2K86A

Solution structure of foxo3a forkhead domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
103
Chain Sequence
GSSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biochemical and structural characterization of an intramolecular interaction in FOXO3a and its binding with p53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Forkhead box protein O3
total genus 23
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k86A00
4IRHA 1ZGAA 1IN5A 3IKTA 3CLOA 2OD5A 3GW2A 2K4JA 4IRIA 2JPCA 4RB3C 3DKWA 1OMIA 3PQJA 1IF1A 2BBYA 5F64A 2JZYA 3DV8A 3ULQB 3BZ6A 4RGRA 1W5SA 3U1DA 1FBQA 3B02A 2QVOA 3LFKA 2FRHA 3GEZA 3V8LA 4EMSA 2H09A 2P6SA 1HKTA 5FO5A 3MZHA 4HX8A 5HLGA 1OPCA 4U7DA 1LDDA 2G7UA 1YW8A 4OU0A 3DQVC 2JT1A 2YU3A 3I0TA 3KP6A 1J5YA 5E8IA 3FMSA 3ZQ7A 2NRAC 2E7XA 2HKOA 2EA2A 3QOPA 1XMAA 1WWXA 4WK8F 4Q47A 1I6XA 3O6BB 3J81Z 2GZWA 2QM3A 3O2PE 1LEBA 1YG2A 3L09A 2ISYA 2FBKA 2VE9A 5ICFA 1RI7A 4ASNA 4XBFA 1Q1HA 5FD5A 1K7AA 1YYVA 1OKRA 2K27A 1TTYA 5H6RA 2P5LC 4A0YA 4FT8A 5BPDA 3I53A 2IA0A 3MFKA 2XAHA 1SFXA 2DK8A 1FNNA 1O3TA 2OZ6A 3T8TA 1XSDA 5DCMA 2ZNYA 3CUQC 3I59A 3I59B 3K2ZA 1J2XA 3KLNA 4XSXF 4O3MA 1R36A 1JHFA 1FPQA 5DD4A 4LK1F 4MQVA 2L54A 2AXLA 4M6YA 1P6RA 3TOAA 5D5UB 2QUFA 4IPAA 4FHTA 4HDUA 3BDDA 2P6TA 3GZ6A 4EJWA 1UB9A 3QP5A 5DCMB 1XGSA 1Z1DA 2CWEA 4HQMA 5A2QK 2P8TA 1Z7UA 2HFHA 2UWMA 3M7GA 4EV0A 1AOYA 1WQ2A 4RAYA 4UV9A 3LQQA 1SMYF 5CLSA 3LA7A 2BEOA 3E6BA 1RUNA 4RGSA 4M9SA 3FF5A 1BOAA 5L3CA 3MWMA 3FMQA 5HDNA 4R1HA 5JR3A 4E70A 3FM3A 2KJBA 2ZNZA 4KYWA 2Z5UA 1Y0UA 2R7FA 2EA4A 2MBFA 5HS8A 3FWEA 2NAZA 2ZO4A 1XSXA 4ZYEA 1LJ9A 1FC3A 4KN7X 2F5DA 3GZ5A 5FLXK 3J80K 5LGUA 1KYWA 4U7BA 2DAOA 1XDUA 2XKOA 3ABTA 4UXNA 1QGPA 2JTVA 2H94A 2RV8A 4O5VA 2KIMA 3SZPA 1T38A 3ZMUA 1BI1A 4OINF 5K1YA 5IT9K 4BH9A 1BI3A 2ZCWA 4HV5A 4KNYA 1F1ZA 5D8KB 3IKVA 3U9GA 1KU3A 3D0SA 1USSA 4P9FA 2OAZA 1TNSA 1ZRFA 4A6DA 4GYGA 2AS5F 2GAUA 2A5YB 2RKHA 3E6CC 3HOSA 4CGZA 1PP7U 2QBYB 3TOBA 4GYIA 3DXJF 3TDZC 2FXAA 1D3YA 4HOBA 1RNLA 4CZZA 1U3EM 2DPUA 3GUDA 3H3ZA 4LB5A 5F6FA 1S7OA 2GA2A 2F2EA 4IF4A 1BI2A 2A68F 4ESJA 2W25A 1ZGJA 4IJAA 4M74A 4XSZF 3F8MA 4AD9A 1ZG5A 3C1DA 2YSRA 4ZYHA 3MEXA 2Z99A 4EGYA 3HRTA 2Y75A 5HDGA 1B9MA 4HX4A 1KQ0A 1SD4A 5TJJA 5E18F 2EFOA 2HR3A 5L3EA 1NHAA 1L3LA 1P4WA 1I27A 3QPHA 5ILSA 5KVRA 2XKPA 3PQKA 3K9TA 5DDGA 3BWGA 2DQLA 4B09A 3JTGA 4KMFA 3QAHA 5E1XA 4EM2A 5ERIA 1B1BA 2IVMA 1YIOA 3BP8A 3HUGA 3RPQA 2CG4A 3KCCA 2W84A 1J9IA 2P5VA 4L9TA 2A69F 4L5IA 3C18A 5J6XA 4L9NA 3QPTA 3RKXA 4CICA 3MCZA 3DPLC 2M1BA 3MZYA 3GYHX 4BHPA 1FP1D 2STWA 3KP4A 2IPQX 4RB2C 3WGHA 4ENKA 4HLXA 4P9UA 2D2WA 4P5OA 1HSJA 2MLKA 4M6XA 4Y17A 1D5VA 3HHHA 4KDPA 2CYYA 1Z6TA 4WCGA 2KJCA 4ENJA 4A12A 1J0RA 4UVAA 2VN2A 2GQQA 3LAJA 1F5TA 1YQAA 3U2RA 1EH7A 4G6QA 4G7OF 2PLYA 4N9HA 2XASA 4UHTA 3WTSC 4BQAA 2STTA 1ZYRF 3WTTC 3FXUA 3NRVA 2K7LA 1FOKA 1XGMA 3K69A 4ZH4F 3DFGA 3SQNA 2W24A 4L9VA 5LLQA 3WTZA 1HBXG 3NEUA 2R3SA 4UUVA 1EH6A 4YIIA 2Y0MA 3KZZA 5L3GA 3HOTA 3QRFF 5K5RA 3AAFA 2C6YA 4AVPA 3R0JA 4I02A 2KIUA 2OBPA 3V7RA 2XAGA 3WE2A 2L4AA 3HTSB 2HEOA 3V7SA 3F6OA 2E1CA 2XAFA 2HKXA 3K0LA 1ZHFA 2LDUA 2K02A 2HDCA 2EK5A 1B9NA 1IN6A 2RQPA 3FHZA 1BC8C 4YFXF 4NQWA 1O3QA 1MKMA 5FFXA 4HF2A 2MH9A 5ILVA 4HW0A 3WTVC 4HLYA 3LAPA 2HWVA 1HXDA 2KKOA 3RTRA 1ZG1A 1GXQA 1W5TA 3KLOA 1LNWA 3VFZA 2NNNA 3M9AA 4M71A 1S6LA 4KMUX 1K78A 4FX4A 1YLFA 