2K7VA

Deletions in a surface loop divert the folding of a protein domain into a metastable dimeric form
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
85
structure length
85
Chain Sequence
MVKEVNVPDIVEVTEVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAAAPAKQE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrolipoyllysine-residue acetyltransferase component of p
publication title A surface loop directs conformational switching of a lipoyl domain between a folded and a novel misfolded structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k7vA00
1Y8PB 3GD7A 5K36H 2D5DA 1GUOA 1H9SA 3EQLC 1HPCA 3MXUA 5K36G 1IW7C 5BN5A 3A7LA 4TQUS 1VDZA 2A6HC 3I73A 1GUGA 4IFDH 3P20A 2D2CC 4G7OC 4BA1I 4IFDG 4I7ZC 5JEAH 1IW7D 2E76C 2BDOA 2F1MA 4OO1H 1QJOA 1E2VA 3OOCA 5JEAG 2A6HD 3AB9A 2CW0C 4OO1G 1GJXA 1ONLA 1YNJC 1OXSC 3ND9A 4KKUA 4KKTA 2PPBC 2PNRC 1LACA 1CTMA 3A8JE 3CRLC 1H9JA 2E74C 4XTCS 1T5EA 1FYCA 1IYVA 1SMYC 2EJMA 2EVBA 4H13C 4L8JA 1OXUA 3M4YA 1V8QA 2DNCA 2JEAI 3MFYA 2R6GA 1E2ZA 1PMRA 1HTPA 4JBWA 1VF7A 3LNNA 3VR3A 1OXTA 2YYZA 2JXMB 4DK0A 2JEBI 2EDGA 3PUVA 2PCFB 3PV0A 4KI0A 2D62A 1OXXK 3VR6A 4XIGS 3VA7A 1Q1EA 1EWHA 2KA7A 3T53B 4JK1C 2NN6I 2K32A 5KNDA 1LABA 2A68C 2K7VA 2KCCA 3A8IE 1O7LA 3D31A 3DXJC 1HQMC 3GQBA 2Q8IB 1K8MA 1Y8NB 3PUZA 4KN4C 1VCIA 3CRKC 1IYUA 2A68D 3ND8A 2DNEA 3PUWA 3W3AA 3A7AB 4KKSA 1Z7TA 3RLFA 3SDZA 3WDNA 5C0XH 2E75C 1CI3M 5C0XG 1A6XA 3SE0A 1K8OA 1H9RA 3BDOA 3PUXA 3A8KE 1O78A 1GUSA 4H0LC 3M85A 3FMCA 3VR2A 1GUNA 1Q12A 2EJGC 1VF5C 4TKOB 3OW7A 4DK1A 3FPPA 2O5IC 1DCZA 5A35A 4HR7B 2QF7A 1TU2B 1YNNC 3I72A 2IT1A 1ZKOA 3QG1A 2LMCB 4GZYC 3OPOA 1V43A 1Z6HA 2AUKA 2EJFC 3LWUA 4LJZC 3T51B 4KHZA 3TZUA 3U9SA 5BN3A 2K33A 1ZYRC 3NE5B 4OGQC 1BDOA 4KMUC 1GHJA 5KNCA 1H9SB 1FR3A 2B8FA 3IFTA 3L7ZC 2O5JC 4KN7C 3VR5A 4LK1C 3BG3A 3HGBA 1Y8OB 1G291 1B9MA 2AWOA 3KLRA 2A6EC 4DNTB 3QIAA 1GHKA 3D4RA 1GUTA 1E2WA 2L5TA 2A69C 3QJYA 4G7ZC 1OXVA 4DNRB 2BA1A 1Y69U 2A6ED 5KNBA 3I4LA 2A69D 2BE5C 1TKWB 1HCZA 4G7HC 4IQZA 3T56B 2DN8A 1I6VC 2ZT9C 4BA2I 1H9KA 2AUJD 3VR4A 3M7NA 1CFMA 3PUYA 2B8GA 1Q90A 2BE5D 2NN6H 1B9NA 2V4DA 1H9MA 3N6RA 4PV1C 4RCNA 3H94A 5BN4A 1Q1BA 2JE6I 2NN6G 2BA0A 3IKJA 1DD2A 4H44C 1DXMA
chains in the Genus database with same CATH superfamily
3GD7A 2CH4W 2EXZA 3TRZA 5C4HA 3P7JA 2ZM6L 2JA5H 4HCSA 4LF5L 4IFDH 2A5HA 2D2CC 1EOTA 5JEAH 2OT2A 4LWCA 2UU9Q 1OTCA 2F0SA 4QL5A 3KOJA 1BF4A 3S16B 1FVIA 2IL8A 3VYRA 1PDQA 2J4XA 4IOAA 3TS0A 1HA6A 4XTCS 4HJ8A 3NTHA 3ULJA 4DV6L 1T5EA 2SOBA 1PLFA 3K59A 3TN2A 3AQQA 3M4YA 3I70A 4R1JA 2QCPX 3EA6A 4ZCKA 1IZ6A 4C2MH 4GNXB 2LY7A 2WKCA 2RF4A 3RLOA 3STBD 1PV4A 1XTCD 5KRUA 1UEAB 2D62A 3K80C 2WACA 4XIGS 4CKCA 1TS2A 1D8LA 1DOMA 3HOXB 5KNDA 3GTLH 2JA8H 1LABA 2A68C 3CCLA 2CWPA 4DK6C 3I56A 1F77A 5ISRA 4DA2A 1EU3A 3BVMA 3NBIA 4P74A 4G7HC 2Z1CA 2R92B 1A62A 1U9RA 2HCCA 4N8FA 1IBKQ 3O13A 3TZDA 2EYFA 3DEPA 4B08A 3J7ZC 5IYCH 5G3LD 4JI2L 1VF5C 1N33L 3S1RB 2E2DC 3K7UC 4RG1A 3GTMH 1PZKD 1JJCB 4E6IA 4GKJQ 1JOKA 1TWCH 3A5UA 2HT1A 2PQAA 1PH1A 1RODA 4DV2Q 3ZYYX 4BXXH 3ER0A 3MFGA 1VQ6A 4WJ4A 1BXTA 2R7FA 1FNWA 2D9UA 1H9SB 2Z6KA 2J7ZA 2LKVA 5CORA 2I46A 3UE0A 3J81i 2HCIA 5DM63 5D3DA 1ZYRD 2IPKD 3MZ5A 5A2QE 4DNTB 3I4OA 3FKIH 4YWKA 2QGQA 1O7IA 4RMFA 3PQIA 1A15A 3T56B 5J22A 3NP8A 1EEFD 2NVQH 1L1OA 3SK6A 2NBFA 1I4XA 2Z9HA 2EYJA 2UUAL 3EN2A 1X3FA 1N34Q 2D5DA 3S1NB 3K7AB 2R93G 3NEMA 1EY6A 3P20A 1S4ZA 4OWTB 4A3KG 2Z0SA 4WRDA 5JOBA 1I4RA 4DXGA 4NKLA 1JORA 4BY7G 1TWGB 1QUQB 4S3SA 2E2JH 3HOYH 3ND9A 5FOBB 2E5LQ 2B29A 1N9WA 3E9HA 1E7ZA 1EUJA 4U673 2E74C 1B4OA 3HOVG 2UXCL 2NZ1D 3HRZC 4H13C 1JB3A 3AEVA 1I50B 5I2YA 4JBWA 5C4XH 1VF7A 1X56A 5FLMG 5LMNL 1UUPA 3F8TA 4RKBA 1YIJA 1GUWA 3E3XA 3RN2A 5IGCA 4KI0A 1D2BA 3SK4A 3PF5A 1KNAA 3UDIA 1EFID 5M5XH 2D0PA 1VQ7A 1U4PA 2KHIA 1LV9A 4RWSC 3T53B 2NN6I 1I6HH 2JA7H 4A3BB 4A3FG 1PH8A 1VMPA 4KJOA 1K8AC 3CRKC 4KTAA 1HZ9A 5C0XH 4JI3Q 1B70B 4CBVA 3D0FA 1K3BC 4DNIA 4K14A 3DM3A 1F9PA 4B3SL 3BZDB 2B2VC 2PZTA 1BQQT 3FMCA 1B50A 2PZWA 4M1UB 1WD1A 3M4OH 1HUNA 2EJGC 1KRTA 2PMZE 5IGGA 1ILPA 1LT5D 1DCZA 5A35A 2MP1A 4A3CG 1PHJA 1LM0A 2Z6BA 1NSNS 3H0GH 3LWUA 5J3BA 3KDFB 2R93B 2HQEA 1F2LA 3M3YB 1CM9A 4A3KB 1BR9A 2VXWA 1YHAA 3T1YQ 4BY7B 2NVTB 5EPKA 3CCUA 1XPOA 4X6AH 4MTKA 4QY7A 3KLRA 2JYOA 4JI7Q 2VQFQ 3HOVB 1EFWA 4K8JA 4ZUJA 4I65A 1P8LA 4IPGA 4NPSA 1SYFA 3G4SA 1JOOA 1ET9A 1DGSA 2ZJRA 4BA2I 2AUJD 3M7NA 4JYAQ 1EQVA 2EY6A 2ICIA 2F0UA 5JJZA 4DAYA 3DHQA 2JE6I 4Y7NH 1DD2A 1SE3A 1DXMA 1Y1WH 3EJIA 4GN3B 3NENA 4DK3C 1SROA 1AE2A 4YCWA 4MNOA 2B2YA 1PRTB 1Q8IA 1LTID 1E2VA 3CCMA 1ONLA 4KKTA 3H3VH 4GKKQ 4FXDA 1QOHA 1G6PA 1CTMA 3CRLC 4IUNA 1ML0D 1JWUD 1WTRA 2EQSA 4C3IH 2VUMH 4DV5Q 1KLUD 3STBC 1UEBA 4IFDJ 2XRQD 2UXDL 4HN7A 3WWVA 2B2UA 4DR2L 4BBRH 4R4TA 4YHHL 1PZID 4RFBA 5LL6X 2JA6G 1PXUA 1SNOA 2OTJA 4LFAQ 3ZJYC 4H02A 1A2TA 1RJTA 3ULPA 2HUGA 3TQYA 1EOVA 1X54A 3D6WA 2ZTEA 4B3RQ 1D7QA 3KLSX 3VYUA 3SDZA 1U4RA 2K1BA 2RVLA 4CJ2C 1A3UA 2AMCB 2RSOA 3C1EA 1KRSA 4L63B 3R93A 1L0YB 4CDEC 3T13A 2F0EA 1Q12A 5ELCA 5JAVA 2OQ0A 4DK1A 4OX9Q 3AMUA 4OIJA 2O5IC 2EY2A 1S3OA 2XN9C 1J9OA 1HR0W 4DR6Q 5IP7G 5JJIA 3CQZH 2IW3A 1ZYRC 4UAIA 4KMUC 3PF4A 1TVXA 1SSOA 1EY7A 2ZXRA 3CD6A 3NWTA 5KGUA 2F0IA 3GO5A 4J6HA 2HIXA 4GNXC 3IL8A 3S1QB 1QNKA 2L55A 4FYDA 4CJ1B 3RZDB 4HTHA 1JE5A 3BYTB 2F0TA 1BCPF 2KUMA 2N8NA 4L5SA 4QB4A 4RGNA 3PUYA 1SEBD 4RCNA 1H9MA 5M5WB 3H94A 2I5LX 2JA6B 2I0QA 3S15B 2OWOA 3BVZA 3S1MB 1L2FA 3PMFA 2I5MX 2PI2A 3J7YW 1WTXA 1EU4A 4LUOA 5FK9C 3OMGA 5EPLA 5LHY1 1H95A 3MXGA 3F1ZA 1QJOA 3SK8A 4IJLA 1RCVD 1K73C 4JV5L 5AJ3Q 1STGA 2PO4A 1C7YA 1YNJC 5HGTA 2AWNA 3I55A 4A3JH 1AEXA 1TS5A 5KEEA 5C3EG 3HKSA 2DNCA 2F0VA 1EIGA 1MHWC 3FVQA 3H91A 1TWAB 1SJHD 3VR3A 4JOIC 1AW7A 2SNSA 3X3MA 2EDGA 2K05A 3PV0A 3L3OC 1X3PA 3DWAA 2UU9L 1SFOB 4DU9A 2E2IH 1OXXK 1XMOQ 3U50C 5J1ZA 5IGFA 3PO2H 2KA7A 1HRJA 5HGQA 1LO5D 2QW7A 1JE4A 5EKLA 1CSQA 1HQMC 1VQCA 4J1MA 4POFA 2KENA 1ZXTA 5T1IA 1NY4A 3BDOA 1QVFA 1GUSA 1F9QA 2YTYA 2KCNA 5I9OA 2R7ZH 3DLLA 4K5WA 3OWFA 3WOFA 1TWFH 2J0TD 1PH4A 3BZCA 3TDQA 5FJ8H 3BVGA 4X66Q 1Q8KA 5M9OA 3F2UA 1CKNB 4A3GG 4AH6A 4C2MB 5C0XJ 3L9AX 1S5ED 4QCLA 2K33A 3TBIB 1IBKL 2RDGA 4HJ5A 3DWPA 1LLRD 4DF7A 3HGBA 4KY6A 3K57A 1Y1VG 2C35B 4A3MH 1SNQA 5IP9G 4GKJL 4EQOA 1V1PB 4DV2L 4NXMQ 1MGSA 4A93G 3HKZG 4ZLTF 1U5KA 3CCEA 3SVMA 2RCFA 3T16A 3NPPA 1IBMQ 5K36G 3G6JB 1PFNA 1YBYA 1VDZA 4A3IG 4EX5A 2FXQA 2VW9A 4CDDC 4HJAA 4DR3Q 2F0JA 1JMCA 1GJXA 4OO1G 5C44G 2PQAB 1OXSC 3S17H 1LACA 3I4NH 1I4GA 4FF2A 2QEJC 4KLKA 1N34L 4L8JA 3MXPA 4WJWA 1X6OA 1E2ZA 1HTPA 2K04A 3GV6A 4IPCA 3MEFA 5M3FG 2FFKB 1PYWD 1EY0A 4DK0A 2ICEC 2JEBI 2IX1A 2PCFB 3J7A5 4KY5A 3K8AA 2KCMA 3EFXD 2NVQB 3VA7A 3CMAA 2B2WC 1BNZA 2E5LL 5FKAC 1EQTA 1WTHA 3K0YA 4JK1C 2Q8TA 1I4HA 1K3RA 1HFNA 4AQYQ 4C3JG 3A8IE 4LW1A 1STYA 2A73B 3DXJC 1A3VA 1FGBD 4R4CA 4X64Q 4GLXA 4KN4C 4BWGB 4JG2A 1IYUA 2DNEA 3W3AA 1Z7TA 2IWHA 5LMUQ 4JI4Q 2RHQB 2DGYA 2K5QA 4ULLA 1I3QB 1VQMA 1AFPA 1XNQQ 3HOYB 2E2JB 3S14H 1KIXA 4K6LA 4APVA 3HKZB 3AFPA 1KAAA 2F0GA 1ZKOA 2RQXA 4EVOA 3H6MA 5C4XB 4LJZC 4B3MQ 1MKHA 4JI3L 3CC4A 3U58A 3I2ZA 4MIUA 3Q24A 4A3IB 2IY5B 1GVPA 1PH9A 2ES2A 1JWMD 5M5XB 3N52A 2B8FA 3HS0C 2MGSA 5C44B 2Q2TA 4IUQA 4OO1I 5T1GA 3SHLA 1I6HB 2O2LD 2JA7B 1WCMG 1W6KA 5E1FA 2D0OA 1XTDA 5EKIA 1ASZA 2A6ED 1WVLA 1X3EA 3FEWX 4JVZA 1TS4A 4GOPC 5M3FB 1H9KA 3VR4A 2B8GA 1PH7A 3HOUG 3E0EA 2KEEA 2NVYH 3C2PA 3T1YL 3M4OB 3FDTA 1Y8PB 4N8X1 1NAPA 3HOXG 3GTOB 4A3EH 2K52A 4LF8L 2VQEQ 4JI7L 2VQFL 4GN5A 4C3JB 4YCUA 1WTPA 1EZ6A 3EROA 2R92G 4YY3Q 5C4JH 4P2CB 2EOTA 4JYAL 2IJ0A 4KKUA 4Q5VA 4HSPA 2PNRC 1S40A 1G2SA 1H9JA 3URYA 5M3MH 3RMHA 3MTSA 3J81j 3A55A 4WFN3 1X3QA 1KAWA 3SR1A 1E1TA 1KDCA 1MI2A 1ZEQX 4LUVA 4OELB 1R9TH 1E22A 4DR5Q 5IE8A 1EYAA 2R61A 4DAPA 1ENAA 1TWHH 4FXGC 4JCVE 3PO3H 2XSCA 1DOLA 2M9VA 3TMEA 2R7DA 1G8ZD 4GKKL 2MQHA 4CKBA 4JC0A 1Y1WB 4DAYB 3U9OA 4DV5L 3RZOB 2N78A 5BR8Q 3PUZA 1VCIA 3GTJH 2K5WA 3ND8A 4PMCA 1WCMB 1LTSD 3KF8A 2E75C 1N36Q 4QIWB 1A6XA 1KDBA 4KHVA 3A56A 1WTVA 2A1AA 2JK8A 3CPFA 4IO9A 3UI2A 4FF1A 4LFAL 3V96A 3CPWA 1VQKA 3HOUB 3F2DA 1HNZQ 4C3IB 5IT9c 1PTOH 4XYQA 3OTOQ 3PIP3 4C56C 3OPOA 1LT4D 2JQOA 1V43A 2KBNA 3E0JA 4OONA 4QUFA 1VQBA 2B63H 4X3TA 5HY6A 4BBSG 4BBRB 4OWXB 2WAQB 1KHIA 4KN7C 3I4MH 2F0OA 2Q2HA 1XJVA 2A19A 2XNAC 4OX9L 3MXNB 5CV5A 4K8IA 2ZTCA 1HCZA 4DR6L 2C9OA 1VQIA 2F4IA 3J80i 1VQFA 1STHA 3NQIA 1CKMA 2EZVA 2NVXH 1PTOF 1D5XC 2M00A 4C3HH 2NN6G 1A63A 4LF6Q 1O7YA 3I90A 2L4NA 