2K7XA

Solution structure of c-terminal domain of sars-cov main protease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
120
structure length
120
Chain Sequence
DRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SARS-CoV main protease
publication title C-terminal domain of SARS-CoV main protease can form a 3D domain-swapped dimer.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 37
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2k7xA00
3D62A 2YNBA 2Z9LA 2YNAA 2Z9JA 3ATWA 2BX4A 2QCYA 3AVZA 2Q6FA 4RSPA 3F9EA 4F49A 3M3VA 1UK3A 3EA8A 4ZUHA 2Z3DA 2LIZA 4YOGA 5C5OA 3E91A 5EU8A 2AMPA 3SNAA 4WMFA 2AMQA 3EBNA 2A5AA 4YOJA 2BX3A 5C5NA 3EAJA 3EA9A 2ZU5A 2VJ1A 3FZDA 3SZNA 2HOBA 4ZROA 1P9SA 2Z9KA 4TWWA 3VB4A 1Z1JA 1UK4A 2A5IA 3VB5A 3F9HA 1Z1IA 4TWYA 2Z9GA 2QC2A 3F9FA 2AMDA 1LVOA 3M3SA 4XFQA 2K7XA 3SNBA 2ALVA 2C3SA 2GT8A 3M3TA 2Z94A 3V3MA 2D2DA 2ZU2A 4YOIA 4HI3A 1UJ1A 2DUCA 2GTBA 4MDSA 4WY3A 3VB6A 3TITA 3AW1A 2GX4A 3SNDA 2A5KA 3TNSA 3TLOA 2ZU4A 4YLUA 2Z3EA 2GZ8A 3SNCA 3TNTA 3VB3A 2H2ZA 5B6OA 1P9UA 2QIQA 2PWXA 3EA7A 2Z3CA 4WMDA 4WMEA 5GWZA 2V6NA 3IWMA 3SNEA 2GZ7A 4YO9A 2Q6GA 3AW0A 3F9GA 5C3NA 1Q2WA 5HYOA 1WOFA 1UK2A 3TIUA 3VB7A 3D23A 2Q6DA 2GZ9A 3SN8A 2OP9A 2GT7A
chains in the Genus database with same CATH superfamily
3D62A 2YNBA 2Z9LA 2YNAA 2Z9JA 3ATWA 2BX4A 2QCYA 3AVZA 2Q6FA 4RSPA 3F9EA 4F49A 3M3VA 1UK3A 3EA8A 4ZUHA 2Z3DA 2LIZA 4YOGA 5C5OA 3E91A 5EU8A 2AMPA 3SNAA 4WMFA 2AMQA 3EBNA 2A5AA 4YOJA 2BX3A 5C5NA 3EAJA 3EA9A 2ZU5A 2VJ1A 3FZDA 3SZNA 2HOBA 4ZROA 1P9SA 2Z9KA 4TWWA 3VB4A 1Z1JA 1UK4A 2A5IA 3VB5A 3F9HA 1Z1IA 4TWYA 2Z9GA 2QC2A 3F9FA 2AMDA 1LVOA 3M3SA 4XFQA 2K7XA 3SNBA 2ALVA 2C3SA 2GT8A 3M3TA 2Z94A 3V3MA 2D2DA 2ZU2A 4YOIA 4HI3A 1UJ1A 2DUCA 2GTBA 4MDSA 4WY3A 3VB6A 3TITA 3AW1A 2GX4A 3SNDA 2A5KA 3TNSA 3TLOA 2ZU4A 4YLUA 2Z3EA 2GZ8A 3SNCA 3TNTA 3VB3A 2H2ZA 5B6OA 1P9UA 2QIQA 2PWXA 3EA7A 2Z3CA 4WMDA 4WMEA 5GWZA 2V6NA 3IWMA 3SNEA 2GZ7A 4YO9A 2Q6GA 3AW0A 3F9GA 5C3NA 1Q2WA 5HYOA 1WOFA 1UK2A 3TIUA 3VB7A 3D23A 2Q6DA 2GZ9A 3SN8A 2OP9A 2GT7A
chains in the Genus database with same CATH topology
