2K7XA

Solution structure of c-terminal domain of sars-cov main protease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
120
structure length
120
Chain Sequence
b'DRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SARS-CoV main protease
publication title C-terminal domain of SARS-CoV main protease can form a 3D domain-swapped dimer.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 37
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2k7xA00
3D62A 2Z3DA 3EA8A 3E91A 2PWXA 2QIQA 4MDSA 3EA9A 2GZ7A 4WMEA 3TNTA 3EBNA 2YNAA 3ATWA 5C5NA 1P9UA 1UJ1A 3VB6A 5GWZA 3VB4A 2BX4A 5HYOA 3TITA 2AMPA 2GZ9A 2A5KA 2H2ZA 5C5OA 3SZNA 4YO9A 2D2DA 1Q2WA 4YLUA 3EA7A 3D23A 3IWMA 4WMFA 2GTBA 2Z3EA 2YNBA 2QCYA 4RSPA 4TWWA 1UK4A 2A5AA 3M3SA 1P9SA 3VB7A 1UK2A 2Z9KA 2GX4A 2ZU2A 3VB5A 2K7XA 2BX3A 3AW1A 4F49A 2AMQA 2QC2A 4YOIA 2GT7A 2A5IA 1WOFA 4ZROA 3SNBA 3AVZA 4XFQA 3FZDA 2DUCA 3F9EA 3SNEA 2LIZA 5EU8A 4WY3A 2Z9LA 2C3SA 1UK3A 4WMDA 2Q6FA 2GZ8A 3SNDA 2ALVA 2ZU5A 2Q6GA 3M3TA 1Z1JA 3SNCA 2GT8A 4TWYA 2VJ1A 3AW0A 4YOJA 2AMDA 3TLOA 3EAJA 2V6NA 2Z9GA 2HOBA 2Z9JA 3VB3A 4ZUHA 2OP9A 2Q6DA 2Z3CA 1LVOA 3SN8A 3SNAA 3TIUA 2Z94A 3F9FA 3F9GA 2ZU4A 4YOGA 3F9HA 3M3VA 5C3NA 3TNSA 5B6OA 1Z1IA 3V3MA 4HI3A
chains in the Genus database with same CATH superfamily
3D62A 2Z3DA 3EA8A 3E91A 2PWXA 2QIQA 4MDSA 3EA9A 2GZ7A 4WMEA 3TNTA 3EBNA 2YNAA 3ATWA 5C5NA 1P9UA 1UJ1A 3VB6A 5GWZA 3VB4A 2BX4A 5HYOA 3TITA 2AMPA 2GZ9A 2A5KA 2H2ZA 5C5OA 3SZNA 4YO9A 2D2DA 1Q2WA 4YLUA 3EA7A 3D23A 3IWMA 4WMFA 2GTBA 2Z3EA 2YNBA 2QCYA 4RSPA 4TWWA 1UK4A 2A5AA 3M3SA 1P9SA 3VB7A 1UK2A 2Z9KA 2GX4A 2ZU2A 3VB5A 2K7XA 2BX3A 3AW1A 4F49A 2AMQA 2QC2A 4YOIA 2GT7A 2A5IA 1WOFA 4ZROA 3SNBA 3AVZA 4XFQA 3FZDA 2DUCA 3F9EA 3SNEA 2LIZA 5EU8A 4WY3A 2Z9LA 2C3SA 1UK3A 4WMDA 2Q6FA 2GZ8A 3SNDA 2ALVA 2ZU5A 2Q6GA 3M3TA 1Z1JA 3SNCA 2GT8A 4TWYA 2VJ1A 3AW0A 4YOJA 2AMDA 3TLOA 3EAJA 2V6NA 2Z9GA 2HOBA 2Z9JA 3VB3A 4ZUHA 2OP9A 2Q6DA 2Z3CA 1LVOA 3SN8A 3SNAA 3TIUA 2Z94A 3F9FA 3F9GA 2ZU4A 4YOGA 3F9HA 3M3VA 5C3NA 3TNSA 5B6OA 1Z1IA 3V3MA 4HI3A
chains in the Genus database with same CATH topology