1J5EQ 1IHZA 4A3BG 3I7FA 3EVQA 1VQ4A 2OCEA 1SNDA 1GKHA 1GUGA 2L11A 3DUZA 1HJPA 1PYBA 4ME5A 4LFBQ 4G7OC 3OHXC 1EYGA 1I4QA 1AH9A 3CQZB 4OWWB 3NBHA 3PSIA 1SR3A 4P72A 2WB1G 2IX3A 3U4ZA 2HIVA 3E6ZX 5I6YA 1VQ9A 4DR4Q 4UY8C 1HQRD 4ILWA 1K9MC 2R6GA 5EGTA 1X32A 5EBCA 5IGBA 5FO7B 1M8AA 3I3CA 4FF4A 1SNCA 3KBXA 5IYBG 5AJ3L 1V1OA 1CZGA 4J8QA 4BBSB 4IPDA 4ZUIA 4P71A 1ICWA 1VQJA 2V1CC 3FHWA 5EKKA 3CF5A 4QQBX 3CCQA 3GQBA 1W2BA 3NHHA 4A3LH 2EXDA 1YNJD 3PUWA 3RLFA 4DAVA 3K5LA 3FPUB 5M5YH 1LT3D 3S2HH 3D4WA 2GVBA 3PUXA 1FNUA 2L1BA 1XMOL 3G71A 4B3RL 3BYYB 3L0OA 2YU9H 4XXEA 3CC7A 1QB5D 1GO3E 3HP3A 1XMQQ 4A3JB 1YHBA 1BCPD 5IYDG 1EY4A 3S2DH 1SNPA 1EYCA 5FO9B 3P1HA 2UUCQ 2MFIA 1D5ZC 4KD4A 2Z6KC 3R8BA 3IFTA 4NMZA 1Q86C 1C8CA 5EBDA 2A6EC 3K81C 2WB1B 3D4RA 1GUTA 1D6EC 3HOWG 2RCNA 1U4MA 3MC0B 4KV6A 4X66L 2DY7A 2YTVA 1JJGA 1DZ1A 3PIPA 4PMBA 4QMGA 1L1OC 1XNRQ 1MJCA 4XT3B 1LTBD 2N55A 3RUZA 1HFGA 5LMNW 5E4XA 3JAMc 1ICFB 4UDUC 4JI8Q 3I73A 2ENBA 3KF6A 3JAML 2ZJPA 3FRPB 4BS9A 3OWEB 4JI6Q 2GN5A 3GTKB 2CCZA 1RIPA 4NXML 1EL0A 3DWQA 1KABA 1VMCA 2BH2A 1IBML 1BUVT 4JBMA 2Y0SG 2TSSA 1KNEA 2PYKA 3FP9A 4A3MB 1FL0A 4DR3L 1II3A 1SBBB 2F0KA 2HQLA 2EE1A 2F0WA 1WFQA 3QB3A 5IGDA 2Q8RE 2ATWA 1Q1EA 2LXJA 3MWYW 1U4LA 2L0CA 1AN8A 2Z8LA 1PFBA 2F0FA 1PFMA 5D3IB 2HHHQ 3V2TA 4BY1H 1Q81C 1SYEA 3MAQA 5CMDA 1K8MA 4RGTA 3S16H 5GROA 3A7AB 4FO2A 4A76A 1BBUA 3HOWB 4C1NI 4K2KA 1CZWA 3HOZH 3A0JA 2K6AA 1S72A 4A3DH 3M85A 2DJGC 1JQYD 4FP5D 1HNXQ 2NB0A 3S17B 1GUNA 3I4NB 1NNXA 1EYDA 2PQEA 3OW7A 5CV4A 4DV7Q 3OSOA 4GOPB 4AQYL 1GXDC 1AZPA 2ZXOA 1QCBD 4X62Q 3KBGA 4X64L 2E2HH 3TP8A 3T51B 1I94Q 4G57A 2B3GA 2VY3A 3H15A 2WINB 5LMUL 4JI4L 1FR3A 5I9PA 1CQVA 1PH5A 1XNQL 3KUPA 1K83H 2NTSA 2NYZD 3QIAA 4R4QA 1J6QA 5C6AA 1NR4A 2CVRA 4IUPA 4OIKA 2NZHA 1Y69U 1A3TA 2C5CA 3A5ZB 1FNVA 2RKSA 3CW2C 4B3ML 4XDXA 1WTQA 2Y0SB 3J81c 4A75A 4UHVA 1Q90A 3J81L 2R3ZA 3ERQA 2BA0A 3HKZE 2TMPA 3S14B 1GUOA 1H9SA 3MXUA 1D5MC 3W2DA 4ALPA 1P16A 3KK7A 4ZRZA 5KYIA 1M4VA 1Q7YC 2JA5G 2QEXA 4I7ZC 3RN5A 4IFDG 4Y52H 2B2YC 2OQKA 4U68A 2XVSA 5JEAG 2DUDA 3D8GA 3H3VC 2F3IA 4LF9Q 3E5SA 4O0AA 1M1KC 1BOSA 5CR3A 3B6YA 4IALA 4GN4B 4DFAA 2NZOA 4HIOA 1BBXC 1DYQA 4O2DA 2VQEL 1UWVA 1SMYD 1OXTA 4NB3A 5H1SE 1VS0A 2B2UC 4K5VA 5IIFA 4YY3L 4RCOA 2F3WA 1DOKA 2BCOA 1RTNA 4R9WA 4P75A 3K7AH 1XXGA 5C5LA 2KHJA 2EYHA 2NVYB 1NUCA 1QUQA 2JA8G 3D6CA 1TWGH 1UNSA 5K5PA 2EYPA 4DN4M 1DM0B 3E9IA 5GAEC 3VYTA 2X6LA 1PH6A 3A8KE 1IL2A 4DR5L 1IKMA 4XQNA 1GOZA 4X3KA 1BCPC 4L5QA 3VDYA 4HEDA 4O1NA 4PMWA 4TKOB 5IYCG 2B2TA 2K75A 3ONAB 3FPPA 3Q22A 1SMXA 4P73A 2KQ3A 3W1BA 4TSSA 4FVMA 1VQNA 5BR8L 1HNWQ 2K03A 5EPJA 3LWEA 4L5TA 4KHZA 3TZUA 5J39A 1N36L 4BXXG 1EWCA 2JA5B 3NELA 3PO3B 2OF1A 1O80A 4IFDI 3BG3A 1LTLA 1KLGD 3JAME 1TY2A 5CBAE 2RBMA 1HNZL 1OXVA 1ILQA 5HURA 3FKIG 1KDAA 3OTOL 4QIWE 1STEA 3GTJB 1Q82C 4IQZA 4N9PA 1DONA 1QNUA 2N3SA 3TP7A 2Q2UA 2LFNA 2UUBQ 2V4DA 4PV1C 1HHVA 3OYYA 2F3VA 1YJWA 3IKJA 2EYMA 1PH2A 1N32Q 3PGZA 4XYOA 2R93H 1MSHA 3M4PA 1NMGA 4MZ9A 4L6TB 4TQUS 4A3KH 4EGVA 2EYOA 2VZAA 3AU7A 3GTLB 2JA8B 2VB3X 3PCOB 3CP0A 4BY7H 2NVTH 1XWEA 2WAQE 4ABNA 1SJED 2AKWB 4DV3Q 1S5CD 2NTTA 4JI1Q 3HOYG 3HOVH 1K28A 2F52A 4LF6L 3I4MB 4F88A 4LFCQ 2EVBA 1J5EL 1LT6D 1CA6A 1I4PA 4H7BA 5FLMH 3S24A 4YWLA 5C3WA 4ZK9B 5C5MA 5C4XG 4GLVB 4LFBL 4NP5A 1LYLA 3C46A 1UE6A 3GTMB 4IUTA 1JC7A 3KFUA 3GTQH 1TWCB 1UE7A 1TT2A 3UDGA 1EWHA 1HZAA 2NVXB 5GAGC 3MA2B 3LX0A 2JJQA 4IOCA 4A3FH 2K7VA 3Q6SA 2FHTA 2QILA 2JA7G 4DR4L 1Z47A 4ID6A 1CHPD 2LSSA 3WDNA 4HMJA 1CI3M 5C0XG 1JT8A 3FKIB 2F4VQ 2JSOA 3BS1A 4H0LC 4M8AA 1LTAD 3NQTA 2YTXA 1XPUA 4LNQA 4RHRA 3U4VA 4A3CH 4CDCC 1JR0D 1E3PA 1FGUA 1VQHA 2K5DA 3K5OA 1VQPA 2M2LA 1L1OB 3V05A 1PTOD 3PIO3 1EWIA 4G4KA 3J81E 5DAUA 5I4DA 3H0GG 4B9XA 5FLXc 2H4OA 1STBA 4UP9A 4R8IA 1HR0Q 1PRTF 4FNFA 1CQFA 4K2LA 3CC2A 5FLXL 4DXFA 2AQ3B 5F2DA 2F0DA 3DMUA 1SNMA 2HD3A 3D3RA 1M90C 1X3GA 4DKAC 1SYDA 1E2WA 1XMQL 1B3QA 1IXRA 2CWAA 3K58A 5KNBA 5I2XA 2CHBD 2A69D 4N9TA 1YJ9A 2UUCL 1HZCA 3TEHB 4X65Q 3T1HQ 3S2HB 5M5YB 2ID0A 4JW0A 1CFMA 3N6RA 3NTKA 3R3OA 5KYLA 2OTLA 1PVOA 2OEOA 2YU9B 3RLNA 2ZTDA 1Y1WG 1B8AA 2NUCA 4QF4A 3EQLC 4JI0Q 4DUZQ 1G2TA 3UE1A 3WOEA 1WJJA 4IUVA 2CW0C 1SYBA 3NXWA 2PPBC 1XNRL 3TSSA 3GP7A 1A8VA 3M9BA 2WB1E 5C0XI 4BY1G 2MO1A 3VA5A 1HUMA 1SMYC 4R4IA 5EQ0A 4C3IG 2VUMG 1B2TA 1V9PA 4JI8L 1CHQD 1QILA 3AYHB 5M5WH 3K5NA 2JA6H 4R4OA 1T5XD 4JI6L 3VR6A 4BBRG 1STNA 1VQDA 3OMCA 5CV6A 5GQOA 3H0GB 1SXTA 2WAQG 5EAYA 3SEBA 2L12A 2KCTA 4OHJA 1A0IA 2XIWA 4X3UA 4AYBG 3UDFA 1UE5A 2UXBQ 4PZ6A 3KF6B 1XPRA 4RGOS 4EQNA 3Q23A 2AQ2B 4JBJA 3SXHA 2RSNA 2IX0A 3GTPH 4J15A 2QF7A 3CCJA 1SFOH 2HHHL 2CH4A 4Y7NB 5JPMC 5JPNC 1AZQA 2PW7A 1E1OA 5IP7H 4UP7A 4B3TQ 3KJPA 4QGUA 4TVAB 4DV4Q 1PYSB 1W3SA 1C0AA 3CAMA 2F0PA 1NJIC 1HNXL 1G291 1SYGA 4DV7L 3GDEA 4G7ZC 1KL9A 2B39A 4BY1B 4X62L 3H3VI 2CQAA 4IZ8A 2VUMB 3CCRA 1I94L 3TP5A 3ERSX 3PIOA 4GS3A 3HOZB 1CKNA 5IT9L 1IKLA 4A3DB 2H5XA 4HAEA 1NTGA 3W5OA 1SDFA 4LF7Q 1EZ8A 1F2ZA 1YZ6A 2E2HB 2BDOA 2JN4A 4FF3A 1EIHA 4AYBB 1CK1A 4RAUC 5DLQE 3TP6A 1SN8A 1EEID 1B44D 3KLSA 1K83B 1V1PA 4K0KQ 1KXLA 5C3EH 1J8IA 2EJMA 5ELFA 1MJEA 4A3JG 2JEAI 1V8QA 1EIFA 3SK5A 3MFYA 4NXNQ 5IGEA 1O7ZA 4RHSA 4KHPQ 1BCPB 2P5ZX 2Y0SE 4LAAA 2F0LA 2JXMB 2N88A 2DJFC 4IUUA 3ULLA 4XQQA 3QOJA 4MHEA 1IL8A 4LF9L 1ET6A 2PZUA 2AHOB 2BOSA 3PO2G 3J7AV 4ZKCB 4ZYSA 4TRDA 3CHBD 5FO8B 2WIIB 2RDFA 1O7LA 1SE8A 5IWAQ 4DUYQ 5EJWA 1I5FA 5FLXE 1CA5A 1SLJA 3SE0A 1HXYD 3CKIB 4RH6A 1WOCA 1UAPA 2B2VA 3M4QA 3KYHC 2JA9A 1Z9FA 1NR2A 2R7ZG 3MEHA 2HDMA 4ME3A 1PTOC 1PH3A 5D14A 4JI5Q 2OXPA 4A3GH 1QE6A 5FJ8G 4GZYC 1RKNA 4ODGA 5BN3A 4DV1Q 1QVGA 4CDFC 1NCVA 1SYCA 4NW2A 4XT1B 4PZ7A 4DR7Q 4DR1Q 2N49A 3R2TA 1F2MA 1Y1VH 2A69C 2G9HD 1QZHA 1YNXA 4R8NA 1F2YA 3NTIA 1I3QH 5IP9H 3R2IA 2KEDA 4JBKA 1S5BD 4X3SA 1HNWL 3IFDA 4A3MG 3CCSA 1G6ZA 2ASBA 1FJGQ 3G7LA 4A93H 1BBWA 4KK7A 1QZGA 3A74A 5ELNA 2IHEA 1JCKB 1F9SA 4H44C 1F9RA 5K36H 2E2IB 1TQOA 2RDHA 1HPCA 3NWSA 4A3IH 5KIXA 1G91A 3PO2B 1C4QA 4RA8A 1YJNA 4PG3A 2PW5A 1R4PB 2FINB 4OO1H 1D1IA 3OOCA 3QOLA 2A6HD 5C44H 4FDBA 2EPBA 3RD4A 1HZBA 2UUBL 1E24A 2WP8J 3GTGH 3I4NG 4HJ7A 2K01A 1N32L 4XQJA 1K0SA 1YVCA 2R7ZB 5M3FH 1OO9B 1TWFB 2BH8A 2YYZA 1NMFA 4OL7A 3PUVA 1EQQA 5JVG3 3RR5A 3GTOH 2GVAA 4DV3L 2EYLA 4ZQ3A 2VNUD 1YEZA 1D1KA 4JI1L 1W6JA 1QWYA 4HSVA 4C3JH 5IY0A 3K0XA 1VQ5A 2XTIA 3JC66 3H09A 4LFCL 3NUCA 3D31A 2Q8IB 1ENCA 4YCVA 4KKSA 1L0XB 1HTLD 2H1EA 3DEOA 1O78A 2FJ2A 4C1NK 4LF8Q 2XRSD 2LXKA 1LTTD 3OIQA 2VS1A 4DV0Q 1MIUA 4KD3A 5CV9A 1HA5A 2IT1A 2KECA 2QDBA 3QG1A 1QVCA 1B3AA 2K28A 2AUKA 5IT9E 4LF4Q 5I6WA 5IODA 1YNND 2F4VL 1BDOA 3C1FA 1XX8A 2Q2IA 2XWJB 4CKEA 1IBLQ 3GTQB 3RZOH 4GLAC 4HCEA 4LK1C 3VR5A 5GAHC 2F03A 1B9MA 1WCMH 4GNXA 4QUCA 2K5VA 4A3FB 2SEBD 4V0BA 2ZM6Q 4LF5Q 1AE3A 4HIMA 4IN3A 5G3LF 2EY5A 1B7YB 2GA4B 4YIJA 1K8GA 3I4LA 4MTNA 1AP0A 3K5MA 5LL6S 1BKBA 2F0QA 1VQLA 1X9NA 2KJXA 4HMIA 3TREA 2ZT9C 1JJ2A 1HR0L 3AFQA 2RHSB 3HOUH 5BN4A 4IPHA 1Q46A 4DV6Q 3HOXH 5IOCA 4WORA 2MO0A 4IJHA 4KY7A 5JEAJ 1SE4A 1IYJB 1KTKA 4A3EG 3MHBA 3J80c 5E4WC 2R92H 1IW7D 2E76C 2QA4A 1X65A 3J80L 3T1HL 4X65L 1YHQA 2CFMA 3MXNA 1EY9A 2PNHA 3QO2A 3J7AF 1CKOA 1ENFA 1A2UA 3S1RH 3M7GA 5ELBA 5M3MG 1KQSA 5CV8A 5CYUA 2VL6A 4JI0L 4DUZL 3LNNA 1DJRD 4JOIA 1MD2D 3BZKA 1VQGA 1JOQA 3T4AC 1SRUA 2SDFA 3PO3G 4RGMA 1TR5A 1GD7A 4JI2Q 1YI2A 1N33Q 4DPGA 4EQPA 1JWSD 1TS3A 3HEJA 1YITA 1PRTD 1S5FD 2CW0D 5ELOA 3G6EA 2MNAA 1K0RA 3NSWA 3ICEA 3HZXA 1K8OA 3I8ZA 1GM5A 1WI5A 3VR2A 2XWBB 1WTWA 2NWGA 3S1NH 2K50A 3NK9A 4HR7B 2ALYB 3HG9A 1HH2P 3MVVA 2I5HA 5L37A 3P75A 1Z6HA 1TXYA 3BJUA 4A3EB 4BBSH 2B63G 3U9SA 2DY8A 2VB2X 3NE5B 2UXBL 3IAYA 1EY8A 1GHJA 3GV3A 2UUAQ 5CV7A 4NDXA 4CHTB 2O5JC 4OXPA 1Y8OB 1VQ8A 4EQ5A 5C4JB 3I4MG 2F0HA 1GHKA 1I50H 1TIID 4DNRB 2BA1A 3BU2A 2K4KA 3I91A 5M3MB 1B53A 3LGJA 3HFZB 1EIYB 4B3TL 1E0BA 4DV4L 5ELDA 2BE5D 2NN6H 1R9TB 2UXCQ 1FD7D 4C3HG 3ITPA 4A3BH 2O4XA 1TWHB 3BDLA 3G48A 1RF2D 4F87A 3S9WA 3GTPB 1VQOA 2A6HC 5LMNQ 2HDLA 4BA1I 1BO0A 1LTRD 4F7XA 2CKZB 2JP1A 2Z4IA 3AB9A 1S5DD 1VQEA 3CMEA 1KD1C 1ESRA 1FYCA 3KF8B 4LF7L 1G51A 1OXUA 2PMZB 1LTGD 3KDFA 1PMRA 2F0MA 4B9WA 2MJ8A 3M3YH 5IYBH 1PTOB 4IURA 4AIMA 2FMCA 1RL2A 3D4DA 2YV5A 4B3SQ 3VYSA 2B2WA 3Q8DA 2B63B 4PQXA 3BDCA 3DM1A 3C3LA 1Q3LA 4K0KL 1X55A 2KCCA 2LS01 5COYA 1WYDA 3GTKH 1Y8NB 4HJ9A 1WD0A 4NXNL 2A68D 4AYBE 4A3LG 4KHPL 4LUZA 4K5XA 1H9RA 4RKLA 3KLWA 4L5RC 2X69A 5DM73 1QG7A 2Z4HA 5GADC 4OEMB 5IYDH 2B2TC 2BDNA 5CGKA 5C3EB 1KC8C 2WKDA 1Y14B 3SGIA 1YNNC 3I72A 4C3HB 5IWAL 3Q0AA 4DUYL 1C48A 4JPBW 4UPAA 3UDXA 2MPMA 2SNMA 4I7AA 5KNCA 1WTOA 4CGYB 1V1QA 4FXKC 2FMMA 4CJ0B 1SAPA 5TSSA 3L7ZC 5JJLA 3W1GA 4PZ8A 1RHPA 5CC4A 1JICA 2A74C 1CT1D 2G5DA 3HOWH 2L5TA 1EQRA 3QJYA 3CCVA 4JI5L 5D65A 3IRBA 3NBHB 3J80E 2K14A 2ZXPA 2CQOA 1TKWB 4GOPA 1TY0A 2QKIC 1MSGA 4F8MA 3OW2A 2A8VA 2DN8A 1I6VC 4DV1L 2WFWA 5JJKA 4QJFA 5C3XA 1Q1BA 3F2CA 4DR7L 3OIPA 1RDPD 4DR1L 1PFSA 1C9OA 5DEHA 1IW7C 5A2QL 2L9HA 1ESFA 3A7LA 5BN5A 1ASYA 2XGTA 4A3GB 2UXDQ 1N8RC 1R4QB 2EIFA 2RA4A 1NBWA 4LMQD 3F2BA 2E8GA 4DR2Q 2F1MA 4YHHQ 2PI2E 1VQAA 1FJGL 4O42A 5C4ZA 4ZKBB 3A8JE 1UE1A 3K6OA 4KJNA 1IYVA 1Y1VB 4DAMA 1STAA 5DNFA 1CSPA 5NUCA 4K6DA 4POGA 3CXCA 3X3NA 4A4IA 4DGZA 5JVH3 2ZJQA 3A54A 4HIDA 3S2DB 2WV6D 4UP8A 4A93B 3KJOA 2K5NA 3EBEA 1PRTC 2K32A 2X6GA 4HIKA 3EIVA 3S1QH 5CBEE 3RZDH 4WJ3M 2KHSA 1RTOA 2K5HA 4MN3A 5E7NA 1CUKA 3L2PA 3HOZG 3CU7A 1SE2A 2F0NA 2I07B 4A3DG 3GTGB 3S15H 3S1MH 1U0LA 4ZAIA 3QWNA 1B1ZA 1RD9D 1PA6A 1TU2B 2LMCB 2EJFC 3RNUA 1XYIA 5ELEA 5E3FA 1T9HA 4OGQC 2KOLA 1LUZA 2MUYA 2L15A 1MBYA 2AWOA 1JB7A 4V190 4DV0L 2QDLA 1PZJD 1NE3A 1TWAH 3TS2A 2EY1A 5AFWA 2KVMA 3JAMi 2BE5C 2MHVA 4Q0FA 4LF4L 4Z9CB 4JV5Q 1BVSA 1L0WA 1B9NA 4PNYA 2AQ1B 2IHFA 1EY5A 4YWMA 1IBLL 2G9DA 3QR8A