1FSEA 1TW3A 3V7CA 3KP2A 2VC1A 2VXZA 1OYYA 1BIAA 4CDGA 2ZJ2A 1O57A 2F5EA 3KE2A 3GWZA 5DUKA 4OMZA 2JSCA 1ON1A 4OOIA 1OR7A 2X4HA 5HOOA 2HYFA 5ICGA 2MH2A 1T39A 6PAXA 3GX4X 1DUXC 1YS6A 2O3FA 2BE5F 2VT3A 1WKMA 3ECHA 2QQBA 3VODA 1YW7A 4LG0A 1Z6RA 4MNUA 1IUYA 2P7CB 3P9CA 4HF0A 3IL2A 3WTUC 4CHUA 5BS6A 2ZBKA 4QLCU 2LKPA 1FX7A 3HRMA 4S04A 4LLNA 4IVNA 1IRGA 3HHGA 4OIOF 1K78B 3C3WA 4WXDA 1HW5A 3OOPA 3WTYC 4M73A 3CUQB 4MQ9F 3T8RA 3DF8A 1TLHB 3IWZA 4KFCA 2V1DA 5LBQA 4GXOA 3JAMZ 2MA3A 2XRNA 1XGOA 3OV8A 4GCVA 1ZG3A 4P96A 3SFZA 2A6HF 4KUMA 2PG4A 2H27A 2Y48A 4KN4X 3DPTA 2RC4A 4UVBA 4HQEA 2MC3A 1R1UA 4A0XA 4U0VA 5CYVA 5JHUA 3TGNA 5JI6A 3E5QA 2FMYA 1Z9CA 3V4GA 2FBIA 3FMRA 4RGUA 3V8JA 3RKYA 1EH8A 2ZMEB 4M9ZA 5IT9Z 2L4MA 4K2EA 3BJ6A 2ISZA 3CJNA 3DP7A 1GVJA 5KK1A 3RJPA 3I64A 3HSRA 2M8EA 2A07F 2QYOA 2UXXA 5LEJA 1FBSA 2WV0A 2EV6A 4XLPF 1CF7A 2DTRA 3W6JB 1FT9A 2X0LA 1O3RA 2PMHA 2QENA 5BQTA 3N97A 4MEYF 2IA2A 2CFXA 1I1SA 2FE3A 2DBBA 2RNJA 2CW0F 4WX9A 4ESBA 2IJLA 5TRDA 2VOOA 3SXYA 2L3DA 3T0YA 3LA3A 1ON2A 1WI9A 2BV6A 1XGNA 2Q0OA 2J5PA 3ZP5A 1FZPB 1SD5A 5HDKA 3T1BA 1SD7A 3K1PA 1F9NA 4EM1A 5D6FA 1U5TC 5D5WB 1IZ1A 3GO5A 3K1MA 3HSFA 4RS8A 3L00A 4ENMA 4I09A 2E7WA 2UXNA 1BBYA 2L02A 1BN5A 2L01A 5BOXA 4LD5A 4OMYA 2PN6A 1W7PD 3BOQA 5HLHA 3L9FA 1XN7A 1D8JA 1DP7P 3KFWX 2V9VA 3R6SA 3G73A 3RIRA 3P9KA 1IRFA 3L7WA 1G6NA 3S2WA 5ED4A 2O8XA 1STZA 3KEOA 3Q9SA 3NQOA 5J8CA 1BIBA 4HBLA 4ZYGA 1KA8A 4EJOA 2YX7A 2HYGD 4A0ZA 2ESNA 1XB4A 2CSOA 3J7AO 4G6DA 4WWCA 2HTJA 4WF2A 4LGWA 3SHFA 3ML6A 1Z05A 4L9JA 4MEXF 5EEHA 3HRSA 4ZYDA 2NNYA 4RAZA 1T0FA 1HQCA 3EUHA 1TBXA 5DEQA 4MGRA 1FYKA 4CYDA 2NYXA 1H0MA 2A6EF 2YX4A 2TDXA 3EETA 4AWXB 2BYVE 1IN4A 3QP6A 1LB2A 2RVCA 1QZYA 3QU3A 1FYLA 1IN8A 2W57A 3KEQA 2WWYA 4U0WA 1X3UA 3KETA 1C0WA 4HF1A 4BHBA 1TQIA 1KQ8A 1LQ1A 2RGVA 2A3SA 1P4AA 5AIPA 5J8FA 1GXPA 2VBXA 4F7ZA 3KP3A 4PGGA 2O03A 5DD8A 1TQPA 3WTXC 1YO5C 4I7HA 1B4AA 1QPMA 3C7JA 1W7PA 4AIHA 1G3TA 5EEGA 3RYPA 1S7AA 3E3VA 4H0EA 5BPIA 2EV0A 2FNPA 5IT3A 1ZAOA 2O0YA 2V1XA 2XAJA 2H6CA 1P4XA 4G8XA 5FGMA 3N4MA 3COAC 4I0AA 1IXCA 3E6MA 3J81K 5JFRA 2VOPA 1DDNA 4KIFA 4UVCA 3M8EA 4KIGA 1IN7A 3REOA 2KRFA 2ZKZA 2XAQA 4L5JA 1KQ9A 3TQNA 3ROUA 2E1NA 3F72A 1SFUA 3TKYA 2QQAA 3TDUC 3WG9A 3GXOA 4GGGA 3RDIA 3VEPA 3IWFA 3RI4A 2RN7A 1W7PB 1XCBA 1R7JA 5LEKA 3I5UA 1U8RA 3JTHA 3WE3A 2PI0A 2WTEA 3GFMA 4G9YA 1USTA 3QU6A 1P2FA 1W4MA 2HTSA 4R79A 2XIGA 2K4BA 4Q4ZF 4PCQA 2ESHA 5E8GA 4Y15A 5D4SA 4MTEA 2CO5A 1K6OA 3F23A 4EJTA 2VBWA 1J59A 4XRFA 3GLXA 4Q48A 5HLIA 1BC7C 2QWWA 5A2QZ 4EJVA 4JK1X 1JE8A 1UHWA 1QQIA 4GO1A 3J80Z 3HTUA 1UFMA 2FBHA 1DPRA 2COMA 4BAYA 1FY7A 3WTWC 2M5WA 4KIBA 4L0YB 5AONA 1F4KA 1OYIA 1D8KA 3ABUA 4PDKA 1UHMA 1BI0A 4R8HA 1MJAA 2OA4A 2XROA 1HKSA 1RUOA 1YTYA 2UZKA 3WGIA 5LHIA 3Q5FA 3JAMK 3BY6A 1O7LA 3R4KA 4G94A 1B59A 2XV4S 1KGSA 2IA1A 1R1VA 5CVJA 1PUEE 3F21A 4AIJA 3E6DA 3WODF 3G3ZA 3HSEA 2DLLA 3P9IA 2HQNA 1JHHA 2R7DA 3GF2A 3BJAA 1TW2A 1EV7A 2GWRA 4LJZF 3H92A 5D5VB 3F8FA 4ZZDA 2ZFWA 3I54A 1BM9A 4BXUA 5FD6A 3ZN0A 2MD5A 3ZMTA 4BHCA 1TNTA 3KP7A 4ON0A 1ODDA 5FFZA 5CVIA 2VE8A 5DYMA 3F8NA 1ZLJA 1FP2A 4Y13A 3BPXA 3WU0A 2MLGA 4OIQF 2OU2A 4Z2YA 1LDJA 1YFHA 2JPBA 5K5OA 5CJ9A 1O7FA 1ZLKA 1MJBA 4FX0A 2OQGA 1T6SA 4CXFA 2LSOA 2M30A 2PFBA 3FM5A 1J7KA 3E5UA 3K1NA 4I98B 2F5CA 1UCRA 2DW4A 2FNAA 1FYMA 4Q5SF 1SD6A 1MD0A 3R61A 5D6EA 2QZ8A 3E97A 4A2UA 4B8XA 1T2KA 