RGM A;  5COY A;  1MJC A;  3NEM A;  2NTT A;  3E6Z X;  2EZV A;  1SEB D;  3SDZ A;  2VUM G;  2ICE C;  4HSP A;  5C4H A;  3NPP A;  2PO4 A;  4DR1 L;  3BVZ A;  2RSO A;  2B2U C;  3KLS X;  4DR5 Q;  1XNR L;  4QUF A;  5GAE C;  4A3J B;  4O1N A;  3KK7 A;  3S17 H;  4C3H H;  2E5L Q;  2I5M X;  1YNJ D;  3NTH A;  1G29 1;  1KAB A;  1N9W A;  4LK1 C;  3OYY A;  4Y7N B;  4UDU C;  2A74 C;  5H1S E;  3NWT A;  1XMO L;  1N32 L;  1Q1B A;  4KKS A;  4RKB A;  4XIG S;  2VUM B;  1Z9F A;  4BA2 I;  4QGU A;  4IZ8 A;  5IGB A;  4DAY A;  3S17 B;  1HR0 W;  4A3E G;  2RDF A;  1KRS A;  1VQI A;  1S5B D;  5M3M G;  3H15 A;  2PQA A;  1CHQ D;  2L4N A;  4LUO A;  2JA7 H;  2C9O A;  4HJ7 A;  3M4P A;  4DXG A;  2B2Y A;  4CDD C;  1N36 Q;  4HJA A;  3GQB A;  4OX9 L;  1SJH D;  3CCU A;  5M5X H;  1Y1V H;  1BKB A;  2A6H C;  4XTC S;  1UE7 A;  5T1G A;  4QQB X;  1I6H H;  1S3O A;  1M1K C;  5EQ0 A;  1II3 A;  2QF7 A;  1JJG A;  3U4Z A;  2PMZ E;  2ES2 A;  3CME A;  1VMP A;  4QMG A;  3GTJ B;  5KEE A;  1SND A;  2JA8 H;  2I5L X;  1S40 A;  4MTN A;  4LFA L;  1HA6 A;  3H0G B;  4L6T B;  1DD2 A;  5IP7 H;  1ET9 A;  5EKL A;  1Q86 C;  3D6W A;  5C44 G;  4B3S L;  1Y69 U;  1BVS A;  2HUG A;  1HZA A;  2JK8 A;  2V1C C;  4XYO A;  2R92 H;  3GO5 A;  1EQQ A;  3OHX C;  3RUZ A;  1C9O A;  4AQY Q;  3P1H A;  1IZ6 A;  4QF4 A;  4DV0 L;  2DGY A;  1D2B A;  2O4X A;  4U67 3;  1YHA A;  4BXX G;  5IT9 c;  4X65 Q;  1HRJ A;  4QCL A;  1D1K A;  5GRO A;  4BS9 A;  5AJ3 L;  4UAI A;  1N8R C;  2CW0 D;  2HCC A;  1STG A;  1WCM H;  4YHH Q;  5FO9 B;  3GTG H;  1Z6H A;  1GHJ A;  5JOB A;  4KJO A;  1TS2 A;  1U9R A;  3PV0 A;  1Q46 A;  1YNN C;  3GTO B;  5LMU Q;  4BBS G;  3G48 A;  2VXW A;  3DWP A;  3Q23 A;  3E9I A;  4KJN A;  4OWX B;  2VB3 X;  1E2W A;  3SHL A;  1S5E D;  4K5W A;  5CBE E;  3U4V A;  5DEH A;  3B6Y A;  3M4Y A;  3NBI A;  5C4J H;  3TP5 A;  4OWW B;  1FNU A;  3KYH C;  3M7G A;  4L5T A;  1D5Z C;  1ZXT A;  3K7U C;  1WCM G;  4C3I B;  2K75 A;  4WJW A;  1STN A;  3A7L A;  2F0P A;  1HUM A;  2CWA A;  4B08 A;  1C0A A;  4JW0 A;  1AW7 A;  2KCC A;  2PYK A;  4KY5 A;  3OTO Q;  4YIJ A;  3R2I A;  1QWY A;  2KA7 A;  3NQT A;  1DZ1 A;  3HOZ B;  3CCL A;  1SNM A;  3DM3 A;  1GUT A;  2E2I H;  4DNR B;  1H95 A;  1WTH A;  1VQK A;  3NTI A;  2K5V A;  1S5F D;  5C0X I;  2MQH A;  3QJY A;  3I56 A;  3STB D;  1CKM A;  1E1T A;  4X66 L;  4JI5 L;  1PZI D;  1XX8 A;  3MC0 B;  3P20 A;  3T56 B;  1VQ9 A;  1Y1W G;  2DY7 A;  4HID A;  1YIT A;  2K04 A;  3S1N B;  4K0K Q;  3KLW A;  4XQJ A;  2KCT A;  1Y14 B;  1ONL A;  2KCM A;  4NW2 A;  3C2P A;  1PYW D;  1DJR D;  3VR6 A;  1AE3 A;  2D62 A;  3C46 A;  3NTK A;  4A3F B;  1H9S B;  2DUD A;  2FJ2 A;  2E2H B;  5IYD H;  1AZP A;  1VQ4 