chains in the Genus database with same CATH topology
3GD7A 2EXZA 5C4HA 3P7JA 4HCSA 4IFDH 2A5HA 2D2CC 1EOTA 5JEAH 2OT2A 2F0SA 1BF4A 3S16B 2IL8A 3VYRA 1PDQA 2J4XA 1HA6A 4XTCS 3NTHA 1T5EA 2SOBA 1PLFA 3K59A 3TN2A 3M4YA 3I70A 2QCPX 3EA6A 2LY7A 2WKCA 1XTCD 5KRUA 1UEAB 2D62A 2WACA 4XIGS 4CKCA 1TS2A 1DOMA 3HOXB 5KNDA 1LABA 2A68C 1F77A 5ISRA 4DA2A 1EU3A 3BVMA 3NBIA 4G7HC 2Z1CA 2R92B 1U9RA 2HCCA 3O13A 3TZDA 2EYFA 3DEPA 4B08A 5G3LD 1VF5C 3S1RB 2E2DC 1PZKD 4E6IA 1JOKA 1RODA 3ZYYX 3MFGA 1BXTA 1FNWA 2D9UA 1H9SB 2J7ZA 2LKVA 5CORA 2I46A 2HCIA 5DM63 5D3DA 1ZYRD 2IPKD 3MZ5A 5A2QE 4DNTB 1A15A 3T56B 5J22A 3NP8A 1EEFD 3SK6A 2NBFA 1I4XA 2EYJA 2D5DA 3S1NB 3K7AB 1EY6A 3P20A 1S4ZA 4WRDA 5JOBA 1I4RA 4DXGA 4NKLA 1JORA 1TWGB 4S3SA 3ND9A 5FOBB 4U673 2E74C 1B4OA 2NZ1D 3HRZC 4H13C 1JB3A 1I50B 5I2YA 4JBWA 1VF7A 1UUPA 4RKBA 1GUWA 5IGCA 4KI0A 1D2BA 3SK4A 1KNAA 1EFID 1U4PA 1LV9A 4RWSC 3T53B 2NN6I 4A3BB 1VMPA 4KJOA 3CRKC 4KTAA 5C0XH 4CBVA 4K14A 1F9PA 3BZDB 2B2VC 2PZTA 1BQQT 3FMCA 1B50A 2PZWA 4M1UB 1WD1A 1HUNA 2EJGC 5IGGA 1ILPA 1LT5D 1DCZA 5A35A 2MP1A 1NSNS 3LWUA 2R93B 2HQEA 1F2LA 3M3YB 1CM9A 4A3KB 1BR9A 2VXWA 4BY7B 2NVTB 5EPKA 3KLRA 2JYOA 3HOVB 4K8JA 4ZUJA 4I65A 1SYFA 1JOOA 1ET9A 4BA2I 2AUJD 3M7NA 1EQVA 2EY6A 2ICIA 2F0UA 5JJZA 4DAYA 3DHQA 2JE6I 1DD2A 1SE3A 1DXMA 3EJIA 2B2YA 1PRTB 1Q8IA 1LTID 1E2VA 1ONLA 4KKTA 4FXDA 1QOHA 1CTMA 3CRLC 4IUNA 1ML0D 1JWUD 1WTRA 1KLUD 4IFDJ 2XRQD 4HN7A 2B2UA 1PZID 4RFBA 5LL6X 1PXUA 1SNOA 1A2TA 1RJTA 2HUGA 3D6WA 3KLSX 3VYUA 3SDZA 1U4RA 2K1BA 2RVLA 4CJ2C 1A3UA 2RSOA 3C1EA 4L63B 3R93A 1L0YB 3T13A 2F0EA 1Q12A 5ELCA 5JAVA 4DK1A 3AMUA 4OIJA 2O5IC 2EY2A 2XN9C 1J9OA 2IW3A 1ZYRC 4UAIA 4KMUC 1TVXA 1SSOA 1EY7A 2ZXRA 3NWTA 5KGUA 2F0IA 3GO5A 4J6HA 3IL8A 3S1QB 1QNKA 2L55A 4FYDA 4CJ1B 3RZDB 4HTHA 3BYTB 2F0TA 1BCPF 2KUMA 4QB4A 4RGNA 3PUYA 1SEBD 4RCNA 1H9MA 5M5WB 3H94A 2JA6B 3S15B 3S1MB 3BVZA 3PMFA 3J7YW 1WTXA 1EU4A 5FK9C 3OMGA 5EPLA 5LHY1 3MXGA 1QJOA 3SK8A 1RCVD 1STGA 2PO4A 1YNJC 5HGTA 2AWNA 1AEXA 1TS5A 5KEEA 2DNCA 2F0VA 1EIGA 3FVQA 3H91A 1TWAB 1SJHD 3VR3A 1AW7A 2SNSA 3X3MA 2EDGA 2K05A 3L3OC 3PV0A 1X3PA 3DWAA 1SFOB 4DU9A 1OXXK 5J1ZA 5IGFA 2KA7A 1HRJA 1LO5D 1JE4A 5EKLA 1HQMC 4J1MA 5T1IA 1ZXTA 3BDOA 1GUSA 1F9QA 2KCNA 5I9OA 4K5WA 3OWFA 3WOFA 2J0TD 3TDQA 3BVGA 5M9OA 3F2UA 4C2MB 5C0XJ 3L9AX 1S5ED 4QCLA 2K33A 3TBIB 2RDGA 3DWPA 1LLRD 4DF7A 3HGBA 4KY6A 3K57A 1SNQA 4EQOA 1V1PB 1MGSA 4ZLTF 3SVMA 3T16A 3NPPA 5K36G 3G6JB 1PFNA 1VDZA 2F0JA 1GJXA 4OO1G 1OXSC 1LACA 1I4GA 4FF2A 2QEJC 4L8JA 3MXPA 4WJWA 1E2ZA 1HTPA 2K04A 3GV6A 2FFKB 1PYWD 1EY0A 4DK0A 2ICEC 2JEBI 2IX1A 2PCFB 4KY5A 3EFXD 2NVQB 3VA7A 2B2WC 1BNZA 5FKAC 1EQTA 3K0YA 4JK1C 2Q8TA 1I4HA 1HFNA 4C3JG 3A8IE 1STYA 2A73B 3DXJC 1A3VA 1FGBD 4KN4C 4BWGB 1IYUA 2DNEA 3W3AA 1Z7TA 2IWHA 2K5QA 4ULLA 1I3QB 1AFPA 2E2JB 3HOYB 4K6LA 3HKZB 1KAAA 2F0GA 1ZKOA 2RQXA 4EVOA 3H6MA 5C4XB 4LJZC 4MIUA 3Q24A 4A3IB 1JWMD 5M5XB 3N52A 2B8FA 3HS0C 2MGSA 5C44B 4IUQA 4OO1I 5T1GA 3SHLA 1I6HB 2O2LD 2JA7B 1W6KA 5E1FA 5EKIA 2A6ED 1WVLA 3FEWX 1TS4A 5M3FB 1H9KA 3VR4A 2B8GA 2KEEA 3C2PA 3M4OB 3FDTA 1Y8PB 1NAPA 3GTOB 4C3JB 1WTPA 1EZ6A 3EROA 4P2CB 2EOTA 2IJ0A 4KKUA 4Q5VA 4HSPA 2PNRC 1G2SA 1H9JA 3URYA 3RMHA 3MTSA 3A55A 4WFN3 1X3QA 3SR1A 1KDCA 1MI2A 1ZEQX 1EYAA 2R61A 4DAPA 1ENAA 4FXGC 2XSCA 1DOLA 2M9VA 3TMEA 1G8ZD 4CKBA 1Y1WB 3U9OA 3RZOB 3PUZA 1VCIA 2K5WA 3ND8A 4PMCA 1WCMB 1LTSD 3KF8A 2E75C 4QIWB 1A6XA 1KDBA 4KHVA 3A56A 1WTVA 3UI2A 4FF1A 3V96A 3HOUB 4C3IB 1PTOH 4XYQA 3PIP3 4C56C 1LT4D 3OPOA 1V43A 3E0JA 4QUFA 4X3TA 4BBRB 2WAQB 4KN7C 2F0OA 2XNAC 5CV5A 4K8IA 1HCZA 2C9OA 2F4IA 1STHA 3NQIA 2EZVA 1PTOF 1D5XC 2M00A 2NN6G 1O7YA 3I90A 2L4NA 1IHZA 3EVQA 1SNDA 1GUGA 2L11A 3DUZA 4ME5A 4G7OC 3OHXC 1I4QA 3CQZB 3NBHA 2IX3A 3E6ZX 5I6YA 1HQRD 4ILWA 2R6GA 5EGTA 1X32A 5EBCA 5IGBA 5FO7B 1M8AA 3I3CA 4FF4A 1SNCA 3KBXA 1V1OA 1CZGA 4J8QA 4BBSB 4ZUIA 1ICWA 5EKKA 3GQBA 3NHHA 1YNJD 3PUWA 3RLFA 4DAVA 3K5LA 3FPUB 1LT3D 3D4WA 3PUXA 1FNUA 2L1BA 3BYYB 4XXEA 1QB5D 3HP3A 4A3JB 1BCPD 1EY4A 1SNPA 1EYCA 5FO9B 3P1HA 1D5ZC 4KD4A 3R8BA 3IFTA 4NMZA 1C8CA 5EBDA 2A6EC 2WB1B 3D4RA 1GUTA 1D6EC 1U4MA 3MC0B 4KV6A 2DY7A 1DZ1A 4PMBA 4QMGA 4XT3B 1LTBD 2N55A 3RUZA 1HFGA 5E4XA 4UDUC 3I73A 2ENBA 3JAML 3FRPB 4BS9A 3OWEB 3GTKB 1EL0A 3DWQA 1KABA 1VMCA 1BUVT 2TSSA 1KNEA 2PYKA 4A3MB 1II3A 1SBBB 2F0KA 2EE1A 2F0WA 3QB3A 5IGDA 2Q8RE 1Q1EA 3MWYW 1U4LA 2L0CA 1AN8A 2Z8LA 1PFBA 2F0FA 1PFMA 5D3IB 3V2TA 1SYEA 3MAQA 5CMDA 1K8MA 4RGTA 3A7AB 4FO2A 3HOWB 4C1NI 4K2KA 1CZWA 2K6AA 3M85A 1JQYD 4FP5D 2NB0A 3S17B 1GUNA 3I4NB 1EYDA 2PQEA 3OW7A 5CV4A 3OSOA 1AZPA 1GXDC 2ZXOA 1QCBD 3KBGA 3TP8A 3T51B 4G57A 2WINB 1FR3A 5I9PA 1CQVA 3KUPA 2NTSA 2NYZD 3QIAA 5C6AA 1NR4A 2CVRA 4IUPA 4OIKA 1Y69U 1A3TA 2C5CA 1FNVA 2RKSA 4XDXA 1WTQA 2Y0SB 1Q90A 3J81L 2R3ZA 3ERQA 2BA0A 2TMPA 3S14B 1GUOA 1H9SA 3MXUA 1D5MC 3W2DA 3KK7A 4ZRZA 5KYIA 1M4VA 4IFDG 4I7ZC 2B2YC 4U68A 2XVSA 5JEAG 3D8GA 3H3VC 3E5SA 1BOSA 5CR3A 4IALA 4DFAA 1BBXC 1DYQA 1SMYD 1OXTA 2B2UC 4K5VA 5IIFA 4RCOA 2F3WA 1DOKA 2BCOA 1RTNA 4R9WA 1XXGA 5C5LA 2EYHA 2NVYB 1NUCA 3D6CA 1UNSA 5K5PA 2EYPA 4DN4M 1DM0B 3VYTA 2X6LA 3A8KE 1IKMA 4XQNA 1GOZA 4X3KA 1BCPC 4HEDA 4O1NA 4PMWA 4TKOB 2B2TA 3ONAB 3FPPA 3Q22A 2KQ3A 4TSSA 4FVMA 2K03A 5EPJA 3LWEA 4KHZA 3TZUA 5J39A 1EWCA 2JA5B 3PO3B 2OF1A 1O80A 4IFDI 3BG3A 1KLGD 3JAME 1TY2A 5CBAE 2RBMA 1OXVA 1ILQA 5HURA 1KDAA 1STEA 3GTJB 4IQZA 4N9PA 1DONA 1QNUA 3TP7A 2LFNA 2V4DA 4PV1C 1HHVA 2F3VA 3IKJA 2EYMA 4XYOA 1MSHA 4L6TB 4TQUS 4EGVA 2EYOA 3AU7A 3GTLB 2JA8B 2VB3X 1XWEA 4ABNA 1SJED 1S5CD 2NTTA 3I4MB 4F88A 2EVBA 1LT6D 1CA6A 1I4PA 4H7BA 5C3WA 4ZK9B 5C5MA 4NP5A 3C46A 3GTMB 4IUTA 1JC7A 1TWCB 1TT2A 1EWHA 2NVXB 3MA2B 3LX0A 2K7VA 3Q6SA 2FHTA 2QILA 1Z47A 4ID6A 1CHPD 3WDNA 4HMJA 1CI3M 5C0XG 3FKIB 2JSOA 3BS1A 4H0LC 4M8AA 1LTAD 3NQTA 4RHRA 1JR0D 2K5DA 3K5OA 2M2LA 3V05A 1PTOD 3PIO3 4G4KA 3J81E 5DAUA 5I4DA 4B9XA 2H4OA 1STBA 4R8IA 1PRTF 4FNFA 1CQFA 4K2LA 5FLXL 4DXFA 2AQ3B 5F2DA 2F0DA 3DMUA 1SNMA 3D3RA 1SYDA 1E2WA 3K58A 5KNBA 5I2XA 2CHBD 2A69D 4N9TA 5M5YB 3S2HB 2ID0A 1CFMA 3N6RA 3NTKA 3R3OA 5KYLA 2OEOA 2YU9B 2NUCA 4QF4A 3EQLC 1G2TA 3WOEA 4IUVA 2CW0C 1SYBA 3NXWA 2PPBC 3TSSA 3GP7A 5C0XI 3VA5A 1HUMA 1SMYC 5EQ0A 4C3IG 1B2TA 1CHQD 1QILA 3K5NA 1T5XD 3VR6A 1STNA 3OMCA 5CV6A 3H0GB 1SXTA 3SEBA 2L12A 4OHJA 2XIWA 4X3UA 4RGOS 4EQNA 3Q23A 2AQ2B 3SXHA 2RSNA 2IX0A 2QF7A 4Y7NB 5JPMC 5JPNC 1AZQA 2PW7A 2F0PA 1G291 1SYGA 4G7ZC 2B39A 4BY1B 2CQAA 4IZ8A 2VUMB 3TP5A 3HOZB 5IT9L 1IKLA 4A3DB 4HAEA 1SDFA 1EZ8A 1F2ZA 2E2HB 2BDOA 4FF3A 1EIHA 4AYBB 1CK1A 4RAUC 3TP6A 1EEID 1B44D 3KLSA 1K83B 1V1PA 1J8IA 2EJMA 5ELFA 2JEAI 1V8QA 3SK5A 3MFYA 5IGEA 1O7ZA 4RHSA 1BCPB 4LAAA 2F0LA 2JXMB 2N88A 4IUUA 4XQQA 3QOJA 4MHEA 1IL8A 1ET6A 2PZUA 2BOSA 3J7AV 4ZKCB 4ZYSA 4TRDA 3CHBD 5FO8B 2WIIB 2RDFA 1O7LA 5EJWA 5FLXE 1CA5A 3SE0A 1HXYD 3CKIB 4RH6A 1UAPA 2B2VA 1NR2A 3MEHA 2HDMA 1PTOC 5D14A 2OXPA 1QE6A 4GZYC 1RKNA 4ODGA 5BN3A 1NCVA 1SYCA 4NW2A 4XT1B 3R2TA 1F2MA 2A69C 2G9HD 4R8NA 1F2YA 3NTIA 3R2IA 2KEDA 1S5BD 4X3SA 3IFDA 1G6ZA 3G7LA 4KK7A 1JCKB 1F9SA 4H44C 1F9RA 5K36H 2E2IB 1TQOA 2RDHA 1HPCA 3NWSA 5KIXA 1G91A 3PO2B 1C4QA 4RA8A 2PW5A 1R4PB 2FINB 4OO1H 1D1IA 3OOCA 3QOLA 2A6HD 2EPBA 3RD4A 2WP8J 