1G3WA 3CUOA 4HA8A 5LHHA 1FBUA 2DPDA 1S3JA 2EB7A 2IW5A 5ICEA 2XHKA 2GA1A 2HOEA 1CGPA 2OQRA 3JW4A 2EFNA 2EJRA 5DCFA 2CGPA 5CVUA 1LVAA 1HSTA 2NS0A 1YW9A 4OIRF 4P55A 4JQFA 5HS7A 1MZBA 1S8NA 4M9XA 1V4RA 4MTDA 3D5LA 3JSPA 3BPVA 3F22A 1S29A 4WXHA 2ZMEA 4O6JA 4U88A 1R23A 4D0PA 4YFNF 2G7HA 1G4DA 4LB6B 5H6QA 2WC2A 3MQ0A 1QZZA 2YR2A 2ZXJA 2VBZA 1HKQA 1JGSA 3GFJA 2VODA 5HVQC 1QBJA 5ILUA 1P92A 4XLNF 4RB1A 2BGCA 1U2WA 1BJAA 1J75A 3ZN1A 4YIFA 3CUQA 3GVAA 5LRRA 1MGTA 2EFPA 3BROA 1AWCA 1REPC 2HS5A 3FX3A 5AIQA 2EFQA 2ETHA 2LF8A 2D1HA 2XVCA 4AIKA 5DV5A 1YS7A 4I0BA 1SMTA 3IHUA 3HIFA 1ONVA 3O3KA 3RYRA 5D5XB 2OZUA 1R5GA 2D1VA 1XSVA 4ENNA 4ZZLA 2W85A 2DO7A 3M1EA 3R60A 4HV6A 2VT2A 2YPRA 3HRUA 5CVRA 1H9GA 3ZMSA 3EYIA 2K86A 1RZ4A 4ESFA 2P7VB 4HYEA 3GFLA 1MJ9A 4IHTA 2Q8KA 3LQRA 4N0BA 3BJOA 3H3UA 1VTNC 4A5NA 2V1UA 1PDNC 2IP2A 1ZH5A 1A04A 4S05A 4HX7A 3IRRA 4A5MA 4L18B 3V8KA 4I2OA 4G7ZF 4EJUA 2GXBA 1IAWA 3TO9A 1RIOH 3MAJA 1V3FA 1I5ZA 4EGZA 3ZMZA 5D4RA 2F5FA 4YFKF 3PFIA 2DK5A 5DUIA 5BMZA 3EQLF 1XDSA 3ELKA 1E2XA 4DNCA 4EVIA 1IXRC 4L0ZB 4HDVA 1ZN2A 1JXSA 1MDMB 2J5OA 5D8LB 2FA5A 1K79A 2VC0A 4N9IA 3ECOA 3W6KB 2ADUA 1GHCA 5L3FA 3R0AA 2DI3A 3KZYA 1PP8F 4LK0F 2P4WA 5K5QA 1ULYA 3P7NA 4NB5A 2PEXA 1WRJA 1IW7F 1R1TA 2XUBA 4IHSA 1XCVA 2FEZA 3IC7A 5ICCA 3TO6A 1CF7B 2FSWA 4IRGA 2O61A 2V79A 1U5TA 5HS9A 3F3XA 4OIPF 5JVTA 2D45A 1R00A 4PGHA 1QO0D 4LG0B 2QQ9A 2PQ8A 1I1GA 5FLXZ 2IT0A 1E17A 3Q9VA 1OYWA 2G9WA 1TQMA 3VOEA 3I4PA 2Q2EA 2V6CA 2A61A 3ZMDA 3GFIA 3RKWA 4ETSA 5LRSA 1ZRCA 3ZPLA 3LWFA 2Z9OA 3CDHA 2H6BA 1IXSB 4DQ2A 5CVVA 2M45A 5E20A 2PMUA 5H20A 1MDMA 1HW1A 3JSOA 3F6VA 1XMKA 1R22A 2QLZA 2VONA 3E5XA 3ZMVA 4I01A 3T5XA 1ZRDA 5F1RA 1L0OC 5LGNA 2DT5A 3DEUA 2FOKA 3F8BA 1B6AA 3B73A 4NHJA 3IRQA 2FF4A 2DU9A 4UV8A 2HQRA 3SZTA 1ZARA 4M72A 2FU4A 1U78A 4WXCA 1T98A 4U0YA 2B0LA 2KIFA 2M87A 3L2CA 2GIVA 2QBYA 2Z33A 1FSHA 4KA4A 3ERED 4YG2F 3CTAA 1DPUA 4EQQA 5E17F 2GXGA 1HW2A 4BYYA 5L3BA 2PBIA 4MHGA 3WGGA 1FLIA 2VBYA 4QWQA 3FXQA 1FWZA 4LMYA 1KU2A 5E1ZB 5FB2A 5LHGA 3I58A 1R5HA 1KU7A 4HAMA 3ISPA 2RDPA 4IXAA 4RGXA 4A6EA 1SFEA 5E1WA 4CO8A 3EYYA 3EDPA 4LFUA 2DFIA 4PZJA 3HYIA 1XD7A 3FZVA 3TO7A 2ACJA 1H9TA 3LA2A 5LGTA 2FMLA 4UNOA 3VB2A 2JRTA 1LEAA 2PJPA 1U6GA 3FXRA 2HGCA 1O3SA 3KP5A 2Z3YA 3LSTA 2FQ3A 1R58A 3CO7C 3RPUA 1G3SA 3F8CA 3I71A 1KYZA 2XGXA 3M8FA 4KICA 2EV5A 2LNBA 3WU1B 2LF7A 5L3DA 2IRFG 4TV7A 2EWNA 2P5KA 2O6GE 4LLLA 4KT5C 1G3YA 4JBAA 2CQKA 1U5TB 1Z91A 1SAXA 4HZFA 4EM0B 1QNTA 3CO6C 1LDKB 4LLGF 4BNCA 2DQRA 2HZTA 2EFWA 2ELHA 1WSUA 1KU9A 4G7HF 1ZREA 4RB0A
chains in the Genus database with same CATH superfamily
4IRHA 3UR3C 1ZGAA 3IH4A 1IN5A 1F36A 3IKTA 3CLOA 2OD5A 2DMTA 2HYJA 3GW2A 2K4JA 4IRIA 2JPCA 4RB3C 1SFKA 2DDBA 4B3AA 4XRSA 1GT0C 2MC4A 3BR1A 3OR1C 4Y7NJ 2LY2A 3FKIJ 3DKWA 1GV5A 1J09A 1OMIA 3PQJA 1IF1A 2BBYA 5F64A 3RQ4A 2JZYA 3DV8A 3ULQB 3BZ6A 4A3CJ 1YE9A 4RGRA 1X58A 1W5SA 3U1DA 3CCSI 1FBQA 5FKNA 3L1PA 2M0CA 3QPSA 2Z16A 3B02A 3PUBA 2HQ5A 1Y0NA 1QU3A 2QVOA 3IUOA 3LFKA 1JI8A 3AFHA 4BXFA 2FRHA 2JUGA 2Y2ZA 3GEZA 5KCMA 1WJ5A 2CUJA 3V8LA 4XOPA 5EZHA 5HODA 4ZJZA 4BDYA 2WAQN 3EUAA 4EMSA 3K6GA 3L2QA 2H09A 3M8JA 2P6SA 4YRVA 4LIVA 2F4OB 1HKTA 3LL7A 5FO5A 4BL0B 3MZHA 4HX8A 5HLGA 2KQRA 1MSFC 1OPCA 4U7DA 2R7TA 1LDDA 2G7UA 1YW8A 4OU0A 3K10A 1D0YA 2ZMEC 3DQVC 1OLTA 2JT1A 2YU3A 3I0TA 4RLQA 1T56A 3KP6A 2M7AA 1J5YA 5E8IA 3FMSA 