3D62A 2Z3DA 3EA8A 3E91A 2PWXA 2QIQA 4MDSA 3EA9A 2GZ7A 4WMEA 3TNTA 3EBNA 2YNAA 3ATWA 5C5NA 1P9UA 1UJ1A 3VB6A 5GWZA 3VB4A 2BX4A 5HYOA 3TITA 2AMPA 2GZ9A 2A5KA 2H2ZA 5C5OA 3SZNA 4YO9A 2D2DA 1Q2WA 4YLUA 3EA7A 3D23A 3IWMA 4WMFA 2GTBA 2Z3EA 2YNBA 2QCYA 4RSPA 4TWWA 1UK4A 2A5AA 3M3SA 1P9SA 3VB7A 1UK2A 2Z9KA 2GX4A 2ZU2A 3VB5A 2K7XA 2BX3A 3AW1A 4F49A 2AMQA 2QC2A 4YOIA 2GT7A 2A5IA 1WOFA 4ZROA 3SNBA 3AVZA 4XFQA 3FZDA 2DUCA 3F9EA 3SNEA 2LIZA 5EU8A 4WY3A 2Z9LA 2C3SA 1UK3A 4WMDA 2Q6FA 2GZ8A 3SNDA 2ALVA 2ZU5A 2Q6GA 3M3TA 1Z1JA 3SNCA 2GT8A 4TWYA 2VJ1A 3AW0A 4YOJA 2AMDA 3TLOA 3EAJA 2V6NA 2Z9GA 2HOBA 2Z9JA 3VB3A 4ZUHA 2OP9A 2Q6DA 2Z3CA 1LVOA 3SN8A 3SNAA 3TIUA 2Z94A 3F9FA 3F9GA 2ZU4A 4YOGA 3F9HA 3M3VA 5C3NA 3TNSA 5B6OA 1Z1IA 3V3MA 4HI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D62 A;  2Z3D A;  3EA8 A;  3E91 A;  2PWX A;  2QIQ A;  4MDS A;  3EA9 A;  2GZ7 A;  4WME A;  3TNT A;  3EBN A;  2YNA A;  3ATW A;  5C5N A;  1P9U A;  1UJ1 A;  3VB6 A;  5GWZ A;  3VB4 A;  2BX4 A;  5HYO A;  3TIT A;  2AMP A;  2GZ9 A;  2A5K A;  2H2Z A;  5C5O A;  3SZN A;  4YO9 A;  2D2D A;  1Q2W A;  4YLU A;  3EA7 A;  3D23 A;  3IWM A;  4WMF A;  2GTB A;  2Z3E A;  2YNB A;  2QCY A;  4RSP A;  4TWW A;  1UK4 A;  2A5A A;  3M3S A;  1P9S A;  3VB7 A;  1UK2 A;  2Z9K A;  2GX4 A;  2ZU2 A;  3VB5 A;  2K7X A;  2BX3 A;  3AW1 A;  4F49 A;  2AMQ A;  2QC2 A;  4YOI A;  2GT7 A;  2A5I A;  1WOF A;  4ZRO A;  3SNB A;  3AVZ A;  4XFQ A;  3FZD A;  2DUC A;  3F9E A;  3SNE A;  2LIZ A;  5EU8 A;  4WY3 A;  2Z9L A;  2C3S A;  1UK3 A;  4WMD A;  2Q6F A;  2GZ8 A;  3SND A;  2ALV A;  2ZU5 A;  2Q6G A;  3M3T A;  1Z1J A;  3SNC A;  2GT8 A;  4TWY A;  2VJ1 A;  3AW0 A;  4YOJ A;  2AMD A;  3TLO A;  3EAJ A;  2V6N A;  2Z9G A;  2HOB A;  2Z9J A;  3VB3 A;  4ZUH A;  2OP9 A;  2Q6D A;  2Z3C A;  1LVO A;  3SN8 A;  3SNA A;  3TIU A;  2Z94 A;  3F9F A;  3F9G A;  2ZU4 A;  4YOG A;  3F9H A;  3M3V A;  5C3N A;  3TNS A;  5B6O A;  1Z1I A;  3V3M A;  4HI3 A; 
#chains in the Genus database with same CATH topology