2K01A 4XQJA 2R7ZB 1OO9B 1TWFB 2YYZA 4OL7A 3PUVA 5JVG3 2EYLA 4ZQ3A 2VNUD 1D1KA 1W6JA 1QWYA 4HSVA 3H09A 3NUCA 3D31A 2Q8IB 1ENCA 4KKSA 1L0XB 1HTLD 2H1EA 3DEOA 1O78A 2FJ2A 4C1NK 2XRSD 1LTTD 3OIQA 4KD3A 5CV9A 1HA5A 2IT1A 2KECA 2QDBA 3QG1A 1B3AA 2K28A 2AUKA 5IT9E 5I6WA 5IODA 1YNND 1BDOA 3C1FA 1XX8A 2XWJB 4CKEA 3GTQB 4HCEA 3VR5A 4LK1C 2F03A 1B9MA 4QUCA 4A3FB 2SEBD 4V0BA 4IN3A 5G3LF 2EY5A 2GA4B 4YIJA 3I4LA 1AP0A 3K5MA 5LL6S 2F0QA 2KJXA 4HMIA 2ZT9C 5BN4A 5IOCA 4WORA 4KY7A 5JEAJ 1SE4A 1KTKA 3MHBA 5E4WC 1IW7D 2E76C 3J80L 3MXNA 1EY9A 3QO2A 3J7AF 1ENFA 1A2UA 3M7GA 5ELBA 5CV8A 5CYUA 3LNNA 1DJRD 1MD2D 1JOQA 3T4AC 2SDFA 4RGMA 1TR5A 4EQPA 1JWSD 1TS3A 3HEJA 1PRTD 1S5FD 2CW0D 3NSWA 3HZXA 1K8OA 3I8ZA 3VR2A 2XWBB 1WTWA 2NWGA 3NK9A 4HR7B 3HG9A 3MVVA 3P75A 1Z6HA 4A3EB 3U9SA 2DY8A 2VB2X 3NE5B 3IAYA 1EY8A 1GHJA 3GV3A 5CV7A 4NDXA 4CHTB 2O5JC 1Y8OB 5C4JB 1GHKA 2F0HA 1TIID 4DNRB 2BA1A 5M3MB 3I91A 1B53A 1E0BA 5ELDA 2BE5D 2NN6H 1R9TB 1FD7D 4C3HG 3ITPA 2O4XA 1TWHB 3BDLA 1RF2D 4F87A 3S9WA 3GTPB 2A6HC 2HDLA 4BA1I 1BO0A 1LTRD 4F7XA 2JP1A 2Z4IA 3AB9A 1S5DD 1ESRA 1FYCA 1OXUA 2PMZB 1LTGD 1PMRA 2F0MA 4B9WA 2MJ8A 1PTOB 4IURA 2FMCA 3D4DA 3VYSA 2B2WA 2B63B 4PQXA 3BDCA 3DM1A 3C3LA 1Q3LA 2KCCA 2LS01 5COYA 1Y8NB 1WD0A 2A68D 4K5XA 1H9RA 4RKLA 2X69A 5DM73 1QG7A 2Z4HA 2B2TC 2BDNA 5CGKA 5C3EB 2WKDA 4C3HB 1YNNC 3I72A 3Q0AA 1C48A 2MPMA 2SNMA 5KNCA 1WTOA 4CGYB 4FXKC 2FMMA 4CJ0B 1SAPA 5TSSA 3L7ZC 1RHPA 5CC4A 1JICA 2A74C 1CT1D 2L5TA 3QJYA 5D65A 3J80E 2ZXPA 1TKWB 1TY0A 2QKIC 1MSGA 4F8MA 2DN8A 1I6VC 5C3XA 1Q1BA 3OIPA 1RDPD 5DEHA 1IW7C 5A2QL 2L9HA 1ESFA 3A7LA 5BN5A 4A3GB 1R4QB 4LMQD 2RA4A 2F1MA 4O42A 5C4ZA 4ZKBB 3A8JE 3K6OA 4KJNA 1IYVA 1Y1VB 1STAA 5DNFA 5NUCA 4K6DA 3X3NA 4DGZA 5JVH3 3A54A 3S2DB 2WV6D 4A93B 1PRTC 2K32A 2X6GA 5CBEE 2KHSA 1RTOA 4MN3A 3CU7A 1SE2A 2F0NA 2I07B 3GTGB 4ZAIA 3QWNA 1B1ZA 1RD9D 1TU2B 2LMCB 2EJFC 1XYIA 5ELEA 5E3FA 4OGQC 2KOLA 2MUYA 1MBYA 2AWOA 4V190 1PZJD 2EY1A 5AFWA 2KVMA 2BE5C 2MHVA 4Q0FA 4Z9CB 1B9NA 4PNYA 2AQ1B 1EY5A 2G9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8P B;  3GD7 A;  5K36 H;  2D5D A;  1GUO A;  1H9S A;  3EQL C;  1HPC A;  3MXU A;  5K36 G;  1IW7 C;  5BN5 A;  3A7L A;  4TQU S;  1VDZ A;  2A6H C;  3I73 A;  1GUG A;  4IFD H;  3P20 A;  2D2C C;  4G7O C;  4BA1 I;  4IFD G;  4I7Z C;  5JEA H;  1IW7 D;  2E76 C;  2BDO A;  2F1M A;  4OO1 H;  1QJO A;  1E2V A;  3OOC A;  5JEA G;  2A6H D;  3AB9 A;  2CW0 C;  4OO1 G;  1GJX A;  1ONL A;  1YNJ C;  1OXS C;  3ND9 A;  4KKU A;  4KKT A;  2PPB C;  2PNR C;  1LAC A;  1CTM A;  3A8J E;  3CRL C;  1H9J A;  2E74 C;  4XTC S;  1T5E A;  1FYC A;  1IYV A;  1SMY C;  2EJM A;  2EVB A;  4H13 C;  4L8J A;  1OXU A;  3M4Y A;  1V8Q A;  2DNC A;  2JEA I;  3MFY A;  2R6G A;  1E2Z A;  1PMR A;  1HTP A;  4JBW A;  1VF7 A;  3LNN A;  3VR3 A;  1OXT A;  2YYZ A;  2JXM B;  4DK0 A;  2JEB I;  2EDG A;  3PUV A;  2PCF B;  3PV0 A;  4KI0 A;  2D62 A;  1OXX K;  3VR6 A;  4XIG S;  3VA7 A;  1Q1E A;  1EWH A;  2KA7 A;  3T53 B;  4JK1 C;  2NN6 I;  2K32 A;  5KND A;  1LAB A;  2A68 C;  2K7V A;  2KCC A;  3A8I E;  1O7L A;  3D31 A;  3DXJ C;  1HQM C;  3GQB A;  2Q8I B;  1K8M A;  1Y8N B;  3PUZ A;  4KN4 C;  1VCI A;  3CRK C;  1IYU A;  2A68 D;  3ND8 A;  2DNE A;  3PUW A;  3W3A A;  3A7A B;  4KKS A;  1Z7T A;  3RLF A;  3SDZ A;  3WDN A;  5C0X H;  2E75 C;  1CI3 M;  5C0X G;  1A6X A;  3SE0 A;  1K8O A;  1H9R A;  3BDO A;  3PUX A;  3A8K E;  1O78 A;  1GUS A;  4H0L C;  3M85 A;  3FMC A;  3VR2 A;  1GUN A;  1Q12 A;  2EJG C;  1VF5 C;  4TKO B;  3OW7 A;  4DK1 A;  3FPP A;  2O5I C;  1DCZ A;  5A35 A;  4HR7 B;  2QF7 A;  1TU2 B;  1YNN C;  3I72 A;  2IT1 A;  1ZKO A;  3QG1 A;  2LMC B;  4GZY C;  3OPO A;  1V43 A;  1Z6H A;  2AUK A;  2EJF C;  3LWU A;  4LJZ C;  3T51 B;  4KHZ A;  3TZU A;  3U9S A;  5BN3 A;  2K33 A;  1ZYR C;  3NE5 B;  4OGQ C;  1BDO A;  4KMU C;  1GHJ A;  5KNC A;  1H9S B;  1FR3 A;  2B8F A;  3IFT A;  3L7Z C;  2O5J C;  4KN7 C;  3VR5 A;  4LK1 C;  3BG3 A;  3HGB A;  1Y8O B;  1G29 1;  1B9M A;  2AWO A;  3KLR A;  2A6E C;  4DNT B;  3QIA A;  1GHK A;  3D4R A;  1GUT A;  1E2W A;  2L5T A;  2A69 C;  3QJY A;  4G7Z C;  1OXV A;  4DNR B;  2BA1 A;  1Y69 U;  2A6E D;  5KNB A;  3I4L A;  2A69 D;  2BE5 C;  1TKW B;  1HCZ A;  4G7H C;  4IQZ A;  3T56 B;  2DN8 A;  1I6V C;  2ZT9 C;  4BA2 I;  1H9K A;  2AUJ D;  3VR4 A;  3M7N A;  1CFM A;  3PUY A;  2B8G A;  1Q90 A;  2BE5 D;  2NN6 H;  1B9N A;  2V4D A;  1H9M A;  3N6R A;  4PV1 C;  4RCN A;  3H94 A;  5BN4 A;  1Q1B A;  2JE6 I;  2NN6 G;  2BA0 A;  3IKJ A;  1DD2 A;  4H44 C;  1DXM A; 
#chains in the Genus database with same CATH topology
 3GD7 A;  2CH4 W;  2EXZ A;  3TRZ A;  5C4H A;  3P7J A;  2ZM6 L;  2JA5 H;  4HCS A;  4LF5 L;  4IFD H;  2A5H A;  2D2C C;  1EOT A;  5JEA H;  2OT2 A;  4LWC A;  2UU9 Q;  1OTC A;  2F0S A;  4QL5 A;  3KOJ A;  1BF4 A;  3S16 B;  1FVI A;  2IL8 A;  3VYR A;  1PDQ A;  2J4X A;  4IOA A;  3TS0 A;  1HA6 A;  4XTC S;  4HJ8 A;  3NTH A;  3ULJ A;  4DV6 L;  1T5E A;  2SOB A;  1PLF A;  3K59 A;  3TN2 A;  3AQQ A;  3M4Y A;  3I70 A;  4R1J A;  2QCP X;  3EA6 A;  4ZCK A;  1IZ6 A;  4C2M H;  4GNX B;  2LY7 A;  2WKC A;  2RF4 A;  3RLO A;  3STB D;  1PV4 A;  1XTC D;  5KRU A;  1UEA B;  2D62 A;  3K80 C;  2WAC A;  4XIG S;  4CKC A;  1TS2 A;  1D8L A;  1DOM A;  3HOX B;  5KND A;  3GTL H;  2JA8 H;  1LAB A;  2A68 C;  3CCL A;  2CWP A;  4DK6 C;  3I56 A;  1F77 A;  5ISR A;  4DA2 A;  1EU3 A;  3BVM A;  3NBI A;  4P74 A;  4G7H C;  2Z1C A;  2R92 B;  1A62 A;  1U9R A;  2HCC A;  4N8F A;  1IBK Q;  3O13 A;  3TZD A;  2EYF A;  3DEP A;  4B08 A;  3J7Z C;  5IYC H;  5G3L D;  4JI2 L;  1VF5 C;  1N33 L;  3S1R B;  2E2D C;  3K7U C;  4RG1 A;  3GTM H;  1PZK D;  1JJC B;  4E6I A;  4GKJ Q;  1JOK A;  1TWC H;  3A5U A;  2HT1 A;  2PQA A;  1PH1 A;  1ROD A;  4DV2 Q;  3ZYY X;  4BXX H;  3ER0 A;  3MFG A;  1VQ6 A;  4WJ4 A;  1BXT A;  2R7F A;  1FNW A;  2D9U A;  1H9S B;  2Z6K A;  2J7Z A;  2LKV A;  5COR A;  2I46 A;  3UE0 A;  3J81 i;  2HCI A;  5DM6 3;  5D3D A;  1ZYR D;  2IPK D;  3MZ5 A;  5A2Q E;  4DNT B;  3I4O A;  3FKI H;  4YWK A;  2QGQ A;  1O7I A;  4RMF A;  3PQI A;  1A15 A;  3T56 B;  5J22 A;  3NP8 A;  1EEF D;  2NVQ H;  1L1O A;  3SK6 A;  2NBF A;  1I4X A;  2Z9H A;  2EYJ A;  2UUA L;  3EN2 A;  1X3F A;  1N34 Q;  2D5D A;  3S1N B;  3K7A B;  2R93 G;  3NEM A;  1EY6 A;  3P20 A;  1S4Z A;  4OWT B;  4A3K G;  2Z0S A;  4WRD A;  5JOB A;  1I4R A;  4DXG A;  4NKL A;  1JOR A;  4BY7 G;  1TWG B;  1QUQ B;  4S3S A;  2E2J H;  3HOY H;  3ND9 A;  5FOB B;  2E5L Q;  2B29 A;  1N9W A;  3E9H A;  1E7Z A;  1EUJ A;  4U67 3;  2E74 C;  1B4O A;  3HOV G;  2UXC L;  2NZ1 D;  3HRZ C;  4H13 C;  1JB3 A;  3AEV A;  1I50 B;  5I2Y A;  4JBW A;  5C4X H;  1VF7 A;  1X56 A;  5FLM G;  5LMN L;  1UUP A;  3F8T A;  4RKB A;  1YIJ A;  1GUW A;  3E3X A;  3RN2 A;  5IGC A;  4KI0 A;  1D2B A;  3SK4 A;  3PF5 A;  1KNA A;  3UDI A;  1EFI D;  5M5X H;  2D0P A;  1VQ7 A;  1U4P A;  2KHI A;  1LV9 A;  4RWS C;  3T53 B;  2NN6 I;  1I6H H;  2JA7 H;  4A3B B;  4A3F G;  1PH8 A;  1VMP A;  4KJO A;  1K8A C;  3CRK C;  4KTA A;  1HZ9 A;  5C0X H;  4JI3 Q;  1B70 B;  4CBV A;  3D0F A;  1K3B C;  4DNI A;  4K14 A;  3DM3 A;  1F9P A;  4B3S L;  3BZD B;  2B2V C;  2PZT A;  1BQQ T;  3FMC A;  1B50 A;  2PZW A;  4M1U B;  1WD1 A;  3M4O H;  1HUN A;  2EJG C;  1KRT A;  2PMZ E;  5IGG A;  1ILP A;  1LT5 D;  1DCZ A;  5A35 A;  2MP1 A;  4A3C G;  1PHJ A;  1LM0 A;  2Z6B A;  1NSN S;  3H0G H;  3LWU A;  5J3B A;  3KDF B;  2R93 B;  2HQE A;  1F2L A;  3M3Y B;  1CM9 A;  4A3K B;  1BR9 A;  2VXW A;  1YHA A;  3T1Y Q;  4BY7 B;  2NVT B;  5EPK A;  3CCU A;  1XPO A;  4X6A H;  4MTK A;  4QY7 A;  3KLR A;  2JYO A;  4JI7 Q;  2VQF Q;  3HOV B;  1EFW A;  4K8J A;  4ZUJ A;  4I65 A;  1P8L A;  4IPG A;  4NPS A;  1SYF A;  3G4S A;  1JOO A;  1ET9 A;  1DGS A;  2ZJR A;  4BA2 I;  2AUJ D;  3M7N A;  4JYA Q;  1EQV A;  2EY6 A;  2ICI A;  2F0U A;  5JJZ A;  4DAY A;  3DHQ A;  2JE6 I;  4Y7N H;  1DD2 A;  1SE3 A;  1DXM A;  1Y1W H;  3EJI A;  4GN3 B;  3NEN A;  4DK3 C;  1SRO A;  1AE2 A;  4YCW A;  4MNO A;  2B2Y A;  1PRT B;  1Q8I A;  1LTI D;  1E2V A;  3CCM A;  1ONL A;  4KKT A;  3H3V H;  4GKK Q;  4FXD A;  1QOH A;  1G6P A;  1CTM A;  3CRL C;  4IUN A;  1ML0 D;  1JWU D;  1WTR A;  2EQS A;  4C3I H;  2VUM H;  4DV5 Q;  1KLU D;  3STB C;  1UEB A;  4IFD J;  2XRQ D;  2UXD L;  4HN7 A;  3WWV A;  2B2U A;  4DR2 L;  4BBR H;  4R4T A;  4YHH L;  1PZI D;  4RFB A;  5LL6 X;  2JA6 G;  1PXU A;  1SNO A;  2OTJ A;  4LFA Q;  3ZJY C;  4H02 A;  1A2T A;  1RJT A;  3ULP A;  