2DOEA 3ZQ7A 4OAZA 2NRAC 3BC8A 4JX6A 2E7XA 2HKOA 2EA2A 3QOPA 3G71I 3TBIA 1XMAA 1WWXA 4WK8F 4B4CA 5GAGJ 3TW6A 4AU7A 4Q47A 1I6XA 4HNTA 3O6BB 3S16J 3J81Z 2GZWA 3G2BA 1SVMA 3PNVA 2QM3A 3O2PE 4XMYA 1LEBA 3M3YJ 2OC6A 1YG2A 3L09A 2LG4A 3FBIB 2ISYA 2XPWA 1JKRC 4BQNA 1JUMA 1R4MB 4I99C 3OYKA 2FBKA 3KYDB 3CJRB 5ICFA 2VE9A 4IO9F 1RI7A 2OF7A 4ASNA 2G0EA 3HJEA 4XBFA 1Q1HA 4GRIA 2EIMH 5FD5A 1R71A 1K7AA 1YYVA 1OKRA 2K27A 1TTYA 4IL6C 4ZDLA 5H6RA 2P5LC 2XSJC 4BQQA 4A0YA 4FT8A 5BPDA 3CDLA 3ABLH 3I53A 2IA0A 3MN2A 3MFKA 3O8HA 2XAHA 1SFXA 1Z77A 2DK8A 2K3PA 1FNNA 1O3TA 2OUMA 2GIZA 2OZ6A 1VQ8I 3T8TA 1XSDA 2ME0A 5DCMA 4XLCA 2ZNYA 4ITVA 3CUQC 3I59A 4EEFG 5C3EJ 3TMOA 3K4BA 3I59B 1LUJB 4IHWA 3TW7A 3K2ZA 2PJRB 1J2XA 3S3OA 2CFOA 3KLNA 4ANJA 4XLFA 4XSXF 4QSHA 1R36A 4O3MA 1JHFA 1FPQA 2W7NA 1X1CA 2X6YA 2R0QC 5DD4A 1MBKA 4LK1F 1TT5B 4AC0A 1FJLA 4MQVA 2L54A 4Y3OA 2A6TA 2AXLA 4M6YA 1P6RA 1OCPA 3TOAA 5D5UB 2QUFA 4IPAA 2HXIA 4FHTA 5HLTA 2DA7A 4HDUA 3BDDA 2P6TA 3GZ6A 4EJWA 1UB9A 1ZELA 3QP5A 2XB0X 5DCMB 4A3JJ 5TISC 5GAEJ 1XGSA 2YUSA 3OYHA 1Z1DA 2CWEA 3S8PA 4H4KC 3HGYA 4HQMA 5A2QK 2P8TA 1NG7A 1Z7UA 1A6IA 2HFHA 3KX2A 2B9SA 3ONQA 3BLYA 2UWMA 3M7GA 5F0FA 2O9LA 2LP0A 4DJAA 1U8BA 1B8IB 4QPOA 5DS9A 4EV0A 2R7ZJ 3HEFA 1WQ2A 1AOYA 4RAYA 2ZJRF 2Z2SB 4UV9A 3LQQA 1SMYF 1WH5A 3QODA 2EZIA 1QVTA 3LA7A 5CLSA 2BEOA 3CJQB 1RR8C 4PSXA 3E6BA 1RUNA 4RGSA 2V4JC 1QPIA 4M9SA 1O4XA 1A31A 3FF5A 1PVEA 3ASNH 1BOAA 5L3CA 3MWMA 2L5QA 3FMQA 3OL3A 5HDNA 2E5NA 4BE2A 4R1HA 5JR3A 4AM3A 4E70A 3SJMA 3FM3A 2KJBA 2ZNZA 1TP4A 4KYWA 2Z5UA 1Y0UA 3H1CA 2IBDA 2R7FA 1I6HJ 2EA4A 2MBFA 5HS8A 3I55I 3ZQIA 3FWEA 2Y69H 2NAZA 2XF6A 2ZO4A 4M3BA 1I50J 1XSXA 4ZYEA 1KZHA 1LJ9A 1FC3A 4KN7X 2F5DA 3GZ5A 3ZGKA 1LKXA 5FLXK 3J80K 2DMPA 5LGUA 5EZGA 1KYWA 2Y9ZA 4U7BA 1IJWC 1XDUA 2DAOA 2RAEA 2XKOA 3OSGA 3ABTA 4UXNA 1QGPA 5M3FJ 2JTVA 2W48A 1JT6A 2H94A 2LYCA 2RV8A 1V5EA 3I4MJ 4O5VA 3ZQGA 2KIMA 2VLAA 3RQIA 3SZPA 4F92B 1T38A 3S1QJ 4DIQA 1W36C 3ZMUA 1Z7LA 2LFBA 1BI1A 4OINF 3ZRGA 5K1YA 1JTYA 2QEXI 5IT9K 1G59A 2Y9YA 4BH9A 4BS9A 3DBHB 1BI3A 5M5YJ 2ZCWA 3PFYA 3S1NJ 4HV5A 4KNYA 2LMDA 1F1ZA 3TL4X 2YS9A 5D8KB 2X6WA 3OS2A 3IKVA 1K6YA 3U9GA 1KU3A 2XRLA 3D0SA 3OYNA 1USSA 4P9FA 2OAZA 1TNSA 2YU9J 4X1EA 1ZRFA 4B48A 4A6DA 2CU7A 3H35A 4GYGA 2AS5F 2GAUA 4RA2A 4HPQA 1AKHB 2A5YB 2RKHA 5IP6A 3E6CC 4I6ZA 3HOSA 1X3WB 3CMAI 3G1LA 4CGZA 5IY5H 2MFZA 1IO2A 1PP7U 2IGNA 2R7RA 1HA8A 2LREA 3JRDA 2QBYB 3TOBA 1ENHA 2K9MA 3H3VK 1A5JA 1DQUA 4GYIA 3DXJF 1DGRM 4PFPA 3TDZC 3AL0C 5IP7J 2FXAA 4IHYA 1D3YA 4HOBA 1F43A 1RNLA 4CZZA 3MD2A 1U3EM 2DPUA 3GUDA 3H3ZA 4LB5A 5F6FA 1S7OA 3HOZJ 2EINH 2GA2A 2F2EA 4IF4A 1BI2A 2CS3A 3OS0A 2EILH 2A68F 2OCCH 4ESJA 2W25A 4XK4A 1WJCA 1JUPA 1ZGJA 4NNJA 4IJAA 4M74A 4XSZF 3F8MA 1E3OC 2XC7A 4AD9A 1ZG5A 5C4XJ 2XDVA 3K4LA 1ACIA 3C1DA 3Q3SA 3K4MA 3LSIA 2YSRA 4ZYHA 3MKLA 1WPKA 3CLQA 2WBMA 1B72A 1ETOA 2Q1ZB 2MABA 3MEXA 2VPLA 5B1AH 2Z99A 4EGYA 3HRTA 2Y75A 5HDGA 2KFDA 1B9MA 4HX4A 1KQ0A 3QYFA 3S2HJ 3GLLA 1SD4A 3JREA 2I8DA 3BTJA 5TJJA 3RZOJ 5E18F 2EFOA 1MH3A 2HR3A 1XS9A 2PJRA 5L3EA 1NHAA 3SYTA 3W2VA 5FROA 2CW8A 1R9TJ 2V9KA 2LRDA 1L3LA 1P4WA 1I27A 3QPHA 2XB5A 5ILSA 5KVRA 2XKPA 1DU6A 3PQKA 3K9TA 5DDGA 3WHCA 2HDDA 3BWGA 2F6CA 2GOXB 2MYSA 2DQLA 4B09A 3JTGA 1OCZH 1Y8RB 4KMFA 3QAHA 3H0DA 1UJ8A 5E1XA 3QYBA 1UHSA 2E2JJ 3HL2A 3CCUI 4EM2A 3BR0A 3CC7I 5ERIA 1W36D 2IXSA 1WFXA 3RZDJ 1B1BA 