A;  1S72 A;  5HGT A;  1XPU A;  4UP9 A;  4A3B H;  4IFD G;  3CRK C;  4XT1 B;  2F03 A;  5G3L D;  5E1F A;  4OX9 Q;  5DLQ E;  4IFD J;  4LUZ A;  4A3M G;  4FXG C;  5C5L A;  1JC7 A;  2HIV A;  4CKE A;  1MSG A;  3P75 A;  1QNU A;  1OTC A;  2RBM A;  1NY4 A;  4P74 A;  4JI8 Q;  3TME A;  3TRZ A;  4DFA A;  1WTW A;  4LF9 Q;  2IWH A;  1X55 A;  2Y0S G;  3U9S A;  3BYT B;  4HIK A;  4JYA Q;  5BR8 Q;  1I4H A;  4BY1 G;  3J80 L;  2CH4 W;  3L3O C;  1HFN A;  3VYR A;  3HOU B;  2JYO A;  1LT5 D;  2A6E D;  4GS3 A;  3ITP A;  5JEA H;  2VS1 A;  4H13 C;  3FKI G;  2EQS A;  1ZEQ X;  3S1Q B;  3K0X A;  5BN4 A;  3NSW A;  4ID6 A;  3TS2 A;  2A19 A;  1VQD A;  2BH8 A;  1EFI D;  2IY5 B;  1M4V A;  3X3N A;  1SRO A;  3HS0 C;  1ENA A;  3OW2 A;  2L0C A;  3F2D A;  1JWS D;  5COR A;  1PH4 A;  4LF5 Q;  2JA6 H;  3HOV H;  5KIX A;  5EKK A;  4J6H A;  2K5N A;  1PRT C;  1K8A C;  1FR3 A;  1HNX Q;  5IGD A;  2R6G A;  1DYQ A;  4BA1 I;  1QJO A;  5M9O A;  1RF2 D;  4YWM A;  2NZO A;  2VY3 A;  1EWH A;  1VQJ A;  3HZX A;  2F0M A;  4A3K G;  4DUY Q;  4P75 A;  1VQ7 A;  2WKC A;  2MO0 A;  1HTL D;  4C1N K;  1S5C D;  3BZC A;  3NUC A;  3Q8D A;  2Z4I A;  4OO1 I;  2K5D A;  3KDF A;  2JA5 G;  1JT8 A;  2EY6 A;  5LMU L;  4ZQ3 A;  3PO3 H;  5C5M A;  2F0F A;  2I07 B;  3IFD A;  1SAP A;  4ZRZ A;  1IBK Q;  1EYD A;  1FYC A;  1S4Z A;  1IYJ B;  4PV1 C;  2F4V Q;  5IYC G;  2UXC Q;  1W6K A;  3CCR A;  4FYD A;  5D3I B;  1A63 A;  1D6E C;  3H0G G;  4R1J A;  3SXH A;  4L5Q A;  1YBY A;  1C48 A;  2ENB A;  2XTI A;  4N8F A;  4LF9 L;  5F2D A;  4RGO S;  1HNZ L;  4FXD A;  3V96 A;  3S1R H;  1CK1 A;  1CI3 M;  4ZYS A;  2XWJ B;  2R92 G;  1HZB A;  4O2D A;  2F0L A;  1K8O A;  4DNI A;  4RGN A;  2K32 A;  3ULJ A;  2JA5 H;  1SJE D;  3C1F A;  1TWA H;  3BS1 A;  1XNQ L;  1EYA A;  2GN5 A;  2KQ3 A;  1SRU A;  1IBL L;  4K6L A;  3TSS A;  2ZTD A;  5K36 G;  4JI1 L;  1VMC A;  3I4M H;  2G9H D;  2EDG A;  2EXZ A;  1KTK A;  4NP5 A;  2DJG C;  1TII D;  4ZAI A;  1KDB A;  1TU2 B;  2A68 C;  4IPH A;  5EBD A;  1B2T A;  1NBW A;  3JAM c;  3W5O A;  2WV6 D;  2WB1 B;  4PG3 A;  5C4X B;  3U9O A;  1K0S A;  4KN7 C;  5CV6 A;  1SE8 A;  1STE A;  5CC4 A;  2LSS A;  4C3I G;  3VA5 A;  1EOV A;  1IW7 C;  4DV7 Q;  1MHW C;  3DXJ C;  4X3S A;  4M8A A;  3U58 A;  4LF7 Q;  2TMP A;  3SR1 A;  3GTM B;  2JJQ A;  1I4P A;  1EU3 A;  2L9H A;  2HQL A;  1DXM A;  1XTD A;  3UDG A;  4R4O A;  1NE3 A;  4CDF C;  4IFD H;  2PW7 A;  3BU2 A;  3E0J A;  2MJ8 A;  3CCQ A;  3M7N A;  3H3V I;  1EZ6 A;  2O5J C;  2WII B;  4KY6 A;  3GTJ H;  4U68 A;  1H9M A;  2LFN A;  2ASB A;  2K01 A;  3HOY H;  3I4N B;  1LTA D;  3EFX D;  3KBX A;  1QB5 D;  3MXN B;  2Z8L A;  3I3C A;  4C2M H;  2NVT B;  1WTR A;  3VR4 A;  