2HUG A;  3TQY A;  1EOV A;  1X54 A;  3D6W A;  2ZTE A;  4B3R Q;  1D7Q A;  3KLS X;  3VYU A;  3SDZ A;  1U4R A;  2K1B A;  2RVL A;  4CJ2 C;  1A3U A;  2AMC B;  2RSO A;  3C1E A;  1KRS A;  4L63 B;  3R93 A;  1L0Y B;  4CDE C;  3T13 A;  2F0E A;  1Q12 A;  5ELC A;  5JAV A;  2OQ0 A;  4DK1 A;  4OX9 Q;  3AMU A;  4OIJ A;  2O5I C;  2EY2 A;  1S3O A;  2XN9 C;  1J9O A;  1HR0 W;  4DR6 Q;  5IP7 G;  5JJI A;  3CQZ H;  2IW3 A;  1ZYR C;  4UAI A;  4KMU C;  3PF4 A;  1TVX A;  1SSO A;  1EY7 A;  2ZXR A;  3CD6 A;  3NWT A;  5KGU A;  2F0I A;  3GO5 A;  4J6H A;  2HIX A;  4GNX C;  3IL8 A;  3S1Q B;  1QNK A;  2L55 A;  4FYD A;  4CJ1 B;  3RZD B;  4HTH A;  1JE5 A;  3BYT B;  2F0T A;  1BCP F;  2KUM A;  2N8N A;  4L5S A;  4QB4 A;  4RGN A;  3PUY A;  1SEB D;  4RCN A;  1H9M A;  5M5W B;  3H94 A;  2I5L X;  2JA6 B;  2I0Q A;  3S15 B;  2OWO A;  3BVZ A;  3S1M B;  1L2F A;  3PMF A;  2I5M X;  2PI2 A;  3J7Y W;  1WTX A;  1EU4 A;  4LUO A;  5FK9 C;  3OMG A;  5EPL A;  5LHY 1;  1H95 A;  3MXG A;  3F1Z A;  1QJO A;  3SK8 A;  4IJL A;  1RCV D;  1K73 C;  4JV5 L;  5AJ3 Q;  1STG A;  2PO4 A;  1C7Y A;  1YNJ C;  5HGT A;  2AWN A;  3I55 A;  4A3J H;  1AEX A;  1TS5 A;  5KEE A;  5C3E G;  3HKS A;  2DNC A;  2F0V A;  1EIG A;  1MHW C;  3FVQ A;  3H91 A;  1TWA B;  1SJH D;  3VR3 A;  4JOI C;  1AW7 A;  2SNS A;  3X3M A;  2EDG A;  2K05 A;  3PV0 A;  3L3O C;  1X3P A;  3DWA A;  2UU9 L;  1SFO B;  4DU9 A;  2E2I H;  1OXX K;  1XMO Q;  3U50 C;  5J1Z A;  5IGF A;  3PO2 H;  2KA7 A;  1HRJ A;  5HGQ A;  1LO5 D;  2QW7 A;  1JE4 A;  5EKL A;  1CSQ A;  1HQM C;  1VQC A;  4J1M A;  4POF A;  2KEN A;  1ZXT A;  5T1I A;  1NY4 A;  3BDO A;  1QVF A;  1GUS A;  1F9Q A;  2YTY A;  2KCN A;  5I9O A;  2R7Z H;  3DLL A;  4K5W A;  3OWF A;  3WOF A;  1TWF H;  2J0T D;  1PH4 A;  3BZC A;  3TDQ A;  5FJ8 H;  3BVG A;  4X66 Q;  1Q8K A;  5M9O A;  3F2U A;  1CKN B;  4A3G G;  4AH6 A;  4C2M B;  5C0X J;  3L9A X;  1S5E D;  4QCL A;  2K33 A;  3TBI B;  1IBK L;  2RDG A;  4HJ5 A;  3DWP A;  1LLR D;  4DF7 A;  3HGB A;  4KY6 A;  3K57 A;  1Y1V G;  2C35 B;  4A3M H;  1SNQ A;  5IP9 G;  4GKJ L;  4EQO A;  1V1P B;  4DV2 L;  4NXM Q;  1MGS A;  4A93 G;  3HKZ G;  4ZLT F;  1U5K A;  3CCE A;  3SVM A;  2RCF A;  3T16 A;  3NPP A;  1IBM Q;  5K36 G;  3G6J B;  1PFN A;  1YBY A;  1VDZ A;  4A3I G;  4EX5 A;  2FXQ A;  2VW9 A;  4CDD C;  4HJA A;  4DR3 Q;  2F0J A;  1JMC A;  1GJX A;  4OO1 G;  5C44 G;  2PQA B;  1OXS C;  3S17 H;  1LAC A;  3I4N H;  1I4G A;  4FF2 A;  2QEJ C;  4KLK A;  1N34 L;  4L8J A;  3MXP A;  4WJW A;  1X6O A;  1E2Z A;  1HTP A;  2K04 A;  3GV6 A;  4IPC A;  3MEF A;  5M3F G;  2FFK B;  1PYW D;  1EY0 A;  4DK0 A;  2ICE C;  2JEB I;  2IX1 A;  2PCF B;  3J7A 5;  4KY5 A;  3K8A A;  2KCM A;  3EFX D;  2NVQ B;  3VA7 A;  3CMA A;  2B2W C;  1BNZ A;  2E5L L;  5FKA C;  1EQT A;  1WTH A;  3K0Y A;  4JK1 C;  2Q8T A;  1I4H A;  1K3R A;  1HFN A;  4AQY Q;  4C3J G;  3A8I E;  4LW1 A;  1STY A;  2A73 B;  3DXJ C;  1A3V A;  1FGB D;  4R4C A;  4X64 Q;  4GLX A;  4KN4 C;  4BWG B;  4JG2 A;  1IYU A;  2DNE A;  3W3A A;  1Z7T A;  2IWH A;  5LMU Q;  4JI4 Q;  2RHQ B;  2DGY A;  2K5Q A;  4ULL A;  1I3Q B;  1VQM A;  1AFP A;  1XNQ Q;  3HOY B;  2E2J B;  3S14 H;  1KIX A;  4K6L A;  4APV A;  3HKZ B;  3AFP A;  1KAA A;  2F0G A;  1ZKO A;  2RQX A;  4EVO A;  3H6M A;  5C4X B;  4LJZ C;  4B3M Q;  1MKH A;  4JI3 L;  3CC4 A;  3U58 A;  3I2Z A;  4MIU A;  3Q24 A;  4A3I B;  2IY5 B;  1GVP A;  1PH9 A;  2ES2 A;  1JWM D;  5M5X B;  3N52 A;  2B8F A;  3HS0 C;  2MGS A;  5C44 B;  2Q2T A;  4IUQ A;  4OO1 I;  5T1G A;  3SHL A;  1I6H B;  2O2L D;  2JA7 B;  1WCM G;  1W6K A;  5E1F A;  2D0O A;  1XTD A;  5EKI A;  1ASZ A;  2A6E D;  1WVL A;  1X3E A;  3FEW X;  4JVZ A;  1TS4 A;  4GOP C;  5M3F B;  1H9K A;  3VR4 A;  2B8G A;  1PH7 A;  3HOU G;  3E0E A;  2KEE A;  2NVY H;  3C2P A;  3T1Y L;  3M4O B;  3FDT A;  1Y8P B;  4N8X 1;  1NAP A;  3HOX G;  3GTO B;  4A3E H;  2K52 A;  4LF8 L;  2VQE Q;  4JI7 L;  2VQF L;  4GN5 A;  4C3J B;  4YCU A;  1WTP A;  1EZ6 A;  3ERO A;  2R92 G;  4YY3 Q;  5C4J H;  4P2C B;  2EOT A;  4JYA L;  2IJ0 A;  4KKU A;  4Q5V A;  4HSP A;  2PNR C;  1S40 A;  1G2S A;  1H9J A;  3URY A;  5M3M H;  3RMH A;  3MTS A;  3J81 j;  3A55 A;  4WFN 3;  1X3Q A;  1KAW A;  3SR1 A;  1E1T A;  1KDC A;  1MI2 A;  1ZEQ X;  4LUV A;  4OEL B;  1R9T H;  1E22 A;  4DR5 Q;  5IE8 A;  1EYA A;  2R61 A;  4DAP A;  1ENA A;  1TWH H;  4FXG C;  4JCV E;  3PO3 H;  2XSC A;  1DOL A;  2M9V A;  3TME A;  2R7D A;  1G8Z D;  4GKK L;  2MQH A;  4CKB A;  4JC0 A;  1Y1W B;  4DAY B;  3U9O A;  4DV5 L;  3RZO B;  2N78 A;  5BR8 Q;  3PUZ A;  1VCI A;  3GTJ H;  2K5W A;  3ND8 A;  4PMC A;  1WCM B;  1LTS D;  3KF8 A;  2E75 C;  1N36 Q;  4QIW B;  1A6X A;  1KDB A;  4KHV A;  3A56 A;  1WTV A;  2A1A A;  2JK8 A;  3CPF A;  4IO9 A;  3UI2 A;  4FF1 A;  4LFA L;  3V96 A;  3CPW A;  1VQK A;  3HOU B;  3F2D A;  1HNZ Q;  4C3I B;  5IT9 c;  1PTO H;  4XYQ A;  3OTO Q;  3PIP 3;  4C56 C;  3OPO A;  1LT4 D;  2JQO A;  1V43 A;  2KBN A;  3E0J A;  4OON A;  4QUF A;  1VQB A;  2B63 H;  4X3T A;  5HY6 A;  4BBS G;  4BBR B;  4OWX B;  2WAQ B;  1KHI A;  4KN7 C;  3I4M H;  2F0O A;  2Q2H A;  1XJV A;  2A19 A;  2XNA C;  4OX9 L;  3MXN B;  5CV5 A;  4K8I A;  2ZTC A;  1HCZ A;  4DR6 L;  2C9O A;  1VQI A;  2F4I A;  3J80 i;  1VQF A;  1STH A;  3NQI A;  1CKM A;  2EZV A;  2NVX H;  1PTO F;  1D5X C;  2M00 A;  4C3H H;  2NN6 G;  1A63 A;  4LF6 Q;  1O7Y A;  3I90 A;  2L4N A;  1J5E Q;  1IHZ A;  4A3B G;  3I7F A;  3EVQ A;  1VQ4 A;  2OCE A;  1SND A;  1GKH A;  1GUG A;  2L11 A;  3DUZ A;  1HJP A;  1PYB A;  4ME5 A;  4LFB Q;  4G7O C;  3OHX C;  1EYG A;  1I4Q A;  1AH9 A;  3CQZ B;  4OWW B;  3NBH A;  3PSI A;  1SR3 A;  4P72 A;  2WB1 G;  2IX3 A;  3U4Z A;  2HIV A;  3E6Z X;  5I6Y A;  1VQ9 A;  4DR4 Q;  4UY8 C;  1HQR D;  4ILW A;  1K9M C;  2R6G A;  5EGT A;  1X32 A;  5EBC A;  5IGB A;  5FO7 B;  1M8A A;  3I3C A;  4FF4 A;  1SNC A;  3KBX A;  5IYB G;  5AJ3 L;  1V1O A;  1CZG A;  4J8Q A;  4BBS B;  4IPD A;  4ZUI A;  4P71 A;  1ICW A;  1VQJ A;  2V1C C;  3FHW A;  5EKK A;  3CF5 A;  4QQB X;  3CCQ A;  3GQB A;  1W2B A;  3NHH A;  4A3L H;  2EXD A;  1YNJ D;  3PUW A;  3RLF A;  4DAV A;  3K5L A;  3FPU B;  5M5Y H;  1LT3 D;  3S2H H;  3D4W A;  2GVB A;  3PUX A;  1FNU A;  2L1B A;  1XMO L;  3G71 A;  4B3R L;  3BYY B;  3L0O A;  2YU9 H;  4XXE A;  3CC7 A;  1QB5 D;  1GO3 E;  3HP3 A;  1XMQ Q;  4A3J B;  1YHB A;  1BCP D;  5IYD G;  1EY4 A;  3S2D H;  1SNP A;  1EYC A;  5FO9 B;  3P1H A;  2UUC Q;  2MFI A;  1D5Z C;  4KD4 A;  2Z6K C;  3R8B A;  3IFT A;  4NMZ A;  1Q86 C;  1C8C A;  5EBD A;  2A6E C;  3K81 C;  2WB1 B;  3D4R A;  1GUT A;  1D6E C;  3HOW G;  2RCN A;  1U4M A;  3MC0 B;  4KV6 A;  4X66 L;  2DY7 A;  2YTV A;  1JJG A;  1DZ1 A;  3PIP A;  4PMB A;  4QMG A;  1L1O C;  1XNR Q;  1MJC A;  4XT3 B;  1LTB D;  2N55 A;  3RUZ A;  1HFG A;  5LMN W;  5E4X A;  3JAM c;  1ICF B;  4UDU C;  4JI8 Q;  3I73 A;  2ENB A;  3KF6 A;  3JAM L;  2ZJP A;  3FRP B;  4BS9 A;  3OWE B;  4JI6 Q;  2GN5 A;  3GTK B;  2CCZ A;  1RIP A;  4NXM L;  1EL0 A;  3DWQ A;  1KAB A;  1VMC A;  2BH2 A;  1IBM L;  1BUV T;  4JBM A;  2Y0S G;  2TSS A;  1KNE A;  2PYK A;  3FP9 A;  4A3M B;  1FL0 A;  4DR3 L;  1II3 A;  1SBB B;  2F0K A;  2HQL A;  2EE1 A;  2F0W A;  1WFQ A;  3QB3 A;  5IGD A;  2Q8R E;  2ATW A;  1Q1E A;  2LXJ A;  3MWY W;  1U4L A;  2L0C A;  1AN8 A;  2Z8L A;  1PFB A;  2F0F A;  1PFM A;  5D3I B;  2HHH Q;  3V2T A;  4BY1 H;  1Q81 C;  1SYE A;  3MAQ A;  5CMD A;  1K8M A;  4RGT A;  3S16 H;  5GRO A;  3A7A B;  4FO2 A;  4A76 A;  1BBU A;  3HOW B;  4C1N I;  4K2K A;  1CZW A;  3HOZ H;  3A0J A;  2K6A A;  1S72 A;  4A3D H;  3M85 A;  2DJG C;  1JQY D;  4FP5 D;  1HNX Q;  2NB0 A;  3S17 B;  1GUN A;  3I4N B;  1NNX A;  1EYD A;  2PQE A;  3OW7 A;  5CV4 A;  4DV7 Q;  3OSO A;  4GOP B;  4AQY L;  1GXD C;  1AZP A;  2ZXO A;  1QCB D;  4X62 Q;  3KBG A;  4X64 L;  2E2H H;  3TP8 A;  3T51 B;  1I94 Q;  4G57 A;  2B3G A;  2VY3 A;  3H15 A;  2WIN B;  5LMU L;  4JI4 L;  1FR3 A;  5I9P A;  1CQV A;  1PH5 A;  1XNQ L;  3KUP A;  1K83 H;  2NTS A;  2NYZ D;  3QIA A;  4R4Q A;  1J6Q A;  5C6A A;  1NR4 A;  2CVR A;  4IUP A;  4OIK A;  2NZH A;  1Y69 U;  1A3T A;  2C5C A;  3A5Z B;  1FNV A;  2RKS A;  3CW2 C;  4B3M L;  4XDX A;  1WTQ A;  2Y0S B;  3J81 c;  4A75 A;  4UHV A;  1Q90 A;  3J81 L;  2R3Z A;  3ERQ A;  2BA0 A;  3HKZ E;  2TMP A;  3S14 B;  1GUO A;  1H9S A;  3MXU A;  1D5M C;  3W2D A;  4ALP A;  1P16 A;  3KK7 A;  4ZRZ A;  5KYI A;  1M4V A;  1Q7Y C;  2JA5 G;  2QEX A;  4I7Z C;  3RN5 A;  4IFD G;  4Y52 H;  2B2Y C;  2OQK