2DCEA 2IVMA 1YIOA 3BP8A 5CQEA 4C2TA 3HUGA 4BKXA 3HDDA 1W1WE 2R7WA 2CUEA 3RPQA 5B3SH 2LD5A 3VYRB 2CG4A 3Q0WA 1HCRA 1DU0A 3KCCA 2IS6A 2W84A 3QQAA 1J9IA 2P5VA 4L9TA 2A69F 4N4OB 4J01A 4L5IA 3C18A 5J6XA 2E2HJ 1RKTA 4L9NA 3QPTA 3RKXA 4CICA 3MCZA 2E35A 5J4VA 2ID6A 3DPLC 2M1BA 3MZYA 3ZQLA 3GYHX 3HPGA 2VQCA 4BHPA 1FP1D 1MBJA 1ZKGA 2STWA 3KP4A 1S5LC 2IPQX 2XF5A 3EUHC 4CCKA 3HM5A 4RB2C 2E71A 3LSRA 3WGHA 1JKOC 4ENKA 1ZR4A 1QVUA 3DTIA 4HLXA 4P9UA 4F52A 2D2WA 4DGWB 4P5OA 2AO9A 1HSJA 3JRFA 3B6CA 2MLKA 4G6TB 4M6XA 4Y17A 1D5VA 3W2AA 3HHHA 4KDPA 3S15J 2CYYA 1Z6TA 4WCGA 2CQXA 1EKEA 2KJCA 3S2DJ 4ENJA 2DODA 4A12A 3FISA 1J0RA 1VQ4I 4UVAA 2NOGA 2VN2A 2GQQA 3LAJA 4M6VA 1TWHJ 1RR7A 1F5TA 2UUZA 3SZGA 1YQAA 4CCLA 3U2RA 4RM3A 1EH7A 2EQRA 4G6QA 2K9QA 4G7OF 3CQZJ 5EJCA 2PLYA 4N9HA 4RBOA 2XASA 4UHTA 3AG4H 3WTSC 4BQAA 1TWGJ 2STTA 1ZYRF 5IOYA 3DTEA 4IQ4A 4DYRA 4Y52J 3WTTC 1TWCJ 4FE4A 3OMYA 3FXUA 3NRVA 2K7LA 1FOKA 1XGMA 3K69A 4ZH4F 3DFGA 3SQNA 2W24A 4L9VA 2KDZA 4MO7A 5LLQA 3WTZA 1HBXG 4NC8A 1TT0A 2R3SA 3NEUA 1N75A 3WU2C 4UUVA 1EH6A 4YIIA 2Y0MA 3KZZA 4RM2A 5L3GA 3HOTA 2DMQA 3QRFF 3PSIA 5K5RA 1W5CC 2L7ZA 5CPRB 4DYCA 4KITB 4G12A 3BZCA 3AAFA 2C6YA 4AVPA 3R0JA 1R4NB 2VKEA 3AKZA 3DKYA 1TL8A 1LFUP 4I02A 2L9VA 2KIUA 2OBPA 1QHHD 3FIWA 3V7RA 3MKYB 2XAGA 3WE2A 3CCEI 4PJLA 1BJZA 2L4AA 3HTSB 4XKWA 2ICWG 5DTDA 2HEOA 3GMEA 3V7SA 2LR8A 4RAFA 3F6OA 1IC8A 1PYVA 1ERDA 3GTKJ 1U9OA 2IEKA 5F04A 2E1CA 2XAFA 2HKXA 4J00A 3K0LA 1Z3XA 2ELJA 1WHUA 1ZHFA 2LDUA 4BACA 3H5AA 2K02A 4A3KJ 2R5YA 2EK5A 2HDCA 1B9NA 1IN6A 4XKBA 1VQMI 1N78A 2RQPA 3FHZA 1BC8C 1FIPA 3HBLA 4YFXF 4NQWA 1CQTA 1O3QA 1MKMA 4CCOA 2CV2A 5FFXA 4HF2A 1ETXA 2DOAA 2MH9A 3H36A 5ILVA 4HW0A 1Y6IA 4PK4A 2VPRA 2KZVA 2IGOA 3WTVC 3OYLA 1UELB 4MIMA 4D7NA 4HLYA 3LAPA 2R7SA 2HWVA 2VJJA 1IRXA 4W1UA 1HXDA 2COBA 2XPVA 2KKOA 5E3LA 5IP9J 3RTRA 1ZG1A 3C2BA 2VJ5A 3F9KA 2I5UA 5H2FC 4UB8C 2WAEA 1GXQA 1W5TA 3KLOA 1LNWA 4M3GA 3VFZA 2NNNA 3M9AA 2V6EA 4M71A 1S6LA 4D9JA 4QTRA 3LSHA 2KIQA 4KMUX 5J4YA 1K78A 4FX4A 3K7AJ 4EATA 1YLFA 4CUGA 4C3HJ 1FSEA 1TW3A 3V7CA 1H88C 3KP2A 3RKQA 2VC1A 2VXZA 1OYYA 2EBIA 1BIAA 2RQQA 2L2OA 4CDGA 3MKZA 3CMEI 2ZJ2A 1O57A 2EZKA 2F5EA 3K2AA 3KE2A 3GWZA 5DUKA 2VXDA 4OMZA 2JSCA 3OL4A 1BR4A 1ON1A 4OOIA 1OR7A 5FKLA 4KISA 5EGOA 4XICA 4ZC3A 2X4HA 2KISA 5B66C 2R93J 5HOOA 4RLFA 2HYFA 5ICGA 2AQFA 3EPZA 4M3EA 5BNGA 3FHNA 2MH2A 1T39A 3N05A 6PAXA 3ZQCA 2BZTA 3M07A 3KZIC 3GX4X 3CC2I 2HI3A 1DUXC 4E7JA 3DLAA 1YS6A 5EG0A 1MH4A 2M34A 2O3FA 2BE5F 2VT3A 1WKMA 3ECHA 4XLHA 2QQBA 3VODA 4E7HA 1BW6A 1YW7A 4LG0A 1Z6RA 3DU5A 4DOZA 4MNUA 1SANA 2DMUA 1IUYA 2LBFA 2P7CB 5J3LA 3P9CA 4CCNA 2JVGA 4HF0A 3SEZA 3IL2A 1ZQ3P 3WTUC 4CHUA 5BS6A 2ZBKA 4CSWA 4QLCU 2LKPA 1FX7A 3HRMA 4S04A 4LLNA 4IVNA 1IRGA 3HHGA 1RETA 3OIQA 2BVMA 4OIOF 2JN6A 1K78B 2DN0A 1W0UA 3C3WA 4IKFA 4WXDA 4XR6A 4U87A 1HW5A 3OOPA 3WTYC 4M73A 2R7XA 3CUQB 1FOYA 3KYCB 4MQ9F 3T8RA 2O8KA 3AG3H 3DF8A 1P7JA 5F08A 1TLHB 3IWZA 4KFCA 2GXAA 3HPHA 3DBRB 2V1DA 5LBQA 4GXOA 3JAMZ 4NBQA 2F5VA 5JLWA 2MA3A 2XRNA 4FQGA 1XGOA 3OV8A 1FOWA 1OCCH 4GCVA 1ZG3A 4P96A 3GTMJ 2EZLA 3SFZA 2DMNA 3VDXA 2A6HF 1MNEA 4KUMA 2PG4A 2H27A 2DFHA 3VPRA 3JRCA 2Y48A 4E7IA 4KN4X 3DPTA 5TGTA 2RC4A 4UVBA 4HQEA 2MC3A 1B8IA 1R1UA 4V19K 1HDPA 4A0XA 4U0VA 5CYVA 4F91B 4JOMA 5LD2C 2CQ7A 3QYEA 5GAHJ 1LFPA 5JHUA 2DT7B 2HU9A 3TGNA 2R92J 2QQ8A 1ZK8A 4A3DJ 5JI6A 3E5QA 