1HQM C;  1HUN A;  1RIP A;  2XRS D;  2YU9 B;  1I50 B;  4IJL A;  3HKZ G;  1TVX A;  4GN5 A;  3SVM A;  2EYO A;  3OW7 A;  3TZU A;  1RJT A;  2K28 A;  3OTO L;  2R61 A;  5GQO A;  1OXS C;  4LFB L;  5A35 A;  3D0F A;  2F0O A;  3OWE B;  1JOQ A;  2VQF Q;  1YNN D;  3GTM H;  1O80 A;  2EYP A;  4G57 A;  4L8J A;  4IOA A;  2FHT A;  3ULL A;  2B2V A;  3MFY A;  1EQT A;  3PO2 H;  2VUM H;  5M3F G;  2QGQ A;  1HR0 Q;  2JA6 G;  2WAQ E;  5JJL A;  2WB1 G;  5C4X G;  1X9N A;  3GTL H;  2XWB B;  4DK6 C;  3FVQ A;  4ZUJ A;  4LNQ A;  4IUR A;  3S16 H;  1K73 C;  4A3D B;  3D8G A;  1A3V A;  2IT1 A;  2Q8R E;  4ULL A;  1XPO A;  4V19 0;  3HOU G;  3HOW B;  1EQR A;  4QUC A;  4HJ9 A;  3IRB A;  2GA4 B;  2F1M A;  3W1B A;  3J81 E;  4DR3 Q;  1SFO B;  1V1P B;  5FKA C;  1L1O B;  3CQZ B;  1SNO A;  1TWC B;  4G7O C;  2JA5 B;  1Q12 A;  3TP6 A;  1WYD A;  3RMH A;  5A2Q L;  3MXN A;  4EVO A;  2Z6K C;  3J81 i;  2R93 B;  1TR5 A;  1C7Y A;  5IP9 H;  3MA2 B;  3K5M A;  2B39 A;  4MNO A;  3NK9 A;  4M1U B;  5E4X A;  5IYB H;  2OXP A;  3BJU A;  2EYL A;  1DGS A;  3LGJ A;  3RZO H;  2RCN A;  1X3E A;  4RMF A;  4PMB A;  2Q2U A;  4JI7 Q;  2ZJP A;  4JOI C;  2SOB A;  2UXB Q;  1BXT A;  1PV4 A;  3E9H A;  4CGY B;  3SEB A;  1GKH A;  2WB1 E;  4BBR G;  1JIC A;  1YJ9 A;  1IBL Q;  5M5Y H;  2RVL A;  2B8G A;  3E3X A;  1XJV A;  2F0S A;  4GLA C;  2RDH A;  4HCS A;  1PYB A;  3CAM A;  1TWG B;  4JK1 C;  1CSP A;  1Q1E A;  1SLJ A;  4ME3 A;  5EGT A;  4JI0 L;  1A3T A;  4AYB G;  1O7L A;  3LWU A;  2RHS B;  3J7A 5;  3NP8 A;  4ILW A;  1YNX A;  3U50 C;  3D31 A;  1BBX C;  3JAM L;  1KXL A;  2XNA C;  1Y8P B;  2DJF C;  2RA4 A;  2MO1 A;  2MHV A;  4LFC L;  4A3M H;  1QVC A;  1K9M C;  3QWN A;  1TWF B;  4JC0 A;  5L37 A;  1E3P A;  1E2V A;  4BBR H;  1A2T A;  1FGU A;  1ZYR D;  4S3S A;  1BNZ A;  2ZXP A;  3AEV A;  2NB0 A;  2BCO A;  1WFQ A;  3FKI B;  2CH4 A;  1NAP A;  4KY7 A;  1JOR A;  1EWI A;  1KDC A;  2KVM A;  1RCV D;  3K7A B;  1FD7 D;  2NN6 I;  1D5X C;  4X3T A;  5J1Z A;  1VQN A;  1LTG D;  1KLG D;  1LYL A;  4A3G G;  2FXQ A;  1E1O A;  2JEA I;  2K52 A;  1FL0 A;  2JXM B;  4DR5 L;  1XNR Q;  4YY3 Q;  1YJW A;  1X3P A;  4HSV A;  4L5R C;  3EN2 A;  1X32 A;  4N8X 1;  4RAU C;  3CXC A;  5LMN L;  1GM5 A;  1DOM A;  4A3K B;  3BG3 A;  2B8F A;  2F0I A;  4PZ7 A;  3PQI A;  3M9B A;  4P2C B; 
#chains in the Genus database with same CATH homology