A;  4U68 A;  2XVS A;  5JEA G;  2DUD A;  3D8G A;  3H3V C;  2F3I A;  4LF9 Q;  3E5S A;  4O0A A;  1M1K C;  1BOS A;  5CR3 A;  3B6Y A;  4IAL A;  4GN4 B;  4DFA A;  2NZO A;  4HIO A;  1BBX C;  1DYQ A;  4O2D A;  2VQE L;  1UWV A;  1SMY D;  1OXT A;  4NB3 A;  5H1S E;  1VS0 A;  2B2U C;  4K5V A;  5IIF A;  4YY3 L;  4RCO A;  2F3W A;  1DOK A;  2BCO A;  1RTN A;  4R9W A;  4P75 A;  3K7A H;  1XXG A;  5C5L A;  2KHJ A;  2EYH A;  2NVY B;  1NUC A;  1QUQ A;  2JA8 G;  3D6C A;  1TWG H;  1UNS A;  5K5P A;  2EYP A;  4DN4 M;  1DM0 B;  3E9I A;  5GAE C;  3VYT A;  2X6L A;  1PH6 A;  3A8K E;  1IL2 A;  4DR5 L;  1IKM A;  4XQN A;  1GOZ A;  4X3K A;  1BCP C;  4L5Q A;  3VDY A;  4HED A;  4O1N A;  4PMW A;  4TKO B;  5IYC G;  2B2T A;  2K75 A;  3ONA B;  3FPP A;  3Q22 A;  1SMX A;  4P73 A;  2KQ3 A;  3W1B A;  4TSS A;  4FVM A;  1VQN A;  5BR8 L;  1HNW Q;  2K03 A;  5EPJ A;  3LWE A;  4L5T A;  4KHZ A;  3TZU A;  5J39 A;  1N36 L;  4BXX G;  1EWC A;  2JA5 B;  3NEL A;  3PO3 B;  2OF1 A;  1O80 A;  4IFD I;  3BG3 A;  1LTL A;  1KLG D;  3JAM E;  1TY2 A;  5CBA E;  2RBM A;  1HNZ L;  1OXV A;  1ILQ A;  5HUR A;  3FKI G;  1KDA A;  3OTO L;  4QIW E;  1STE A;  3GTJ B;  1Q82 C;  4IQZ A;  4N9P A;  1DON A;  1QNU A;  2N3S A;  3TP7 A;  2Q2U A;  2LFN A;  2UUB Q;  2V4D A;  4PV1 C;  1HHV A;  3OYY A;  2F3V A;  1YJW A;  3IKJ A;  2EYM A;  1PH2 A;  1N32 Q;  3PGZ A;  4XYO A;  2R93 H;  1MSH A;  3M4P A;  1NMG A;  4MZ9 A;  4L6T B;  4TQU S;  4A3K H;  4EGV A;  2EYO A;  2VZA A;  3AU7 A;  3GTL B;  2JA8 B;  2VB3 X;  3PCO B;  3CP0 A;  4BY7 H;  2NVT H;  1XWE A;  2WAQ E;  4ABN A;  1SJE D;  2AKW B;  4DV3 Q;  1S5C D;  2NTT A;  4JI1 Q;  3HOY G;  3HOV H;  1K28 A;  2F52 A;  4LF6 L;  3I4M B;  4F88 A;  4LFC Q;  2EVB A;  1J5E L;  1LT6 D;  1CA6 A;  1I4P A;  4H7B A;  5FLM H;  3S24 A;  4YWL A;  5C3W A;  4ZK9 B;  5C5M A;  5C4X G;  4GLV B;  4LFB L;  4NP5 A;  1LYL A;  3C46 A;  1UE6 A;  3GTM B;  4IUT A;  1JC7 A;  3KFU A;  3GTQ H;  1TWC B;  1UE7 A;  1TT2 A;  3UDG A;  1EWH A;  1HZA A;  2NVX B;  5GAG C;  3MA2 B;  3LX0 A;  2JJQ A;  4IOC A;  4A3F H;  2K7V A;  3Q6S A;  2FHT A;  2QIL A;  2JA7 G;  4DR4 L;  1Z47 A;  4ID6 A;  1CHP D;  2LSS A;  3WDN A;  4HMJ A;  1CI3 M;  5C0X G;  1JT8 A;  3FKI B;  2F4V Q;  2JSO A;  3BS1 A;  4H0L C;  4M8A A;  1LTA D;  3NQT A;  2YTX A;  1XPU A;  4LNQ A;  4RHR A;  3U4V A;  4A3C H;  4CDC C;  1JR0 D;  1E3P A;  1FGU A;  1VQH A;  2K5D A;  3K5O A;  1VQP A;  2M2L A;  1L1O B;  3V05 A;  1PTO D;  3PIO 3;  1EWI A;  4G4K A;  3J81 E;  5DAU A;  5I4D A;  3H0G G;  4B9X A;  5FLX c;  2H4O A;  1STB A;  4UP9 A;  4R8I A;  1HR0 Q;  1PRT F;  4FNF A;  1CQF A;  4K2L A;  3CC2 A;  5FLX L;  4DXF A;  2AQ3 B;  5F2D A;  2F0D A;  3DMU A;  1SNM A;  2HD3 A;  3D3R A;  1M90 C;  1X3G A;  4DKA C;  1SYD A;  1E2W A;  1XMQ L;  1B3Q A;  1IXR A;  2CWA A;  3K58 A;  5KNB A;  5I2X A;  2CHB D;  2A69 D;  4N9T A;  1YJ9 A;  2UUC L;  1HZC A;  3TEH B;  4X65 Q;  3T1H Q;  3S2H B;  5M5Y B;  2ID0 A;  4JW0 A;  1CFM A;  3N6R A;  3NTK A;  3R3O A;  5KYL A;  2OTL A;  1PVO A;  2OEO A;  2YU9 B;  3RLN A;  2ZTD A;  1Y1W G;  1B8A A;  2NUC A;  4QF4 A;  3EQL C;  4JI0 Q;  4DUZ Q;  1G2T A;  3UE1 A;  3WOE A;  1WJJ A;  4IUV A;  2CW0 C;  1SYB A;  3NXW A;  2PPB C;  1XNR L;  3TSS A;  3GP7 A;  1A8V A;  3M9B A;  2WB1 E;  5C0X I;  4BY1 G;  2MO1 A;  3VA5 A;  1HUM A;  1SMY C;  4R4I A;  5EQ0 A;  4C3I G;  2VUM G;  1B2T A;  1V9P A;  4JI8 L;  1CHQ D;  1QIL A;  3AYH B;  5M5W H;  3K5N A;  2JA6 H;  4R4O A;  1T5X D;  4JI6 L;  3VR6 A;  4BBR G;  1STN A;  1VQD A;  3OMC A;  5CV6 A;  5GQO A;  3H0G B;  1SXT A;  2WAQ G;  5EAY A;  3SEB A;  2L12 A;  2KCT A;  4OHJ A;  1A0I A;  2XIW A;  4X3U A;  4AYB G;  3UDF A;  1UE5 A;  2UXB Q;  4PZ6 A;  3KF6 B;  1XPR A;  4RGO S;  4EQN A;  3Q23 A;  2AQ2 B;  4JBJ A;  3SXH A;  2RSN A;  2IX0 A;  3GTP H;  4J15 A;  2QF7 A;  3CCJ A;  1SFO H;  2HHH L;  2CH4 A;  4Y7N B;  5JPM C;  5JPN C;  1AZQ A;  2PW7 A;  1E1O A;  5IP7 H;  4UP7 A;  4B3T Q;  3KJP A;  4QGU A;  4TVA B;  4DV4 Q;  1PYS B;  1W3S A;  1C0A A;  3CAM A;  2F0P A;  1NJI C;  1HNX L;  1G29 1;  1SYG A;  4DV7 L;  3GDE A;  4G7Z C;  1KL9 A;  2B39 A;  4BY1 B;  4X62 L;  3H3V I;  2CQA A;  4IZ8 A;  2VUM B;  3CCR A;  1I94 L;  3TP5 A;  3ERS X;  3PIO A;  4GS3 A;  3HOZ B;  1CKN A;  5IT9 L;  1IKL A;  4A3D B;  2H5X A;  4HAE A;  1NTG A;  3W5O A;  1SDF A;  4LF7 Q;  1EZ8 A;  1F2Z A;  1YZ6 A;  2E2H B;  2BDO A;  2JN4 A;  4FF3 A;  1EIH A;  4AYB B;  1CK1 A;  4RAU C;  5DLQ E;  3TP6 A;  1SN8 A;  1EEI D;  1B44 D;  3KLS A;  1K83 B;  1V1P A;  4K0K Q;  1KXL A;  5C3E H;  1J8I A;  2EJM A;  5ELF A;  1MJE A;  4A3J G;  2JEA I;  1V8Q A;  1EIF A;  3SK5 A;  3MFY A;  4NXN Q;  5IGE A;  1O7Z A;  4RHS A;  4KHP Q;  1BCP B;  2P5Z X;  2Y0S E;  4LAA A;  2F0L A;  2JXM B;  2N88 A;  2DJF C;  4IUU A;  3ULL A;  4XQQ A;  3QOJ A;  4MHE A;  1IL8 A;  4LF9 L;  1ET6 A;  2PZU A;  2AHO B;  2BOS A;  3PO2 G;  3J7A V;  4ZKC B;  4ZYS A;  4TRD A;  3CHB D;  5FO8 B;  2WII B;  2RDF A;  1O7L A;  1SE8 A;  5IWA Q;  4DUY Q;  5EJW A;  1I5F A;  5FLX E;  1CA5 A;  1SLJ A;  3SE0 A;  1HXY D;  3CKI B;  4RH6 A;  1WOC A;  1UAP A;  2B2V A;  3M4Q A;  3KYH C;  2JA9 A;  1Z9F A;  1NR2 A;  2R7Z G;  3MEH A;  2HDM A;  4ME3 A;  1PTO C;  1PH3 A;  5D14 A;  4JI5 Q;  2OXP A;  4A3G H;  1QE6 A;  5FJ8 G;  4GZY C;  1RKN A;  4ODG A;  5BN3 A;  4DV1 Q;  1QVG A;  4CDF C;  1NCV A;  1SYC A;  4NW2 A;  4XT1 B;  4PZ7 A;  4DR7 Q;  4DR1 Q;  2N49 A;  3R2T A;  1F2M A;  1Y1V H;  2A69 C;  2G9H D;  1QZH A;  1YNX A;  4R8N A;  1F2Y A;  3NTI A;  1I3Q H;  5IP9 H;  3R2I A;  2KED A;  4JBK A;  1S5B D;  4X3S A;  1HNW L;  3IFD A;  4A3M G;  3CCS A;  1G6Z A;  2ASB A;  1FJG Q;  3G7L A;  4A93 H;  1BBW A;  4KK7 A;  1QZG A;  3A74 A;  5ELN A;  2IHE A;  1JCK B;  1F9S A;  4H44 C;  1F9R A;  5K36 H;  2E2I B;  1TQO A;  2RDH A;  1HPC A;  3NWS A;  4A3I H;  5KIX A;  1G91 A;  3PO2 B;  1C4Q A;  4RA8 A;  1YJN A;  4PG3 A;  2PW5 A;  1R4P B;  2FIN B;  4OO1 H;  1D1I A;  3OOC A;  3QOL A;  2A6H D;  5C44 H;  4FDB A;  2EPB A;  3RD4 A;  1HZB A;  2UUB L;  1E24 A;  2WP8 J;  3GTG H;  3I4N G;  4HJ7 A;  2K01 A;  1N32 L;  4XQJ A;  1K0S A;  1YVC A;  2R7Z B;  5M3F H;  1OO9 B;  1TWF B;  2BH8 A;  2YYZ A;  1NMF A;  4OL7 A;  3PUV A;  1EQQ A;  5JVG 3;  3RR5 A;  3GTO H;  2GVA A;  4DV3 L;  2EYL A;  4ZQ3 A;  2VNU D;  1YEZ A;  1D1K A;  4JI1 L;  1W6J A;  1QWY A;  4HSV A;  4C3J H;  5IY0 A;  3K0X A;  1VQ5 A;  2XTI A;  3JC6 6;  3H09 A;  4LFC L;  3NUC A;  3D31 A;  2Q8I B;  1ENC A;  4YCV A;  4KKS A;  1L0X B;  1HTL D;  2H1E A;  3DEO A;  1O78 A;  2FJ2 A;  4C1N K;  4LF8 Q;  2XRS D;  2LXK A;  1LTT D;  3OIQ A;  2VS1 A;  4DV0 Q;  1MIU A;  4KD3 A;  5CV9 A;  1HA5 A;  2IT1 A;  2KEC A;  2QDB A;  3QG1 A;  1QVC A;  1B3A A;  2K28 A;  2AUK A;  5IT9 E;  4LF4 Q;  5I6W A;  5IOD A;  1YNN D;  2F4V L;  1BDO A;  3C1F A;  1XX8 A;  2Q2I A;  2XWJ B;  4CKE A;  1IBL Q;  3GTQ B;  3RZO H;  4GLA C;  4HCE A;  4LK1 C;  3VR5 A;  5GAH C;  2F03 A;  1B9M A;  1WCM H;  4GNX A;  4QUC A;  2K5V A;  4A3F B;  2SEB D;  4V0B A;  2ZM6 Q;  4LF5 Q;  1AE3 A;  4HIM A;  4IN3 A;  5G3L F;  2EY5 A;  1B7Y B;  2GA4 B;  4YIJ A;  1K8G A;  3I4L A;  4MTN A;  1AP0 A;  3K5M A;  5LL6 S;  1BKB A;  2F0Q A;  1VQL A;  1X9N A;  2KJX A;  4HMI A;  3TRE A;  2ZT9 C;  1JJ2 A;  1HR0 L;  3AFQ A;  2RHS B;  3HOU H;  5BN4 A;  4IPH A;  1Q46 A;  4DV6 Q;  3HOX H;  5IOC A;  4WOR A;  2MO0 A;  4IJH A;  4KY7 A;  5JEA J;  1SE4 A;  1IYJ B;  1KTK A;  4A3E G;  3MHB A;  3J80 c;  5E4W C;  2R92 H;  1IW7 D;  2E76 C;  2QA4 A;  1X65 A;  3J80 L;  3T1H L;  4X65 L;  1YHQ A;  2CFM A;  3MXN A;  1EY9 A;  2PNH A;  3QO2 A;  3J7A F;  1CKO A;  1ENF A;  1A2U A;  3S1R H;  3M7G A;  5ELB A;  5M3M G;  1KQS A;  5CV8 A;  5CYU A;  2VL6 A;  4JI0 L;  4DUZ L;  3LNN A;  1DJR D;  4JOI A;  1MD2 D;  3BZK A;  1VQG A;  1JOQ A;  3T4A C;  1SRU A;  2SDF A;  3PO3 G;  4RGM A;  1TR5 A;  1GD7 A;  4JI2 Q;  1YI2 A;  1N33 Q;  4DPG A;  4EQP A;  1JWS D;  1TS3 A;  3HEJ A;  1YIT A;  1PRT D;  1S5F D;  2CW0 D;  5ELO A;  3G6E A;  2MNA A;  1K0R A;  3NSW A;  3ICE A;  3HZX A;  1K8O A;  3I8Z A;  1GM5 A;  1WI5 A;  3VR2 A;  2XWB B;  1WTW A;  2NWG A;  3S1N H;  2K50 A;  3NK9 A;  4HR7 B;  2ALY B;  3HG9 A;  1HH2 P;  3MVV A;  2I5H A;  5L37 A;  3P75 A;  1Z6H A;  1TXY A;  3BJU A;  4A3E B;  4BBS H;  2B63 G;  3U9S A;  2DY8 A;  2VB2 X;  3NE5 B;  2UXB L;  3IAY A;  1EY8 A;  1GHJ A;  3GV3 A;  2UUA Q;  5CV7 A;  4NDX A;  4CHT B;  2O5J C;  4OXP A;  1Y8O B;  1VQ8 A;  4EQ5 A;  