1BR2A 2FMYA 4HEA2 1Z9CA 3W3CA 5IYBJ 3V4GA 4XRSG 2FBIA 3FMRA 4RGUA 3V8JA 2KPMA 5IPAA 2X85A 3RKYA 1EH8A 2ZMEB 1X2NA 2PMZA 4M9ZA 5IT9Z 2L4MA 3OYMA 4K2EA 3ZXSA 2HOTA 2BW3A 1WZ2A 3BJ6A 3K4CA 2ISZA 4FCYA 2DA1A 3CJNA 3CCYA 3DP7A 4HRIA 3BTLA 1GVJA 3OR2C 5KK1A 4E7SA 2BY2A 3RJPA 3I64A 1APLC 3HSRA 1V54H 2M8EA 4E6KG 2A07F 2QYOA 2IS1A 2UXXA 2DFFA 1M1EB 2KRCA 1FBSA 2WV0A 5LEJA 5FKMA 2EV6A 1H89C 4XLPF 2VIXA 2HOAA 3MMYB 2R5ZB 3HC7A 1ITYA 2E1OA 3TEDA 4CCMA 2DA2A 3BR3A 2ZSIB 2NVTJ 2W00A 4V2FA 4A3FJ 1CF7A 2DTRA 3W6JB 2HDWA 1FT9A 4RMNA 2X0LA 1O3RA 4IHVA 4YIRX 1RPWA 2PMHA 2QENA 5BQTA 3VYSB 2LTPA 3H0GJ 3N97A 2D5VA 1BR1A 4MEYF 1HDDC 2DXIA 2IA2A 2CFXA 3A4CA 3GBGA 3J7AY 2NS7A 1I1SA 2FE3A 2I10A 1P9QC 4B43A 2DBBA 2RNJA 2HNHA 1OCOH 2EH3A 1U9NA 2CW0F 4WX9A 4ESBA 2IJLA 3QWLA 5TRDA 2VOOA 2ZJPF 3SXYA 2L3DA 3T0YA 1JKQC 1HC8A 3LA3A 5M5WJ 1BL0A 1IDYA 1ON2A 3NWTA 4E7ZA 4A3LJ 1WI9A 2DYRH 2BV6A 1XGNA 4A69C 2Z1DA 2Q0OA 1V5GA 2J5PA 2QKMB 4D7MA 3ZP5A 2X6OA 3BG9A 3L2RA 4UUSA 9ANTA 1FZPB 1T95A 1SD5A 5HDKA 4X0GA 5CQGA 1T33A 4Y4RA 3T1BA 1SD7A 1LVKA 3K1PA 1AA7A 1F9NA 4EM1A 5D6FA 1PJRA 1U5TC 2LKXA 1JT0A 4PSWA 5D5WB 1E3PA 1IZ1A 2RREA 4IX7A 3GO5A 1BW5A 3K1MA 3HSFA 4RS8A 3A1YA 3L00A 2CV1A 4ENMA 2OV7A 2HPIA 2UXNA 2E7WA 4I09A 4BE1A 2QGUA 3CCQI 1X1BA 4MFDA 1BBYA 2L02A 4M3FA 1BN5A 2L01A 2JA6J 5BOXA 4LD5A 4OMYA 2PN6A 3OYDA 3OSFA 3ZOBA 3TP0A 1W7PD 3CCMI 3OYIA 3BOQA 5K7FA 2X1CA 3L9FA 5HLHA 1A35A 1XN7A 2O5RA 4BUPA 1TC3C 1D8JA 1MBFA 1DP7P 2K9LA 2BXYA 2WA0A 3KFWX 3UNGC 2V9VA 3R6SA 3G73A 3H9GA 3RIRA 3P9KA 2LKSA 2V9PA 1IRFA 3L7WA 2DOFA 4AUXA 3LNQA 3FXMA 1G6NA 3S2WA 1V5FA 5ED4A 5K7HA 2O8XA 5IYCJ 1STZA 3KEOA 3Q9SA 3S3NA 2E5ZA 1Z67A 3NQOA 5J8CA 1BIBA 1MIJA 1VQOI 2QSHX 3GTOJ 4HBLA 4ZYGA 2R5YB 5F27A 2QCOA 1SAUA 2GBYA 1XMXA 1KA8A 4EJOA 3TP3A 2YX7A 1UG2A 3DTKA 2HYGD 4A0ZA 2ESNA 3J7YJ 1XB4A 2CSOA 3J7AO 5IYDJ 4G6DA 2DA4A 3HKZA 4WWCA 2HTJA 4WF2A 4LGWA 3BTIA 3SHFA 3ML6A 1Z05A 3G4SI 1SFOJ 5M5XJ 4L9JA 4MEXF 3HOVJ 5EEHA 3HRSA 4DBRA 3B6AA 4ZYDA 3A02A 2NNYA 4RAZA 3W2WA 1T0FA 1MMGA 1TWAJ 5EEAA 1HQCA 4PUSA 3EUHA 4FETA 1TBXA 5DEQA 2WADA 4MGRA 2H1LA 1FYKA 4CYDA 2NYXA 2DA5A 1H0MA 2A6EF 2H8RA 1VQKI 3CCJI 2YX4A 2TDXA 2XGCA 3BG6A 3EETA 1W0TA 4AWXB 2BYVE 2NVXJ 1IN4A 3LSPA 4DZPA 3QP6A 4II2A 1YITI 1LB2A 4CZCA 2DA6A 2RVCA 3ZQQA 1QZYA 3ESWB 5HNFA 3K70C 3P5JA 3QU3A 1FYLA 1IN8A 2W57A 3CMYA 3KEQA 2WWYA 4U0WA 3S3MA 4NUBA 1X3UA 3D5SC 4MLOA 4B47A 3KETA 4IOAF 1A36A 1C0WA 4HF1A 3OY9A 4BHBA 1TQIA 1KQ8A 1LQ1A 2RGVA 3CJTB 3LSJA 2BY1A 2R7VA 2VKVA 4HNUA 2A3SA 4A3MJ 1P4AA 5AIPA 5J8FA 2QSGX 1GXPA 2L7MP 3S32A 1VI0A 2VBXA 4F7ZA 3KP3A 5FKOA 2HVQA 4PGGA 1I3QJ 1P7IA 2O03A 2JUCA 1D1CA 4QIWN 2Q2EB 5DD8A 1TQPA 2FD5A 1AHDP 3WTXC 4BY7J 1YO5C 4I7HA 1B4AA 1QPMA 2E60A 3CZ6A 1K61A 4D5FA 3C7JA 3L2VA 1W7PA 4AIHA 1VQNI 4AYBA 1G3TA 1WJBA 5EEGA 2BY0A 4C3IJ 3HOXJ 3I4NJ 1GVDA 3RYPA 4NDLA 1S7AA 3E3VA 4H0EA 5JLXA 5BPIA 2EV0A 2FNPA 2AQEA 1ZAOA 5IT3A 2O0YA 2V1XA 2XAJA 2H6CA 1P4XA 2MG4A 1YI2I 4G8XA 2MW8A 5FGMA 3N4MA 2JMWA 2DDAA 1SC7A 3COAC 4I0AA 4BU2A 1YX5A 1IXCA 3CESA 3E6MA 3J81K 5JFRA 2X1EA 1VQLI 3ZR8X 2VOPA 1WJAA 3I9V2 1DDNA 4KIFA 2NXNB 3RCOA 1GV2A 1I39A 4UVCA 3JR9A 3M8EA 4LOCA 4KIGA 4NC6A 2DA3A 1IN7A 3REOA 2KRFA 2ZKZA 2VUMJ 4BQOA 2XAQA 2UV1A 4L5JA 1KQ9A 2M4KA 3TQNA 3ROUA 2E1NA 5CKTA 3UKGA 3F72A 1SFUA 3TKYA 3OYEA 4HNVA 2QQAA 4UUTA 3TDUC 3WG9A 3GXOA 2V7FA 3CCLI 2FOWA 5DM7F 