3D62A 2YNBA 2Z9LA 2YNAA 2Z9JA 3ATWA 2BX4A 2QCYA 3AVZA 2Q6FA 4RSPA 3F9EA 4F49A 3M3VA 1UK3A 3EA8A 4ZUHA 2Z3DA 2LIZA 4YOGA 5C5OA 3E91A 5EU8A 2AMPA 3SNAA 4WMFA 2AMQA 3EBNA 2A5AA 4YOJA 2BX3A 5C5NA 3EAJA 3EA9A 2ZU5A 2VJ1A 3FZDA 3SZNA 2HOBA 4ZROA 1P9SA 2Z9KA 4TWWA 3VB4A 1Z1JA 1UK4A 2A5IA 3VB5A 3F9HA 1Z1IA 4TWYA 2Z9GA 2QC2A 3F9FA 2AMDA 1LVOA 3M3SA 4XFQA 2K7XA 3SNBA 2ALVA 2C3SA 2GT8A 3M3TA 2Z94A 3V3MA 2D2DA 2ZU2A 4YOIA 4HI3A 1UJ1A 2DUCA 2GTBA 4MDSA 4WY3A 3VB6A 3TITA 3AW1A 2GX4A 3SNDA 2A5KA 3TNSA 3TLOA 2ZU4A 4YLUA 2Z3EA 2GZ8A 3SNCA 3TNTA 3VB3A 2H2ZA 5B6OA 1P9UA 2QIQA 2PWXA 3EA7A 2Z3CA 4WMDA 4WMEA 5GWZA 2V6NA 3IWMA 3SNEA 2GZ7A 4YO9A 2Q6GA 3AW0A 3F9GA 5C3NA 1Q2WA 5HYOA 1WOFA 1UK2A 3TIUA 3VB7A 3D23A 2Q6DA 2GZ9A 3SN8A 2OP9A 2GT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D62 A;  2YNB A;  2Z9L A;  2YNA A;  2Z9J A;  3ATW A;  2BX4 A;  2QCY A;  3AVZ A;  2Q6F A;  4RSP A;  3F9E A;  4F49 A;  3M3V A;  1UK3 A;  3EA8 A;  4ZUH A;  2Z3D A;  2LIZ A;  4YOG A;  5C5O A;  3E91 A;  5EU8 A;  2AMP A;  3SNA A;  4WMF A;  2AMQ A;  3EBN A;  2A5A A;  4YOJ A;  2BX3 A;  5C5N A;  3EAJ A;  3EA9 A;  2ZU5 A;  2VJ1 A;  3FZD A;  3SZN A;  2HOB A;  4ZRO A;  1P9S A;  2Z9K A;  4TWW A;  3VB4 A;  1Z1J A;  1UK4 A;  2A5I A;  3VB5 A;  3F9H A;  1Z1I A;  4TWY A;  2Z9G A;  2QC2 A;  3F9F A;  2AMD A;  1LVO A;  3M3S A;  4XFQ A;  2K7X A;  3SNB A;  2ALV A;  2C3S A;  2GT8 A;  3M3T A;  2Z94 A;  3V3M A;  2D2D A;  2ZU2 A;  4YOI A;  4HI3 A;  1UJ1 A;  2DUC A;  2GTB A;  4MDS A;  4WY3 A;  3VB6 A;  3TIT A;  3AW1 A;  2GX4 A;  3SND A;  2A5K A;  3TNS A;  3TLO A;  2ZU4 A;  4YLU A;  2Z3E A;  2GZ8 A;  3SNC A;  3TNT A;  3VB3 A;  2H2Z A;  5B6O A;  1P9U A;  2QIQ A;  2PWX A;  3EA7 A;  2Z3C A;  4WMD A;  4WME A;  5GWZ A;  2V6N A;  3IWM A;  3SNE A;  2GZ7 A;  4YO9 A;  2Q6G A;  3AW0 A;  3F9G A;  5C3N A;  1Q2W A;  5HYO A;  1WOF A;  1UK2 A;  3TIU A;  3VB7 A;  3D23 A;  2Q6D A;  2GZ9 A;  3SN8 A;  2OP9 A;  2GT7 A; 
#chains in the Genus database with same CATH topology