5C4J B;  3I4M G;  2F0H A;  1GHK A;  1I50 H;  1TII D;  4DNR B;  2BA1 A;  3BU2 A;  2K4K A;  3I91 A;  5M3M B;  1B53 A;  3LGJ A;  3HFZ B;  1EIY B;  4B3T L;  1E0B A;  4DV4 L;  5ELD A;  2BE5 D;  2NN6 H;  1R9T B;  2UXC Q;  1FD7 D;  4C3H G;  3ITP A;  4A3B H;  2O4X A;  1TWH B;  3BDL A;  3G48 A;  1RF2 D;  4F87 A;  3S9W A;  3GTP B;  1VQO A;  2A6H C;  5LMN Q;  2HDL A;  4BA1 I;  1BO0 A;  1LTR D;  4F7X A;  2CKZ B;  2JP1 A;  2Z4I A;  3AB9 A;  1S5D D;  1VQE A;  3CME A;  1KD1 C;  1ESR A;  1FYC A;  3KF8 B;  4LF7 L;  1G51 A;  1OXU A;  2PMZ B;  1LTG D;  3KDF A;  1PMR A;  2F0M A;  4B9W A;  2MJ8 A;  3M3Y H;  5IYB H;  1PTO B;  4IUR A;  4AIM A;  2FMC A;  1RL2 A;  3D4D A;  2YV5 A;  4B3S Q;  3VYS A;  2B2W A;  3Q8D A;  2B63 B;  4PQX A;  3BDC A;  3DM1 A;  3C3L A;  1Q3L A;  4K0K L;  1X55 A;  2KCC A;  2LS0 1;  5COY A;  1WYD A;  3GTK H;  1Y8N B;  4HJ9 A;  1WD0 A;  4NXN L;  2A68 D;  4AYB E;  4A3L G;  4KHP L;  4LUZ A;  4K5X A;  1H9R A;  4RKL A;  3KLW A;  4L5R C;  2X69 A;  5DM7 3;  1QG7 A;  2Z4H A;  5GAD C;  4OEM B;  5IYD H;  2B2T C;  2BDN A;  5CGK A;  5C3E B;  1KC8 C;  2WKD A;  1Y14 B;  3SGI A;  1YNN C;  3I72 A;  4C3H B;  5IWA L;  3Q0A A;  4DUY L;  1C48 A;  4JPB W;  4UPA A;  3UDX A;  2MPM A;  2SNM A;  4I7A A;  5KNC A;  1WTO A;  4CGY B;  1V1Q A;  4FXK C;  2FMM A;  4CJ0 B;  1SAP A;  5TSS A;  3L7Z C;  5JJL A;  3W1G A;  4PZ8 A;  1RHP A;  5CC4 A;  1JIC A;  2A74 C;  1CT1 D;  2G5D A;  3HOW H;  2L5T A;  1EQR A;  3QJY A;  3CCV A;  4JI5 L;  5D65 A;  3IRB A;  3NBH B;  3J80 E;  2K14 A;  2ZXP A;  2CQO A;  1TKW B;  4GOP A;  1TY0 A;  2QKI C;  1MSG A;  4F8M A;  3OW2 A;  2A8V A;  2DN8 A;  1I6V C;  4DV1 L;  2WFW A;  5JJK A;  4QJF A;  5C3X A;  1Q1B A;  3F2C A;  4DR7 L;  3OIP A;  1RDP D;  4DR1 L;  1PFS A;  1C9O A;  5DEH A;  1IW7 C;  5A2Q L;  2L9H A;  1ESF A;  3A7L A;  5BN5 A;  1ASY A;  2XGT A;  4A3G B;  2UXD Q;  1N8R C;  1R4Q B;  2EIF A;  2RA4 A;  1NBW A;  4LMQ D;  3F2B A;  2E8G A;  4DR2 Q;  2F1M A;  4YHH Q;  2PI2 E;  1VQA A;  1FJG L;  4O42 A;  5C4Z A;  4ZKB B;  3A8J E;  1UE1 A;  3K6O A;  4KJN A;  1IYV A;  1Y1V B;  4DAM A;  1STA A;  5DNF A;  1CSP A;  5NUC A;  4K6D A;  4POG A;  3CXC A;  3X3N A;  4A4I A;  4DGZ A;  5JVH 3;  2ZJQ A;  3A54 A;  4HID A;  3S2D B;  2WV6 D;  4UP8 A;  4A93 B;  3KJO A;  2K5N A;  3EBE A;  1PRT C;  2K32 A;  2X6G A;  4HIK A;  3EIV A;  3S1Q H;  5CBE E;  3RZD H;  4WJ3 M;  2KHS A;  1RTO A;  2K5H A;  4MN3 A;  5E7N A;  1CUK A;  3L2P A;  3HOZ G;  3CU7 A;  1SE2 A;  2F0N A;  2I07 B;  4A3D G;  3GTG B;  3S15 H;  3S1M H;  1U0L A;  4ZAI A;  3QWN A;  1B1Z A;  1RD9 D;  1PA6 A;  1TU2 B;  2LMC B;  2EJF C;  3RNU A;  1XYI A;  5ELE A;  5E3F A;  1T9H A;  4OGQ C;  2KOL A;  1LUZ A;  2MUY A;  2L15 A;  1MBY A;  2AWO A;  1JB7 A;  4V19 0;  4DV0 L;  2QDL A;  1PZJ D;  1NE3 A;  1TWA H;  3TS2 A;  2EY1 A;  5AFW A;  2KVM A;  3JAM i;  2BE5 C;  2MHV A;  4Q0F A;  4LF4 L;  4Z9C B;  4JV5 Q;  1BVS A;  1L0W A;  1B9N A;  4PNY A;  2AQ1 B;  2IHF A;  1EY5 A;  4YWM A;  1IBL L;  2G9D A;  3QR8 A; 
#chains in the Genus database with same CATH homology
 3GD7 A;  2EXZ A;  5C4H A;  3P7J A;  4HCS A;  4IFD H;  2A5H A;  2D2C C;  1EOT A;  5JEA H;  2OT2 A;  2F0S A;  1BF4 A;  3S16 B;  2IL8 A;  3VYR A;  1PDQ A;  2J4X A;  1HA6 A;  4XTC S;  3NTH A;  1T5E A;  2SOB A;  1PLF A;  3K59 A;  3TN2 A;  3M4Y A;  3I70 A;  2QCP X;  3EA6 A;  2LY7 A;  2WKC A;  1XTC D;  5KRU A;  1UEA B;  2D62 A;  2WAC A;  4XIG S;  4CKC A;  1TS2 A;  1DOM A;  3HOX B;  5KND A;  1LAB A;  2A68 C;  1F77 A;  5ISR A;  4DA2 A;  1EU3 A;  3BVM A;  3NBI A;  4G7H C;  2Z1C A;  2R92 B;  1U9R A;  2HCC A;  3O13 A;  3TZD A;  2EYF A;  3DEP A;  4B08 A;  5G3L D;  1VF5 C;  3S1R B;  2E2D C;  1PZK D;  4E6I A;  1JOK A;  1ROD A;  3ZYY X;  3MFG A;  1BXT A;  1FNW A;  2D9U A;  1H9S B;  2J7Z A;  2LKV A;  5COR A;  2I46 A;  2HCI A;  5DM6 3;  5D3D A;  1ZYR D;  2IPK D;  3MZ5 A;  5A2Q E;  4DNT B;  1A15 A;  3T56 B;  5J22 A;  3NP8 A;  1EEF D;  3SK6 A;  2NBF A;  1I4X A;  2EYJ A;  2D5D A;  3S1N B;  3K7A B;  1EY6 A;  3P20 A;  1S4Z A;  4WRD A;  5JOB A;  1I4R A;  4DXG A;  4NKL A;  1JOR A;  1TWG B;  4S3S A;  3ND9 A;  5FOB B;  4U67 3;  2E74 C;  1B4O A;  2NZ1 D;  3HRZ C;  4H13 C;  1JB3 A;  1I50 B;  5I2Y A;  4JBW A;  1VF7 A;  1UUP A;  4RKB A;  1GUW A;  5IGC A;  4KI0 A;  1D2B A;  3SK4 A;  1KNA A;  1EFI D;  1U4P A;  1LV9 A;  4RWS C;  3T53 B;  2NN6 I;  4A3B B;  1VMP A;  4KJO A;  3CRK C;  4KTA A;  5C0X H;  4CBV A;  4K14 A;  1F9P A;  3BZD B;  2B2V C;  2PZT A;  1BQQ T;  3FMC A;  1B50 A;  2PZW A;  4M1U B;  1WD1 A;  1HUN A;  2EJG C;  5IGG A;  1ILP A;  1LT5 D;  1DCZ A;  5A35 A;  2MP1 A;  1NSN S;  3LWU A;  2R93 B;  2HQE A;  1F2L A;  3M3Y B;  1CM9 A;  4A3K B;  1BR9 A;  2VXW A;  4BY7 B;  2NVT B;  5EPK A;  3KLR A;  2JYO A;  3HOV B;  4K8J A;  4ZUJ A;  4I65 A;  1SYF A;  1JOO A;  1ET9 A;  4BA2 I;  2AUJ D;  3M7N A;  1EQV A;  2EY6 A;  2ICI A;  2F0U A;  5JJZ A;  4DAY A;  3DHQ A;  2JE6 I;  1DD2 A;  1SE3 A;  1DXM A;  3EJI A;  2B2Y A;  1PRT B;  1Q8I A;  1LTI D;  1E2V A;  1ONL A;  4KKT A;  4FXD A;  1QOH A;  1CTM A;  3CRL C;  4IUN A;  1ML0 D;  1JWU D;  1WTR A;  1KLU D;  4IFD J;  2XRQ D;  4HN7 A;  2B2U A;  1PZI D;  4RFB A;  5LL6 X;  1PXU A;  1SNO A;  1A2T A;  1RJT A;  2HUG A;  3D6W A;  3KLS X;  3VYU A;  3SDZ A;  1U4R A;  2K1B A;  2RVL A;  4CJ2 C;  1A3U A;  2RSO A;  3C1E A;  4L63 B;  3R93 A;  1L0Y B;  3T13 A;  2F0E A;  1Q12 A;  5ELC A;  5JAV A;  4DK1 A;  3AMU A;  4OIJ A;  2O5I C;  2EY2 A;  2XN9 C;  1J9O A;  2IW3 A;  1ZYR C;  4UAI A;  4KMU C;  1TVX A;  1SSO A;  1EY7 A;  2ZXR A;  3NWT A;  5KGU A;  2F0I A;  3GO5 A;  4J6H A;  3IL8 A;  3S1Q B;  1QNK A;  2L55 A;  4FYD A;  4CJ1 B;  3RZD B;  4HTH A;  3BYT B;  2F0T A;  1BCP F;  2KUM A;  4QB4 A;  4RGN A;  3PUY A;  1SEB D;  4RCN A;  1H9M A;  5M5W B;  3H94 A;  2JA6 B;  3S15 B;  3S1M B;  3BVZ A;  3PMF A;  3J7Y W;  1WTX A;  1EU4 A;  5FK9 C;  3OMG A;  5EPL A;  5LHY 1;  3MXG A;  1QJO A;  3SK8 A;  1RCV D;  1STG A;  2PO4 A;  1YNJ C;  5HGT A;  2AWN A;  1AEX A;  1TS5 A;  5KEE A;  2DNC A;  2F0V A;  1EIG A;  3FVQ A;  3H91 A;  1TWA B;  1SJH D;  3VR3 A;  1AW7 A;  2SNS A;  3X3M A;  2EDG A;  2K05 A;  3L3O C;  3PV0 A;  1X3P A;  3DWA A;  1SFO B;  4DU9 A;  1OXX K;  5J1Z A;  5IGF A;  2KA7 A;  1HRJ A;  1LO5 D;  1JE4 A;  5EKL A;  1HQM C;  4J1M A;  5T1I A;  1ZXT A;  3BDO A;  1GUS A;  1F9Q A;  2KCN A;  5I9O A;  4K5W A;  3OWF A;  3WOF A;  2J0T D;  3TDQ A;  3BVG A;  5M9O A;  3F2U A;  4C2M B;  5C0X J;  3L9A X;  1S5E D;  4QCL A;  2K33 A;  3TBI B;  2RDG A;  3DWP A;  1LLR D;  4DF7 A;  3HGB A;  4KY6 A;  3K57 A;  1SNQ A;  4EQO A;  1V1P B;  1MGS A;  4ZLT F;  3SVM A;  3T16 A;  3NPP A;  5K36 G;  3G6J B;  1PFN A;  1VDZ A;  2F0J A;  1GJX A;  4OO1 G;  1OXS C;  1LAC A;  1I4G A;  4FF2 A;  2QEJ C;  4L8J A;  3MXP A;  4WJW A;  1E2Z A;  1HTP A;  2K04 A;  3GV6 A;  2FFK B;  1PYW D;  1EY0 A;  4DK0 A;  2ICE C;  2JEB I;  2IX1 A;  2PCF B;  4KY5 A;  3EFX D;  2NVQ B;  3VA7 A;  2B2W C;  1BNZ A;  5FKA C;  1EQT A;  3K0Y A;  4JK1 C;  2Q8T A;  1I4H A;  1HFN A;  4C3J G;  3A8I E;  1STY A;  2A73 B;  3DXJ C;  1A3V A;  1FGB D;  4KN4 C;  4BWG B;  1IYU A;  2DNE A;  3W3A A;  1Z7T A;  2IWH A;  2K5Q A;  4ULL A;  1I3Q B;  1AFP A;  2E2J B;  3HOY B;  4K6L A;  3HKZ B;  1KAA A;  2F0G A;  1ZKO A;  2RQX A;  4EVO A;  3H6M A;  5C4X B;  4LJZ C;  4MIU A;  3Q24 A;  4A3I B;  1JWM D;  5M5X B;  3N52 A;  2B8F A;  3HS0 C;  2MGS A;  5C44 B;  4IUQ A;  4OO1 I;  5T1G A;  3SHL A;  1I6H B;  2O2L D;  2JA7 B;  1W6K A;  5E1F A;  5EKI A;  2A6E D;  1WVL A;  3FEW X;  1TS4 A;  5M3F B;  1H9K A;  3VR4 A;  2B8G A;  2KEE A;  3C2P A;  3M4O B;  3FDT A;  1Y8P B;  1NAP A;  3GTO B;  4C3J B;  1WTP A;  1EZ6 A;  3ERO A;  4P2C B;  2EOT A;  2IJ0 A;  4KKU A;  4Q5V A;  4HSP A;  2PNR C;  1G2S A;  1H9J A;  3URY A;  3RMH A;  3MTS A;  3A55 A;  4WFN 3;  1X3Q A;  3SR1 A;  1KDC A;  1MI2 A;  1ZEQ X;  1EYA A;  2R61 A;  4DAP A;  1ENA A;  4FXG C;  2XSC A;  1DOL A;  2M9V A;  3TME A;  1G8Z D;  4CKB A;  1Y1W B;  3U9O A;  3RZO B;  3PUZ A;  1VCI A;  2K5W A;  3ND8 A;  4PMC A;  1WCM B;  1LTS D;  3KF8 A;  2E75 C;  4QIW B;  1A6X A;  1KDB A;  4KHV A;  3A56 A;  1WTV A;  3UI2 A;  4FF1 A;  3V96 A;  3HOU B;  4C3I B;  1PTO H;  4XYQ A;  3PIP 3;  4C56 C;  1LT4 D;  3OPO A;  1V43 A;  3E0J A;  4QUF A;  4X3T A;  4BBR B;  2WAQ B;  4KN7 C;  2F0O A;  2XNA C;  5CV5 A;  4K8I A;  1HCZ A;  2C9O A;  2F4I A;  1STH A;  3NQI A;  2EZV A;  1PTO F;  