4GGGA 3RDIA 2QF7A 3VEPA 5KAIC 2VQLA 3C2HA 4E7LA 4XL9A 2CW7A 5EGOB 2HPMA 2QA4I 3IWFA 1SVLA 3PIOF 3BCAA 2KL4A 2RN7A 3IH2A 1W7PB 1XCBA 3RI4A 1NH3A 1IDZA 3FKJA 2WB1A 3OS1A 2X51A 3E0JB 1JUSA 2X6XA 4DW6A 5KHDA 1RRJA 5E3NA 2JSPA 3GCMA 1R7JA 4DBQA 4CYCB 5B5EC 5LEKA 2Y31A 4OWRB 3I5UA 1U8RA 3JTHA 4PJ0C 3WE3A 3DLLF 4A3BJ 2PI0A 2WTEA 3DWLE 2ZJQF 4ZDPA 3GFMA 2JQ7A 4G9YA 3BG3A 3O8GA 4PJNA 1D1AA 3H5RA 1USTA 3QU6A 2L9RA 2ZXHA 1P2FA 4B1RA 3K70D 1W4MA 2HTSA 4R79A 2XIGA 2K4BA 3A01A 4Q4ZF 4PCQA 1YHQI 2ESHA 5E8GA 4Y15A 5D4SA 1D0ZA 4MTEA 2CO5A 1ETWA 1K6OA 3F23A 3BQYA 3KIOA 1JJ6C 2L9SA 2VBWA 3FBNB 1J59A 4EJTA 4XRFA 3IH3A 4OAYA 2XGEA 3GLXA 4Q48A 1QRYA 5HLIA 2KMUA 1BC7C 2QWWA 5A2QZ 3L2WA 1DGWY 4FISA 4EJVA 1X2MA 4NQWB 4JK1X 4XM3A 3D1NI 4JX4A 1JE8A 3QPLA 1UHWA 1E0EA 1QQIA 4GO1A 1OCRH 1IV6A 3J80Z 3HTUA 1VFCA 1UFMA 1LE8A 2FBHA 2R7UA 1DPRA 3W6VA 2COMA 4BAYA 1FY7A 3WTWC 2WY8Q 2M5WA 1T8IA 5LFAA 1FMVA 4KIBA 4L0YB 5AONA 1F4KA 3CDIA 1OYIA 3VYTB 2AHQA 1D8KA 3OIOA 3ABUA 4XKVA 4PDKA 1UHMA 2VB6A 1ZTRA 1BI0A 2W1OA 2H8WA 4R8HA 1MJAA 3HG9A 2M2EA 2OA4A 2XROA 1HKSA 1RUOA 1YTYA 2UZKA 1MMSA 2ECBA 5LHIA 3WGIA 3Q5FA 4IQJA 4KT6A 1V55H 2JJ7A 3IAM2 3BT9A 3JAMK 4E7KA 3BY6A 2M7BA 1O7LA 3R4KA 3SDGA 3LOCA 4L5EA 2F4IA 4G94A 1B59A 4HSRA 2XV4S 1KGSA 2IA1A 1R1VA 3A01B 1ZR2A 5CVJA 1PUEE 1Z21A 2E34A 3F21A 4AIJA 3E6DA 3JRHA 3WODF 3S1MJ 3G3ZA 3OYAA 3HSEA 5J1YA 2DLLA 3P9IA 2HQNA 1JHHA 2PMZN 3VSKA 2R7DA 3LSMA 2H1KA 4UY8I 4BY1J 3JRBA 3GF2A 3BJAA 1NG6A 1TW2A 1EV7A 2DYSH 2GWRA 4LJZF 3H92A 5D5VB 3F8FA 4N4NB 4ZZDA 2ZFWA 3I54A 1BM9A 3X2QH 4BXUA 1GLNA 5FD6A 3ZN0A 2MD5A 3EUKL 2CMPA 3ZMTA 4BHCA 1TNTA 3RPUD 3IAS2 3KP7A 4ON0A 3ASOH 1D5YA 1ODDA 1JTXA 2E36A 5FFZA 3PNYA 2GM4A 5CVIA 3HGGA 2CUZA 3J7ZI 2VE8A 2L0KA 5B1BH 2R7QA 2VASA 5DYMA 2FJ1A 4PJMA 3F8NA 1ZLJA 1X1DA 1OFCX 1FP2A 4Y13A 3CD6I 3BPXA 3U21A 3WU0A 3BR2A 4XN3A 2N8GA 2ZC2A 3AG1H 5M3MJ 2MLGA 3CCVI 1RESA 4OIQF 2ZSHB 2OU2A 4Z2YA 3HOUJ 1LDJA 1YFHA 2JPBA 4FTHA 2CQQA 5K5OA 3H9QA 1GDTA 4YELA 2DT6A 2L7FP 1O7FA 5CJ9A 3IP4B 4HG2A 1ZLKA 1MJBA 2BOLA 2R7OA 3G1OA 4FX0A 1Y1WJ 2TCTA 2OQGA 2OPTA 2OCEA 1T6SA 4IEJA 2LSOA 4CXFA 1ETKA 2IS4A 2M30A 2PFBA 1DP3A 3OIPA 3FM5A 1J7KA 3E5UA 1KONA 3K1NA 4I98B 1MMAA 3CP2A 2CUFA 2F5CA 5EDNA 1UCRA 2DW4A 1HLVA 1S72I 2FNAA 4CCJA 1FYMA 3ABMH 1R49A 4JX5A 5FRMA 3E7LA 4Q5SF 2AXTC 3ZQFA 1SD6A 1MBHA 1MD0A 3BR5A 4PFOA 2VJ4A 3DBLB 3R61A 3MZ8A 5D6EA 4AVZA 2QZ8A 2NS8A 3E97A 3A2KA 4A2UA 4B8XA 3FK6A 4I76A 1PUFA 1T2KA 1G3WA 3CUOA 2LY1A 2K85A 3GTGJ 4HA8A 4XNFA 5LHHA 1WJEA 2GLOA 1FBUA 2JRMA 2XF7A 3FXLA 2K5CA 3DPUA 1AU7A 4J19A 2DPDA 1S3JA 2EB7A 2IW5A 2E1MB 5ICEA 2XHKA 4IZZA 1VNDA 2MSYA 2GA1A 2HOEA 1CGPA 2OQRA 3JRAA 3JW4A 2EFNA 2EJRA 4GDFA 3S17J 5DCFA 2CGPA 5CVUA 2XAUA 4XOTA 1LVAA 3GZNB 4BEHB 1HSTA 1K4SA 2NS0A 3KPHA 1YW9A 5J40A 4OIRF 4BBRJ 2R4GA 5F0CA 4P55A 4F93B 5E3MA 5KNLA 4F55A 1LE8B 4JQFA 5HS7A 3CCRI 1MZBA 1SVOA 1S8NA 1WCMJ 4M9XA 1V4RA 4MTDA 3D5LA 2WY7Q 3JSPA 5K7ZA 2ZXWH 3BPVA 1BA5A 3F22A 3AL0B 5C44J 3VSLA 3Q0VA 3U1KA 1S29A 1GUUA 4A3IJ 2E1MC 4WXHA 1OCTC 1NTCA 2ZMEA 4O6JA 4U88A 1R23A 5C4JJ 2Y0SA 2BXZA 1OQYA 4UUSB 1FTTA 4D0PA 4YFNF 1YJ9I 1XTAA 2G7HA 1G4DA 2LC2A 3PUFA 4LB6B 3LSKA 5H6QA 1LPQA 2WC2A 3MQ0A 1QZZA 1FEXA 2YR2A 5EF6A 1UG0A 2ZXJA 2VBZA 2A5WA 4BBSJ 1HKQA 3HKZN 1JGSA 3GFJA 2LLKA 2VODA 1G2HA 2KZGA 5HVQC 1YRNA 1QBJA 4ZTJA 5ILUA 1P92A 1T08B 4XLNF 2B63J 4RB1A 2BGCA 