 1T5X D;  1F9P A;  1VF5 C;  1H9S A;  1F2Y A;  2LKV A;  3MXU A;  5LHY 1;  2Z4H A;  2L12 A;  3T51 B;  5BN5 A;  3D6C A;  1G91 A;  4DGZ A;  1UUP A;  1A3U A;  3K6O A;  3OPO A;  4K8J A;  3VR5 A;  3HP3 A;  2Q8I B;  3PIP 3;  3CKI B;  5C4Z A;  4ZLT F;  5CV9 A;  1STY A;  2K5W A;  4EQP A;  1QIL A;  4EQO A;  2EPB A;  1OXU A;  2SDF A;  2A6H D;  1I6H B;  1RDP D;  4FO2 A;  4NDX A;  4F8M A;  1BCP B;  1EYC A;  2B2U A;  3DM1 A;  3ERQ A;  4DAP A;  2Z1C A;  3KBG A;  4WRD A;  2XIW A;  3H3V C;  3R93 A;  3RZO B;  2F0E A;  1D5M C;  3VYU A;  5JVH 3;  3R2T A;  1EQV A;  1PTO H;  1F2L A;  3A54 A;  1IW7 D;  1QOH A;  4QB4 A;  3PUW A;  1DON A;  5ELE A;  1KNA A;  3H91 A;  2MPM A;  5IGG A;  4KKU A;  5KYL A;  4MHE A;  3PO2 B;  4Z9C B;  1RHP A;  2F0Q A;  5FO7 B;  3IAY A;  5I2X A;  5ELD A;  2WKD A;  4I7Z C;  4RCO A;  3T53 B;  2B2Y C;  3NHH A;  3HGB A;  1DCZ A;  4ME5 A;  3T16 A;  1B53 A;  2EYF A;  3EA6 A;  1MBY A;  1U4L A;  1Z47 A;  1EY4 A;  4XQN A;  4LMQ D;  3HEJ A;  2R92 B;  4IUQ A;  5C3E B;  4CBV A;  1Y1W B;  4H44 C;  3SK4 A;  1TWA B;  1ENC A;  5IIF A;  1NUC A;  3S1R B;  2M00 A;  4RKL A;  1JE4 A;  1HHV A;  2LY7 A;  4X3K A;  3ZYY X;  4J1M A;  1LV9 A;  1R9T B;  2BOS A;  2HDL A;  5CV7 A;  1WVL A;  4CKB A;  1SNC A;  4IUN A;  1GOZ A;  1SNP A;  2DY8 A;  2ZXR A;  3SK6 A;  5C44 B;  1A6X A;  1OO9 B;  1R4P B;  5ELB A;  2F0J A;  1RD9 D;  4DK1 A;  3L7Z C;  1ILQ A;  1UNS A;  3J7Y W;  4RCN A;  4EGV A;  4Q0F A;  3HOV B;  4NKL A;  3KLR A;  3DEO A;  1PFB A;  5A2Q E;  1JOO A;  3GD7 A;  3QOL A;  5D14 A;  5HUR A;  4RFB A;  5CGK A;  4CHT B;  4LJZ C;  1STA A;  3CU7 A;  1AFP A;  3FPP A;  1GJX A;  4OGQ C;  5IOD A;  1EY5 A;  5FLX E;  1Z7T A;  3SK5 A;  5LL6 S;  3GTP B;  2IW3 A;  5EKI A;  4ODG A;  2EYJ A;  3A7A B;  4K8I A;  3OMC A;  1SYE A;  2YYZ A;  3KLS A;  5K5P A;  1BF4 A;  1I4R A;  3GV3 A;  3HOX B;  1K83 B;  2EY5 A;  1PTO B;  1TKW B;  3OSO A;  4FF4 A;  3OOC A;  3J80 E;  1ZYR C;  2F4I A;  3EQL C;  1PRT D;  1I4X A;  1NR4 A;  2IL8 A;  3NE5 B;  4XDX A;  5JPM C;  4IUT A;  5I6Y A;  3TBI B;  4TSS A;  2QIL A;  4WOR A;  2O2L D;  2JA6 B;  3T4A C;  4FF2 A;  4G4K A;  2EY1 A;  5CMD A;  5I2Y A;  1C8C A;  3FMC A;  4IN3 A;  4N9P A;  1TY0 A;  2M2L A;  2G9D A;  1WTO A;  4JBW A;  5EPJ A;  1HCZ A;  4C3J B;  1B4O A;  1UAP A;  1EWC A;  2QDB A;  2D2C C;  4EQN A;  2IPK D;  3W3A A;  1MD2 D;  2PW5 A;  3S14 B;  4DNT B;  4F7X A;  2V4D A;  2Y0S B;  1WTV A;  1GXD C;  1G2T A;  4DA2 A;  4OIJ A;  1SYG A;  1LLR D;  2KOL A;  4IUP A;  4H7B A;  2A68 D;  4HCE A;  4ZK9 B;  4FXK C;  5CV4 A;  1WTP A;  3FEW X;  3A55 A;  1EY0 A;  3J7A F;  5C3W A;  3K59 A;  4IUU A;  1XWE A;  2KHS A;  2E2I B;  2AWO A;  1EY8 A;  1CQV A;  1DOL A;  3SE0 A;  1Y8O B;  2CHB D;  5FO8 B;  1SMY C;  4RA8 A;  5KND A;  2EE1 A;  4FF1 A;  3RLF A;  4H0L C;  2HCI A;  3S9W A;  2E2J B;  4K2L A;  1A15 A;  3LWE A;  2AWN A;  1SE2 A;  3D3R A;  3TP8 A;  1MGS A;  1ESF A;  3NQI A;  3ND9 A;  3LNN A;  1AEX A;  1F77 A;  5CR3 A;  1FGB D;  1B3A A;  2RKS