 3D62 A;  2YNB A;  2Z9L A;  2YNA A;  2Z9J A;  3ATW A;  2BX4 A;  2QCY A;  3AVZ A;  2Q6F A;  4RSP A;  3F9E A;  4F49 A;  3M3V A;  1UK3 A;  3EA8 A;  4ZUH A;  2Z3D A;  2LIZ A;  4YOG A;  5C5O A;  3E91 A;  5EU8 A;  2AMP A;  3SNA A;  4WMF A;  2AMQ A;  3EBN A;  2A5A A;  4YOJ A;  2BX3 A;  5C5N A;  3EAJ A;  3EA9 A;  2ZU5 A;  2VJ1 A;  3FZD A;  3SZN A;  2HOB A;  4ZRO A;  1P9S A;  2Z9K A;  4TWW A;  3VB4 A;  1Z1J A;  1UK4 A;  2A5I A;  3VB5 A;  3F9H A;  1Z1I A;  4TWY A;  2Z9G A;  2QC2 A;  3F9F A;  2AMD A;  1LVO A;  3M3S A;  4XFQ A;  2K7X A;  3SNB A;  2ALV A;  2C3S A;  2GT8 A;  3M3T A;  2Z94 A;  3V3M A;  2D2D A;  2ZU2 A;  4YOI A;  4HI3 A;  1UJ1 A;  2DUC A;  2GTB A;  4MDS A;  4WY3 A;  3VB6 A;  3TIT A;  3AW1 A;  2GX4 A;  3SND A;  2A5K A;  3TNS A;  3TLO A;  2ZU4 A;  4YLU A;  2Z3E A;  2GZ8 A;  3SNC A;  3TNT A;  3VB3 A;  2H2Z A;  5B6O A;  1P9U A;  2QIQ A;  2PWX A;  3EA7 A;  2Z3C A;  4WMD A;  4WME A;  5GWZ A;  2V6N A;  3IWM A;  3SNE A;  2GZ7 A;  4YO9 A;  2Q6G A;  3AW0 A;  3F9G A;  5C3N A;  1Q2W A;  5HYO A;  1WOF A;  1UK2 A;  3TIU A;  3VB7 A;  3D23 A;  2Q6D A;  2GZ9 A;  3SN8 A;  2OP9 A;  2GT7 A; 
#chains in the Genus database with same CATH homology
 3D62 A;  2YNB A;  2Z9L A;  2YNA A;  2Z9J A;  3ATW A;  2BX4 A;  2QCY A;  3AVZ A;  2Q6F A;  4RSP A;  3F9E A;  4F49 A;  3M3V A;  1UK3 A;  3EA8 A;  4ZUH A;  2Z3D A;  2LIZ A;  4YOG A;  5C5O A;  3E91 A;  5EU8 A;  2AMP A;  3SNA A;  4WMF A;  2AMQ A;  3EBN A;  2A5A A;  4YOJ A;  2BX3 A;  5C5N A;  3EAJ A;  3EA9 A;  2ZU5 A;  2VJ1 A;  3FZD A;  3SZN A;  2HOB A;  4ZRO A;  1P9S A;  2Z9K A;  4TWW A;  3VB4 A;  1Z1J A;  1UK4 A;  2A5I A;  3VB5 A;  3F9H A;  1Z1I A;  4TWY A;  2Z9G A;  2QC2 A;  3F9F A;  2AMD A;  1LVO A;  3M3S A;  4XFQ A;  2K7X A;  3SNB A;  2ALV A;  2C3S A;  2GT8 A;  3M3T A;  2Z94 A;  3V3M A;  2D2D A;  2ZU2 A;  4YOI A;  4HI3 A;  1UJ1 A;  2DUC A;  2GTB A;  4MDS A;  4WY3 A;  3VB6 A;  3TIT A;  3AW1 A;  2GX4 A;  3SND A;  2A5K A;  3TNS A;  3TLO A;  2ZU4 A;  4YLU A;  2Z3E A;  2GZ8 A;  3SNC A;  3TNT A;  3VB3 A;  2H2Z A;  5B6O A;  1P9U A;  2QIQ A;  2PWX A;  3EA7 A;  2Z3C A;  4WMD A;  4WME A;  5GWZ A;  2V6N A;  3IWM A;  3SNE A;  2GZ7 A;  4YO9 A;  2Q6G A;  3AW0 A;  3F9G A;  5C3N A;  1Q2W A;  5HYO A;  1WOF A;  1UK2 A;  3TIU A;  3VB7 A;  3D23 A;  2Q6D A;  2GZ9 A;  3SN8 A;  2OP9 A;  2GT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...