 3D62 A;  2Z3D A;  3EA8 A;  3E91 A;  2PWX A;  2QIQ A;  4MDS A;  3EA9 A;  2GZ7 A;  4WME A;  3TNT A;  3EBN A;  2YNA A;  3ATW A;  5C5N A;  1P9U A;  1UJ1 A;  3VB6 A;  5GWZ A;  3VB4 A;  2BX4 A;  5HYO A;  3TIT A;  2AMP A;  2GZ9 A;  2A5K A;  2H2Z A;  5C5O A;  3SZN A;  4YO9 A;  2D2D A;  1Q2W A;  4YLU A;  3EA7 A;  3D23 A;  3IWM A;  4WMF A;  2GTB A;  2Z3E A;  2YNB A;  2QCY A;  4RSP A;  4TWW A;  1UK4 A;  2A5A A;  3M3S A;  1P9S A;  3VB7 A;  1UK2 A;  2Z9K A;  2GX4 A;  2ZU2 A;  3VB5 A;  2K7X A;  2BX3 A;  3AW1 A;  4F49 A;  2AMQ A;  2QC2 A;  4YOI A;  2GT7 A;  2A5I A;  1WOF A;  4ZRO A;  3SNB A;  3AVZ A;  4XFQ A;  3FZD A;  2DUC A;  3F9E A;  3SNE A;  2LIZ A;  5EU8 A;  4WY3 A;  2Z9L A;  2C3S A;  1UK3 A;  4WMD A;  2Q6F A;  2GZ8 A;  3SND A;  2ALV A;  2ZU5 A;  2Q6G A;  3M3T A;  1Z1J A;  3SNC A;  2GT8 A;  4TWY A;  2VJ1 A;  3AW0 A;  4YOJ A;  2AMD A;  3TLO A;  3EAJ A;  2V6N A;  2Z9G A;  2HOB A;  2Z9J A;  3VB3 A;  4ZUH A;  2OP9 A;  2Q6D A;  2Z3C A;  1LVO A;  3SN8 A;  3SNA A;  3TIU A;  2Z94 A;  3F9F A;  3F9G A;  2ZU4 A;  4YOG A;  3F9H A;  3M3V A;  5C3N A;  3TNS A;  5B6O A;  1Z1I A;  3V3M A;  4HI3 A; 
#chains in the Genus database with same CATH homology
 3D62 A;  2Z3D A;  3EA8 A;  3E91 A;  2PWX A;  2QIQ A;  4MDS A;  3EA9 A;  2GZ7 A;  4WME A;  3TNT A;  3EBN A;  2YNA A;  3ATW A;  5C5N A;  1P9U A;  1UJ1 A;  3VB6 A;  5GWZ A;  3VB4 A;  2BX4 A;  5HYO A;  3TIT A;  2AMP A;  2GZ9 A;  2A5K A;  2H2Z A;  5C5O A;  3SZN A;  4YO9 A;  2D2D A;  1Q2W A;  4YLU A;  3EA7 A;  3D23 A;  3IWM A;  4WMF A;  2GTB A;  2Z3E A;  2YNB A;  2QCY A;  4RSP A;  4TWW A;  1UK4 A;  2A5A A;  3M3S A;  1P9S A;  3VB7 A;  1UK2 A;  2Z9K A;  2GX4 A;  2ZU2 A;  3VB5 A;  2K7X A;  2BX3 A;  3AW1 A;  4F49 A;  2AMQ A;  2QC2 A;  4YOI A;  2GT7 A;  2A5I A;  1WOF A;  4ZRO A;  3SNB A;  3AVZ A;  4XFQ A;  3FZD A;  2DUC A;  3F9E A;  3SNE A;  2LIZ A;  5EU8 A;  4WY3 A;  2Z9L A;  2C3S A;  1UK3 A;  4WMD A;  2Q6F A;  2GZ8 A;  3SND A;  2ALV A;  2ZU5 A;  2Q6G A;  3M3T A;  1Z1J A;  3SNC A;  2GT8 A;  4TWY A;  2VJ1 A;  3AW0 A;  4YOJ A;  2AMD A;  3TLO A;  3EAJ A;  2V6N A;  2Z9G A;  2HOB A;  2Z9J A;  3VB3 A;  4ZUH A;  2OP9 A;  2Q6D A;  2Z3C A;  1LVO A;  3SN8 A;  3SNA A;  3TIU A;  2Z94 A;  3F9F A;  3F9G A;  2ZU4 A;  4YOG A;  3F9H A;  3M3V A;  5C3N A;  3TNS A;  5B6O A;  1Z1I A;  3V3M A;  4HI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...