1D5X C;  2M00 A;  2NN6 G;  1O7Y A;  3I90 A;  2L4N A;  1IHZ A;  3EVQ A;  1SND A;  1GUG A;  2L11 A;  3DUZ A;  4ME5 A;  4G7O C;  3OHX C;  1I4Q A;  3CQZ B;  3NBH A;  2IX3 A;  3E6Z X;  5I6Y A;  1HQR D;  4ILW A;  2R6G A;  5EGT A;  1X32 A;  5EBC A;  5IGB A;  5FO7 B;  1M8A A;  3I3C A;  4FF4 A;  1SNC A;  3KBX A;  1V1O A;  1CZG A;  4J8Q A;  4BBS B;  4ZUI A;  1ICW A;  5EKK A;  3GQB A;  3NHH A;  1YNJ D;  3PUW A;  3RLF A;  4DAV A;  3K5L A;  3FPU B;  1LT3 D;  3D4W A;  3PUX A;  1FNU A;  2L1B A;  3BYY B;  4XXE A;  1QB5 D;  3HP3 A;  4A3J B;  1BCP D;  1EY4 A;  1SNP A;  1EYC A;  5FO9 B;  3P1H A;  1D5Z C;  4KD4 A;  3R8B A;  3IFT A;  4NMZ A;  1C8C A;  5EBD A;  2A6E C;  2WB1 B;  3D4R A;  1GUT A;  1D6E C;  1U4M A;  3MC0 B;  4KV6 A;  2DY7 A;  1DZ1 A;  4PMB A;  4QMG A;  4XT3 B;  1LTB D;  2N55 A;  3RUZ A;  1HFG A;  5E4X A;  4UDU C;  3I73 A;  2ENB A;  3JAM L;  3FRP B;  4BS9 A;  3OWE B;  3GTK B;  1EL0 A;  3DWQ A;  1KAB A;  1VMC A;  1BUV T;  2TSS A;  1KNE A;  2PYK A;  4A3M B;  1II3 A;  1SBB B;  2F0K A;  2EE1 A;  2F0W A;  3QB3 A;  5IGD A;  2Q8R E;  1Q1E A;  3MWY W;  1U4L A;  2L0C A;  1AN8 A;  2Z8L A;  1PFB A;  2F0F A;  1PFM A;  5D3I B;  3V2T A;  1SYE A;  3MAQ A;  5CMD A;  1K8M A;  4RGT A;  3A7A B;  4FO2 A;  3HOW B;  4C1N I;  4K2K A;  1CZW A;  2K6A A;  3M85 A;  1JQY D;  4FP5 D;  2NB0 A;  3S17 B;  1GUN A;  3I4N B;  1EYD A;  2PQE A;  3OW7 A;  5CV4 A;  3OSO A;  1AZP A;  1GXD C;  2ZXO A;  1QCB D;  3KBG A;  3TP8 A;  3T51 B;  4G57 A;  2WIN B;  1FR3 A;  5I9P A;  1CQV A;  3KUP A;  2NTS A;  2NYZ D;  3QIA A;  5C6A A;  1NR4 A;  2CVR A;  4IUP A;  4OIK A;  1Y69 U;  1A3T A;  2C5C A;  1FNV A;  2RKS A;  4XDX A;  1WTQ A;  2Y0S B;  1Q90 A;  3J81 L;  2R3Z A;  3ERQ A;  2BA0 A;  2TMP A;  3S14 B;  1GUO A;  1H9S A;  3MXU A;  1D5M C;  3W2D A;  3KK7 A;  4ZRZ A;  5KYI A;  1M4V A;  4IFD G;  4I7Z C;  2B2Y C;  4U68 A;  2XVS A;  5JEA G;  3D8G A;  3H3V C;  3E5S A;  1BOS A;  5CR3 A;  4IAL A;  4DFA A;  1BBX C;  1DYQ A;  1SMY D;  1OXT A;  2B2U C;  4K5V A;  5IIF A;  4RCO A;  2F3W A;  1DOK A;  2BCO A;  1RTN A;  4R9W A;  1XXG A;  5C5L A;  2EYH A;  2NVY B;  1NUC A;  3D6C A;  1UNS A;  5K5P A;  2EYP A;  4DN4 M;  1DM0 B;  3VYT A;  2X6L A;  3A8K E;  1IKM A;  4XQN A;  1GOZ A;  4X3K A;  1BCP C;  4HED A;  4O1N A;  4PMW A;  4TKO B;  2B2T A;  3ONA B;  3FPP A;  3Q22 A;  2KQ3 A;  4TSS A;  4FVM A;  2K03 A;  5EPJ A;  3LWE A;  4KHZ A;  3TZU A;  5J39 A;  1EWC A;  2JA5 B;  3PO3 B;  2OF1 A;  1O80 A;  4IFD I;  3BG3 A;  1KLG D;  3JAM E;  1TY2 A;  5CBA E;  2RBM A;  1OXV A;  1ILQ A;  5HUR A;  1KDA A;  1STE A;  3GTJ B;  4IQZ A;  4N9P A;  1DON A;  1QNU A;  3TP7 A;  2LFN A;  2V4D A;  4PV1 C;  1HHV A;  2F3V A;  3IKJ A;  2EYM A;  4XYO A;  1MSH A;  4L6T B;  4TQU S;  4EGV A;  2EYO A;  3AU7 A;  3GTL B;  2JA8 B;  2VB3 X;  1XWE A;  4ABN A;  1SJE D;  1S5C D;  2NTT A;  3I4M B;  4F88 A;  2EVB A;  1LT6 D;  1CA6 A;  1I4P A;  4H7B A;  5C3W A;  4ZK9 B;  5C5M A;  4NP5 A;  3C46 A;  3GTM B;  4IUT A;  1JC7 A;  1TWC B;  1TT2 A;  1EWH A;  2NVX B;  3MA2 B;  3LX0 A;  2K7V A;  3Q6S A;  2FHT A;  2QIL A;  1Z47 A;  4ID6 A;  1CHP D;  3WDN A;  4HMJ A;  1CI3 M;  5C0X G;  3FKI B;  2JSO A;  3BS1 A;  4H0L C;  4M8A A;  1LTA D;  3NQT A;  4RHR A;  1JR0 D;  2K5D A;  3K5O A;  2M2L A;  3V05 A;  1PTO D;  3PIO 3;  4G4K A;  3J81 E;  5DAU A;  5I4D A;  4B9X A;  2H4O A;  1STB A;  4R8I A;  1PRT F;  4FNF A;  1CQF A;  4K2L A;  5FLX L;  4DXF A;  2AQ3 B;  5F2D A;  2F0D A;  3DMU A;  1SNM A;  3D3R A;  1SYD A;  1E2W A;  3K58 A;  5KNB A;  5I2X A;  2CHB D;  2A69 D;  4N9T A;  5M5Y B;  3S2H B;  2ID0 A;  1CFM A;  3N6R A;  3NTK A;  3R3O A;  5KYL A;  2OEO A;  2YU9 B;  2NUC A;  4QF4 A;  3EQL C;  1G2T A;  3WOE A;  4IUV A;  2CW0 C;  1SYB A;  3NXW A;  2PPB C;  3TSS A;  3GP7 A;  5C0X I;  3VA5 A;  1HUM A;  1SMY C;  5EQ0 A;  4C3I G;  1B2T A;  1CHQ D;  1QIL A;  3K5N A;  1T5X D;  3VR6 A;  1STN A;  3OMC A;  5CV6 A;  3H0G B;  1SXT A;  3SEB A;  2L12 A;  4OHJ A;  2XIW A;  4X3U A;  4RGO S;  4EQN A;  3Q23 A;  2AQ2 B;  3SXH A;  2RSN A;  2IX0 A;  2QF7 A;  4Y7N B;  5JPM C;  5JPN C;  1AZQ A;  2PW7 A;  2F0P A;  1G29 1;  1SYG A;  4G7Z C;  2B39 A;  4BY1 B;  2CQA A;  4IZ8 A;  2VUM B;  3TP5 A;  3HOZ B;  5IT9 L;  1IKL A;  4A3D B;  4HAE A;  1SDF A;  1EZ8 A;  1F2Z A;  2E2H B;  2BDO A;  4FF3 A;  1EIH A;  4AYB B;  1CK1 A;  4RAU C;  3TP6 A;  1EEI D;  1B44 D;  3KLS A;  1K83 B;  1V1P A;  1J8I A;  2EJM A;  5ELF A;  2JEA I;  1V8Q A;  3SK5 A;  3MFY A;  5IGE A;  1O7Z A;  4RHS A;  1BCP B;  4LAA A;  2F0L A;  2JXM B;  2N88 A;  4IUU A;  4XQQ A;  3QOJ A;  4MHE A;  1IL8 A;  1ET6 A;  2PZU A;  2BOS A;  3J7A V;  4ZKC B;  4ZYS A;  4TRD A;  3CHB D;  5FO8 B;  2WII B;  2RDF A;  1O7L A;  5EJW A;  5FLX E;  1CA5 A;  3SE0 A;  1HXY D;  3CKI B;  4RH6 A;  1UAP A;  2B2V A;  1NR2 A;  3MEH A;  2HDM A;  1PTO C;  5D14 A;  2OXP A;  1QE6 A;  4GZY C;  1RKN A;  4ODG A;  5BN3 A;  1NCV A;  1SYC A;  4NW2 A;  4XT1 B;  3R2T A;  1F2M A;  2A69 C;  2G9H D;  4R8N A;  1F2Y A;  3NTI A;  3R2I A;  2KED A;  1S5B D;  4X3S A;  3IFD A;  1G6Z A;  3G7L A;  4KK7 A;  1JCK B;  1F9S A;  4H44 C;  1F9R A;  5K36 H;  2E2I B;  1TQO A;  2RDH A;  1HPC A;  3NWS A;  5KIX A;  1G91 A;  3PO2 B;  1C4Q A;  4RA8 A;  2PW5 A;  1R4P B;  2FIN B;  4OO1 H;  1D1I A;  3OOC A;  3QOL A;  2A6H D;  2EPB A;  3RD4 A;  2WP8 J;  2K01 A;  4XQJ A;  2R7Z B;  1OO9 B;  1TWF B;  2YYZ A;  4OL7 A;  3PUV A;  5JVG 3;  2EYL A;  4ZQ3 A;  2VNU D;  1D1K A;  1W6J A;  1QWY A;  4HSV A;  3H09 A;  3NUC A;  3D31 A;  2Q8I B;  1ENC A;  4KKS A;  1L0X B;  1HTL D;  2H1E A;  3DEO A;  1O78 A;  2FJ2 A;  4C1N K;  2XRS D;  1LTT D;  3OIQ A;  4KD3 A;  5CV9 A;  1HA5 A;  2IT1 A;  2KEC A;  2QDB A;  3QG1 A;  1B3A A;  2K28 A;  2AUK A;  5IT9 E;  5I6W A;  5IOD A;  1YNN D;  1BDO A;  3C1F A;  1XX8 A;  2XWJ B;  4CKE A;  3GTQ B;  4HCE A;  3VR5 A;  4LK1 C;  2F03 A;  1B9M A;  4QUC A;  4A3F B;  2SEB D;  4V0B A;  4IN3 A;  5G3L F;  2EY5 A;  2GA4 B;  4YIJ A;  3I4L A;  1AP0 A;  3K5M A;  5LL6 S;  2F0Q A;  2KJX A;  4HMI A;  2ZT9 C;  5BN4 A;  5IOC A;  4WOR A;  4KY7 A;  5JEA J;  1SE4 A;  1KTK A;  3MHB A;  5E4W C;  1IW7 D;  2E76 C;  3J80 L;  3MXN A;  1EY9 A;  3QO2 A;  3J7A F;  1ENF A;  1A2U A;  3M7G A;  5ELB A;  5CV8 A;  5CYU A;  3LNN A;  1DJR D;  1MD2 D;  1JOQ A;  3T4A C;  2SDF A;  4RGM A;  1TR5 A;  4EQP A;  1JWS D;  1TS3 A;  3HEJ A;  1PRT D;  1S5F D;  2CW0 D;  3NSW A;  3HZX A;  1K8O A;  3I8Z A;  3VR2 A;  2XWB B;  1WTW A;  2NWG A;  3NK9 A;  4HR7 B;  3HG9 A;  3MVV A;  3P75 A;  1Z6H A;  4A3E B;  3U9S A;  2DY8 A;  2VB2 X;  3NE5 B;  3IAY A;  1EY8 A;  1GHJ A;  3GV3 A;  5CV7 A;  4NDX A;  4CHT B;  2O5J C;  1Y8O B;  5C4J B;  1GHK A;  2F0H A;  1TII D;  4DNR B;  2BA1 A;  5M3M B;  3I91 A;  1B53 A;  1E0B A;  5ELD A;  2BE5 D;  2NN6 H;  1R9T B;  1FD7 D;  4C3H G;  3ITP A;  2O4X A;  1TWH B;  3BDL A;  1RF2 D;  4F87 A;  3S9W A;  3GTP B;  2A6H C;  2HDL A;  4BA1 I;  1BO0 A;  1LTR D;  4F7X A;  2JP1 A;  2Z4I A;  3AB9 A;  1S5D D;  1ESR A;  1FYC A;  1OXU A;  2PMZ B;  1LTG D;  1PMR A;  2F0M A;  4B9W A;  2MJ8 A;  1PTO B;  4IUR A;  2FMC A;  3D4D A;  3VYS A;  2B2W A;  2B63 B;  4PQX A;  3BDC A;  3DM1 A;  3C3L A;  1Q3L A;  2KCC A;  2LS0 1;  5COY A;  1Y8N B;  1WD0 A;  2A68 D;  4K5X A;  1H9R A;  4RKL A;  2X69 A;  5DM7 3;  1QG7 A;  2Z4H A;  2B2T C;  2BDN A;  5CGK A;  5C3E B;  2WKD A;  4C3H B;  1YNN C;  3I72 A;  3Q0A A;  1C48 A;  2MPM A;  2SNM A;  5KNC A;  1WTO A;  4CGY B;  4FXK C;  2FMM A;  4CJ0 B;  1SAP A;  5TSS A;  3L7Z C;  1RHP A;  5CC4 A;  1JIC A;  2A74 C;  1CT1 D;  2L5T A;  3QJY A;  5D65 A;  3J80 E;  2ZXP A;  1TKW B;  1TY0 A;  2QKI C;  1MSG A;  4F8M A;  2DN8 A;  1I6V C;  5C3X A;  1Q1B A;  3OIP A;  1RDP D;  5DEH A;  1IW7 C;  5A2Q L;  2L9H A;  1ESF A;  3A7L A;  5BN5 A;  4A3G B;  1R4Q B;  4LMQ D;  2RA4 A;  2F1M A;  4O42 A;  5C4Z A;  4ZKB B;  3A8J E;  3K6O A;  4KJN A;  1IYV A;  1Y1V B;  1STA A;  5DNF A;  5NUC A;  4K6D A;  3X3N A;  4DGZ A;  5JVH 3;  3A54 A;  3S2D B;  2WV6 D;  4A93 B;  1PRT C;  2K32 A;  2X6G A;  5CBE E;  2KHS A;  1RTO A;  4MN3 A;  3CU7 A;  1SE2 A;  2F0N A;  2I07 B;  3GTG B;  4ZAI A;  3QWN A;  1B1Z A;  1RD9 D;  1TU2 B;  2LMC B;  2EJF C;  1XYI A;  5ELE A;  5E3F A;  4OGQ C;  2KOL A;  2MUY A;  1MBY A;  2AWO A;  4V19 0;  1PZJ D;  2EY1 A;  5AFW A;  2KVM A;  2BE5 C;  2MHV A;  4Q0F A;  4Z9C B;  1B9N A;  4PNY A;  2AQ1 B;  1EY5 A;  2G9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...