A;  4KHZ A;  3VA7 A;  3TZD A;  1U4R A;  2A6E C;  3DHQ A;  2PNR C;  3HRZ C;  3GV6 A;  2AQ3 B;  3HOY B;  5M5Y B;  3AB9 A;  1LAC A;  2TSS A;  1LT3 D;  2E2D C;  3K57 A;  2KEC A;  3L9A X;  2R7Z B;  3MTS A;  5J22 A;  1M8A A;  1SYC A;  1SYD A;  3GTL B;  3M85 A;  4C3H G;  4O42 A;  1JOK A;  1C4Q A;  2H1E A;  3UI2 A;  1EL0 A;  1WCM B;  1CA5 A;  2CVR A;  3MAQ A;  1J8I A;  3LX0 A;  5C0X G;  1ET6 A;  1NSN S;  3I70 A;  3DEP A;  2KCN A;  4A3M B;  2H4O A;  3I8Z A;  5C0X J;  1EEF D;  4KHV A;  3PUV A;  2SNM A;  4HAE A;  2JEB I;  1JWU D;  2B2W C;  2F0G A;  1TY2 A;  5KYI A;  1PTO C;  3OIQ A;  1VCI A;  2F0D A;  4BBS B;  3URY A;  2XN9 C;  3FPU B;  5CYU A;  1LTR D;  5KNB A;  5M5X B;  3HG9 A;  3ND8 A;  2AQ2 B;  3CHB D;  1PTO F;  1V1P A;  3A56 A;  1DM0 B;  4BY1 B;  1MI2 A;  2EYM A;  4I65 A;  4RHR A;  5IGC A;  4HED A;  1XTC D;  3RD4 A;  1BCP C;  3QIA A;  2KJX A;  3GTK B;  2R3Z A;  5FLX L;  1PMR A;  3WOE A;  2NVX B;  5DM7 3;  5C3X A;  2AUK A;  1CZG A;  3Q0A A;  4PNY A;  2QCP X;  2IX0 A;  1FNW A;  1FNV A;  1K8M A;  3BVG A;  3M4O B;  2JSO A;  3V2T A;  2O5I C;  1LT4 D;  4MIU A;  4IUV A;  1G2S A;  4PMC A;  3PUZ A;  2B2T C;  1D1I A;  5LL6 X;  5D65 A;  1IYV A;  1SYB A;  4AYB B;  1JB3 A;  4DAV A;  4PQX A;  2J4X A;  2F0K A;  1WTX A;  5IGE A;  3OIP A;  2L5T A;  1F2Z A;  2K05 A;  1IYU A;  3K5O A;  2NWG A;  4KN4 C;  1V8Q A;  4XQQ A;  4C3H B;  1EOT A;  3I72 A;  3BVM A;  1TS5 A;  5EPK A;  1EZ8 A;  1Y8N B;  4GZY C;  4OO1 H;  3C3L A;  4B9X A;  1IKM A;  1B50 A;  4KI0 A;  4ZKC B;  3GP7 A;  4F87 A;  5JVG 3;  1E2Z A;  5EJW A;  1I6V C;  1L0X B;  2EOT A;  3D4R A;  4FP5 D;  4C2M B;  3OWF A;  1CT1 D;  3I91 A;  4IFD I;  1Q90 A;  4K5X A;  1F9R A;  2EJM A;  3N52 A;  1HA5 A;  2IX3 A;  3S15 B;  2KED A;  4A3B B;  4K2K A;  2PZW A;  5JEA G;  4RH6 A;  1O7Z A;  5CV5 A;  4V0B A;  2X6L A;  2ZXO A;  3VR3 A;  2NTS A;  3QG1 A;  1U4P A;  1T5E A;  2X6G A;  2KEE A;  3IL8 A;  3G7L A;  2F0U A;  5C0X H;  3GTQ B;  5EPL A;  1BDO A;  1EY7 A;  3SK8 A;  1OXX K;  2DNC A;  1KAA A;  1Q8I A;  3ONA B;  1TWH B;  1XYI A;  3S2D B;  2J0T D;  5KGU A;  2E76 C;  1SBB B;  1XXG A;  2FMC A;  2FFK B;  1BOS A;  4KV6 A;  2B63 B;  1KDA A;  1GHK A;  1CHP D;  2A73 B;  1ENF A;  1PFN A;  1AP0 A;  2K1B A;  2D5D A;  1AZQ A;  1YNJ C;  4ZUI A;  5I9O A;  3P7J A;  3IFT A;  2NN6 G;  3W2D A;  2L1B A;  3T13 A;  3KF8 A;  1J9O A;  5M5W B;  4G7Z C;  1F9S A;  1F9Q A;  3F2U A;  4E6I A;  5FK9 C;  1HXY D;  4A3I B;  3QO2 A;  4FVM A;  4BBR B;  2SNS A;  3NXW A;  2NUC A;  2EVB A;  5IOC A;  5JPN C;  5JJZ A;  5NUC A;  1QE6 A;  2M9V A;  1JCK B;  1EIH A;  3E5S A;  2N88 A;  4TRD A;  2NYZ D;  1VF7 A;  1B1Z A;  1QG7 A;  5CV8 A;  4OHJ A;  5DM6 3;  2NBF A;  4R9W A;  3EVQ A;  3QOJ A;  2IJ0 A;  2L55 A;  5TSS A;  1VDZ A;  1LAB A;  1EY6 A;  2F0V A;  2HQE A;  5IGF A;  2FIN B;  2RSN A;  3R8B A;  3S2H B;  1SYF A;  1WTQ A;  5CBA E;  4CKC A;  2E74 C;  1CQF A;  4C3J G;  2F0H A;  2Q8T A;  2RDG A;  3GTG B;  4HN7 A;  4K6D A;  1PZK D;  2F0T A;  5I6W A;  1GUO A;  3Q6S A;  4TQU S;  3I73 A;  3EJI A;  5FOB B;  1PTO D;  2NN6 H;  3PUY A;  5JAV A;  5ELF A;  1LO5 D;  4DXF A;  1HTP A;  1BUV T;  4KK7 A;  2J7Z A;  1SE3 A;  3V05 A;  2DN8 A;  1EEI D;  1GUN A;  3S16 B;  4G7H C;  1G8Z D;  3X3M A;  4MN3 A;  5C6A A;  2VNU D;  2JE6 I;  2EYH A;  4KD4 A;  2A5H A;  2FMM A;  1SXT A;  1KNE A;  2EY2 A;  5DNF A;  4KMU C;  1JR0 D;  2NVY B;  3D4W A;  1ZKO A;  2PMZ B;  2MP1 A;  1HFG A;  4XXE A;  4OO1 G;  2WIN B;  3RZD B;  5J39 A;  2BDO A;  4HR7 B;  2BE5 D;  5T1I A;  2MGS A;  3BYY B;  2WP8 J;  4BY7 B;  3A8K E;  4CJ1 B;  1TS3 A;  4Q5V A;  1RTN A;  4N9T A;  2QKI C;  1SMY D;  1NR2 A;  1RTO A;  2X69 A;  1O78 A;  4C56 C;  1CZW A;  3FRP B;  2IX1 A;  3PIO 3;  3BZD B;  2XSC A;  4HTH A;  1I3Q B;  2F0W A;  2DNE A;  4IAL A;  3J81 L;  1LTB D;  5IT9 E;  2ZT9 C;  3IKJ A;  4HMJ A;  5D3D A;  3BDO A;  1Y1V B;  5IT9 L;  1DOK A;  1PLF A;  2ICI A;  1EIG A;  5EBC A;  4FNF A;  2CW0 C;  4OIK A;  4C1N I;  1EU4 A;  1F2M A;  3OMG A;  2JA7 B;  5JEA J;  1SE4 A;  3WOF A;  5G3L F;  3WDN A;  1ESR A;  3KUP A;  1W6J A;  4K5V A;  2EJF C;  1QNK A;  4KD3 A;  2A69 C;  3AMU A;  2K5Q A;  2PPB C;  4A93 B;  4X3U A;  4J8Q A;  4A3G B;  3A8I E;  1GUG A;  2SEB D;  3I4M B;  5E3F A;  2JA8 B;  5AFW A;  1ROD A;  4B9W A;  3Q22 A;  1ILP A;  1EY9 A;  3BDC A;  3MZ5 A;  2PCF B;  3H94 A;  3TDQ A;  2F3V A;  2LS0 1;  3NWS A;  3R3O A;  1B9M A;  3VYT A;  3DUZ A;  3JAM E;  1QCB D;  1UEA B;  3PMF A;  1SSO A;  3K0Y A;  4XT3 B;  1Q3L A;  2OEO A;  3MXP A;  1PDQ A;  4DN4 M;  5KNC A;  2WAQ B;  1ML0 D;  3D4D A;  3PO3 B;  1BCP D;  3K58 A;  2BDN A;  1GUS A;  1OXV A;  1S5D D;  5I4D A;  2NVQ B;  1LTT D;  1IHZ A;  1JQY D;  4CJ2 C;  1JWM D;  3QB3 A;  3FDT A;  1CA6 A;  1PRT F;  2WAC A;  2KUM A;  2LMC B;  3DWA A;  3MWY W;  3J7A V;  1CTM A;  2L11 A;  3I90 A;  1R4Q B;  1O7Y A;  2B2V C;  1A2U A;  1ICW A;  2CQA A;  1WD1 A;  4PMW A;  4ABN A;  1CM9 A;  1PZJ D;  1RKN A;  2AUJ D;  4A3E B;  1LTS D;  3Q24 A;  4K14 A;  1BQQ T;  2PZU A;  1U4M A;  2OF1 A;  3G6J B;  2AQ1 B;  4RHS A;  1B44 D;  4F88 A;  4DU9 A;  1E0B A;  1STB A;  3TP7 A;  2HDM A;  3NBH A;  3BDL A;  3VYS A;  4TKO B;  3MHB A;  3DMU A;  2I46 A;  2PQE A;  2RQX A;  5K36 H;  1PFM A;  2EJG C;  3S1M B;  1IKL A;  4DF7 A;  1L0Y B;  3MFG A;  2QEJ C;  4RWS C;  2K6A A;  3ERO A;  3MXG A;  3N6R A;  5M3F B;  1OXT A;  1AN8 A;  2MUY A;  2N55 A;  1G6Z A;  1STH A;  1WD0 A;  1I4G A;  1I4Q A;  4R8I A;  3K5N A;  3TN2 A;  3H6M A;  4HMI A;  5M3M B;  5C4J B;  1V1O A;  1BO0 A;  5E4W C;  3M3Y B;  5ELC A;  2D9U A;  3PUX A;  4BWG B;  2ID0 A;  1H9K A;  4LAA A;  4XYQ A;  3AU7 A;  1H9J A;  2B2W A;  1PRT B;  3CRL C;  3C1E A;  4FF3 A;  1B9N A;  4QIW B;  2F3W A;  5DAU A;  2NZ1 D;  1PXU A;  1NCV A;  3H09 A;  2BE5 C;  2OT2 A;  2XRQ D;  3HKZ B;  4IQZ A;  4R8N A;  2VB2 X;  3MVV A;  4ZKB B;  4NMZ A;  2JP1 A;  5I9P A;  1TT2 A;  3VR2 A;  4CJ0 B;  1SNQ A;  1HQR D;  4KTA A;  2XVS A;  1LT6 D;  5BN3 A;  2K33 A;  1BCP F;  1KLU D;  1SDF A;  3MEH A;  2BA0 A;  2BA1 A;  2K03 A;  1BR9 A;  2C5C A;  5ISR A;  4OL7 A;  1HPC A;  4RGT A;  4WFN 3;  1TS4 A;  2B2T A;  4L63 B;  1X3Q A;  3DWQ A;  1IL8 A;  2E75 C;  5KRU A;  2K7V A;  1MSH A;  3K5L A;  2PZT A;  1V43 A;  1H9R A;  3A8J E;  2A69 D;  4DK0 A;  3O13 A;  2F0N A;  3I4L A;  1LTI D;  1GUW A;  1TQO A;  4KKT A;  1CFM A;  4RGM A;  5COY A;  2NTT A;  3E6Z X;  2EZV A;  1SEB D;  3SDZ A;  2ICE C;  4HSP A;  5C4H A;  3NPP A;  2PO4 A;  3BVZ A;  2RSO A;  2B2U C;  3KLS X;  4QUF A;  4A3J B;  4O1N A;  3KK7 A;  1YNJ D;  3NTH A;  1G29 1;  1KAB A;  4LK1 C;  4Y7N B;  4UDU C;  2A74 C;  3NWT A;  1Q1B A;  4KKS A;  4RKB A;  4XIG S;  2VUM B;  4BA2 I;  4IZ8 A;  5IGB A;  4DAY A;  3S17 B;  2RDF A;  1S5B D;  1CHQ D;  2L4N A;  2C9O A;  4DXG A;  2B2Y A;  3GQB A;  1SJH D;  2A6H C;  4XTC S;  5T1G A;  5EQ0 A;  1II3 A;  2QF7 A;  1VMP A;  4QMG A;  3GTJ B;  5KEE A;  1SND A;  1HA6 A;  3H0G B;  4L6T B;  1DD2 A;  1ET9 A;  5EKL A;  3D6W A;  1Y69 U;  2HUG A;  4XYO A;  3GO5 A;  3OHX C;  3RUZ A;  3P1H A;  4QF4 A;  1D2B A;  2O4X A;  4U67 3;  1HRJ A;  4QCL A;  1D1K A;  4BS9 A;  4UAI A;  2CW0 D;  2HCC A;  1STG A;  5FO9 B;  1Z6H A;  1GHJ A;  5JOB A;  4KJO A;  1TS2 A;  1U9R A;  3PV0 A;  1YNN C;  3GTO B;  2VXW A;  3DWP A;  3Q23 A;  4KJN A;  2VB3 X;  1E2W A;  3SHL A;  1S5E D;  4K5W A;  5CBE E;  5DEH A;  3M4Y A;  3NBI A;  3TP5 A;  1FNU A;  3M7G A;  1D5Z C;  1ZXT A;  4C3I B;  4WJW A;  1STN A;  3A7L A;  2F0P A;  1HUM A;  4B08 A;  1AW7 A;  2KCC A;  2PYK A;  4KY5 A;  4YIJ A;  3R2I A;  1QWY A;  2KA7 A;  3NQT A;  1DZ1 A;  3HOZ B;  1SNM A;  1GUT A;  4DNR B;  3NTI A;  1S5F D;  5C0X I;  3QJY A;  1PZI D;  1XX8 A;  3MC0 B;  3P20 A;  3T56 B;  2DY7 A;  2K04 A;  3S1N B;  4XQJ A;  1ONL A;  4NW2 A;  3C2P A;  1PYW D;  1DJR D;  3VR6 A;  2D62 A;  3C46 A;  3NTK A;  4A3F B;  1H9S B;  2FJ2 A;  2E2H B;  1AZP A;  5HGT A;  4IFD G;  3CRK C;  4XT1 B;  2F03 A;  5G3L D;  5E1F A;  4IFD J;  4FXG C;  5C5L A;  1JC7 A;  4CKE A;  1MSG A;  3P75 A;  1QNU A;  2RBM A;  3TME A;  4DFA A;  1WTW A;  2IWH A;  3U9S A;  3BYT B;  1I4H A;  3J80 L;  3L3O C;  1HFN A;  3VYR A;  3HOU B;  2JYO A;  1LT5 D;  2A6E D;  3ITP A;  5JEA H;  4H13 C;  1ZEQ X;  3S1Q B;  5BN4 A;  3NSW A;  4ID6 A;  1EFI D;  1M4V A;  3X3N A;  3HS0 C;  1ENA A;  2L0C A;  1JWS D;  5COR A;  5KIX A;  5EKK A;  4J6H A;  1PRT C;  1FR3 A;  5IGD A;  2R6G A;  1DYQ A;  4BA1 I;  1QJO A;  5M9O A;  1RF2 D;  1EWH A;  3HZX A;  2F0M A;  2WKC A;  1HTL D;  4C1N K;  1S5C D;  3NUC A;  2Z4I A;  4OO1 I;  2K5D A;  2EY6 A;  4ZQ3 A;  5C5M A;  2F0F A;  2I07 B;  3IFD A;  1SAP A;  4ZRZ A;  1EYD A;  1FYC A;  1S4Z A;  4PV1 C;  1W6K A;  4FYD A;  5D3I B;  1D6E C;  3SXH A;  1C48 A;  2ENB A;  5F2D A;  4RGO S;  4FXD A;  3V96 A;  1CK1 A;  1CI3 M;  4ZYS A;  2XWJ B;  2F0L A;  1K8O A;  4RGN A;  2K32 A;  1SJE D;  3C1F A;  3BS1 A;  1EYA A;  2KQ3 A;  4K6L A;  3TSS A;  5K36 G;  1VMC A;  2G9H D;  2EDG A;  2EXZ A;  1KTK A;  4NP5 A;  4ZAI A;  1TII D;  1KDB A;  1TU2 B;  2A68 C;  5EBD A;  1B2T A;  2WV6 D;  2WB1 B;  5C4X B;  3U9O A;  4KN7 C;  5CV6 A;  1STE A;  5CC4 A;  4C3I G;  3VA5 A;  1IW7 C;  3DXJ C;  4X3S A;  4M8A A;  3GTM B;  2TMP A;  3SR1 A;  1I4P A;  1EU3 A;  2L9H A;  1DXM A;  4IFD H;  2PW7 A;  3E0J A;  2MJ8 A;  3M7N A;  1EZ6 A;  2O5J C;  2WII B;  4KY6 A;  4U68 A;  1H9M A;  2LFN A;  2K01 A;  3I4N B;  1LTA D;  3EFX D;  3KBX A;  1QB5 D;  2Z8L A;  3I3C A;  2NVT B;  1WTR A;  3VR4 A;  1HQM C;  1HUN A;  2XRS D;  2YU9 B;  1I50 B;  1TVX A;  3SVM A;  2EYO A;  3OW7 A;  3TZU A;  1RJT A;  2K28 A;  2R61 A;  1OXS C;  5A35 A;  2F0O A;  3OWE B;  1JOQ A;  1YNN D;  1O80 A;  2EYP A;  4G57 A;  4L8J A;  2FHT A;  2B2V A;  3MFY A;  1EQT A;  2XWB B;  3FVQ A;  4ZUJ A;  4IUR A;  4A3D B;  3D8G A;  1A3V A;  2IT1 A;  2Q8R E;  4ULL A;  4V19 0;  3HOW B;  4QUC A;  2GA4 B;  2F1M A;  3J81 E;  1SFO B;  1V1P B;  5FKA C;  3CQZ B;  1SNO A;  1TWC B;  4G7O C;  2JA5 B;  1Q12 A;  3TP6 A;  3RMH A;  5A2Q L;  3MXN A;  4EVO A;  2R93 B;  1TR5 A;  3MA2 B;  3K5M A;  2B39 A;  3NK9 A;  4M1U B;  5E4X A;  2OXP A;  2EYL A;  4PMB A;  2SOB A;  1BXT A;  4CGY B;  3SEB A;  1JIC A;  2RVL A;  2B8G A;  2F0S A;  2RDH A;  4HCS A;  1TWG B;  4JK1 C;  1Q1E A;  5EGT A;  1A3T A;  1O7L A;  3LWU A;  3NP8 A;  4ILW A;  3D31 A;  1BBX C;  3JAM L;  2XNA C;  1Y8P B;  2RA4 A;  2MHV A;  3QWN A;  1TWF B;  1E2V A;  1A2T A;  1BNZ A;  1ZYR D;  4S3S A;  2ZXP A;  2NB0 A;  2BCO A;  3FKI B;  1NAP A;  4KY7 A;  1JOR A;  1KDC A;  2KVM A;  1RCV D;  3K7A B;  1FD7 D;  2NN6 I;  1D5X C;  4X3T A;  5J1Z A;  1LTG D;  1KLG D;  2JEA I;  2JXM B;  1X3P A;  4HSV A;  1X32 A;  4RAU C;  1DOM A;  4A3K B;  3BG3 A;  2B8F A;  2F0I A;  4P2C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...