1U2WA 5GPCA 4M3DA 1BJAA 3HUGB 1J75A 4BDZA 1EJ9A 3ZN1A 4XKCA 4YIFA 3CUQA 2MD0A 3HXLA 1N77A 2OTJI 3GVAA 5LRRA 2JA5J 4ZTFA 3A03A 1VQ5I 1MGTA 2EFPA 3FXOA 2VKDA 3BROA 1AWCA 1REPC 1RKWA 2HS5A 2X9DA 2ELKA 1YOVB 5KAFC 3FX3A 3SDBA 5AIQA 5GTHC 2EFQA 2ETHA 2LF8A 3A0BC 3GTPJ 3HZJA 2D1HA 3Q0UA 2XVCA 4JP0A 1ETYA 1YIJI 4AIKA 1UZCA 3PNTA 3DCFA 5DV5A 2R5ZA 3CF5F 2VQGA 2ECCA 1EA3A 1YS7A 4F3QA 4I0BA 1X4OA 1SMTA 3IHUA 3HIFA 1ONVA 3O3KA 3OOUA 3C2GA 4P1WA 3I56I 1WH7A 4Z6YA 3RYRA 4C2MJ 3K4NA 3BTCA 5D5XB 1Y8QB 2OZUA 1R5GA 3DKXA 1MBEA 3KYLA 5EYRA 2D1VA 2NVYJ 3V42A 5DM6F 1XSVA 4ENNA 5J1UA 3PM1A 2XGDA 4ZZLA 2W85A 2DO7A 4XRMA 4CA0A 1JGGA 1E3HA 3M1EA 3DEWA 4XN0A 3R60A 3HB9A 5F1JA 1OJLA 4HV6A 2VT2A 2YPRA 3HRUA 2HVSA 5CVRA 1H9GA 4FE7A 3GTQJ 2LBFB 3WHBA 1IGNA 2X48A 3ZMSA 3FXKA 4LITA 3EYIA 2K86A 1VQ7I 2LOOA 1RZ4A 2NOJB 2BW3B 4ESFA 3L2UA 2P7VB 4BGDA 4HYEA 4AYBN 3BR6A 3GFLA 2DJNA 3CC4I 1MJ9A 2Y0SN 5E3OA 4D5CA 2Q8KA 4IHTA 1WGXA 3LQRA 3PO3J 4KJZA 4N0BA 3BJOA 3QOEA 4A3EJ 2EZHA 3H3UA 1RC9A 1VTNC 3ZCOA 1YJNI 1FTZA 4A5NA 2V1UA 4B3XA 1PDNC 2IP2A 1ZH5A 2DFEA 2JK3A 1A04A 4S05A 1X4PA 4HX7A 1XC5A 3IRRA 2JA2A 4A5MA 5EG0B 4L18B 3CMMA 2V1NA 3V8KA 4I2OA 4G7ZF 1D1BA 1YX3A 4EJUA 2BVLA 2GXBA 1IAWA 4BJ6C 4A3GJ 3TO9A 1X1PA 1T0FC 1S9HA 1RIOH 1ORKA 2WAQA 3S14J 4RDUA 3MAJA 1V3FA 5FLVA 1R6RA 2HQAA 2VL8A 3OYFA 1I5ZA 4E4HA 4EGZA 1OISA 4LG3A 3ZMZA 5D4RA 1FIAA 2F5FA 2IAIA 2KLOA 5GPAA 4YFKF 3PFIA 1ZGWA 3OYJA 1UAAA 2DK5A 2FX0A 5DUIA 5BMZA 2LH9A 3EQLF 4ZYAA 3HOYJ 1XDSA 4BJTA 2PX9A 3ELKA 1E2XA 3FK7A 3AG2H 5FKKA 4DNCA 4EVIA 1VQ9I 1IXRC 4L0ZB 4HDVA 1ZN2A 5GADJ 1MNDA 1JXSA 4HSTA 2J5OA 2ZXIA 1MDMB 1Z0XA 2L9NA 2FA5A 4RAGA 5D8LB 2E19A 1JKPC 1K79A 2VC0A 4N9IA 3IV5A 5J1RA 4XIDA 3ECOA 2HZDA 3W6KB 2F48A 2ADUA 1VZ0A 1K83J 1GHCA 5FRNA 5L3FA 3R0AA 2Y30A 2DI3A 1R5ID 3DU6A 3KZYA 4QPQA 1PP8F 4LK0F 1MNMC 2P4WA 5K5QA 3H9JA 1ULYA 3P7NA 2CV0A 4NB5A 2PEXA 4IOCF 4XLEA 1WRJA 1IW7F 1R1TA 2BY3A 2XUBA 3GTLJ 4IHSA 3KEYA 1Q1VA 1XCVA 2FEZA 3IC7A 1WJDA 5ICCA 4C30A 1G8XA 4MFEA 3TO6A 1MMNA 2FSWA 3G6EI 1CF7B 2VKHA 3BG7A 4IRGA 2O61A 3RSNA 2V79A 1FMWA 2HOSA 1TWFJ 1U5TA 2CJJA 1WI3A 5HS9A 3BQZA 3F3XA 4OIPF 1B72B 5JVTA 1PUFB 2D45A 1R00A 2BHYA 4PGHA 2CH0A 5JHFA 2BHZA 3ERMA 5E79C 3ABKH 1QO0D 4LG0B 3A0HC 2QQ9A 2JVHA 2PQ8A 1I1GA 5FLXZ 2IT0A 1E17A 3Q9VA 1OYWA 1MMDA 2G9WA 2K9SA 1HF0A 1TQMA 3VOEA 3I4PA 4AIDA 2Q2EA 2V6CA 1HOMA 2A61A 2XPUA 3ZMDA 1MSEC 3GFIA 3RKWA 5JVGF 1YRNB 4ETSA 5LRSA 3NWSA 1S7EA 1ZRCA 2W4SA 3ZPLA 3LWFA 2K9NA 5GP9A 4V2GA 2VQHA 1XPXA 2Z9OA 3CDHA 1MBGA 2H6BA 1IXSB 2KDOA 4DQ2A 2RNGA 2DJIA 3BZKA 5CVVA 2M45A 5E20A 2PMUA 5H20A 3M4OJ 1MDMA 2M9HA 2X1DA 1IUFA 1HW1A 3K4JA 3JSOA 3FXJA 3F6VA 1XMKA 1R22A 2QLZA 1AKHA 2VONA 3JCUC 3E5XA 3PSFA 4XQFA 2NVUB 3ZMVA 2HVRA 4C2UA 2ZB9A 4I01A 3T5XA 1ZRDA 3PL8A 5F1RA 1L0OC 5LGNA 2DT5A 4ZDOA 1VQPI 4C9YA 2MGQA 4X6AJ 3DEUA 2FOKA 3F8BA 1VQ6I 1LFBA 1B6AA 1QZEA 3B73A 2E2IJ 4NHJA 3PJRA 5GTIC 2ME6A 3IRQA 2FF4A 2L7KA 2DU9A 4UV8A 2HQRA 2VI6A 1ZARA 3SZTA 4FASD 4M72A 2FU4A 1U78A 4WXCA 2JA8J 1T98A 2DTZA 2P0WA 4U0YA 2B0LA 2KIFA 2KRHA 1SEUA 2M87A 1X1AA 3L2CA 2GIVA 2LY9A 4JYKA 2QBYA 2LVSA 1H8AC 1A6QA 2F4MB 1XX5A 2TRTA 2OJED 1POGA 1UMQA 1X19A 2Z33A 1FSHA 4KA4A 1D0XA 4IHXA 3ERED 5HNHA 4YG2F 2V26A 2VJIA 1ETVA 3CTAA 4CYCA 3S1RJ 4C3JJ 3M1CA 3HOWJ 3MKWB 2KP6A 1YJWI 1DPUA 2EPFA 4EQQA 5E17F 3F0CA 2GXGA 4LIUA 2HXOA 1HW2A 4BYYA 2KT0A 5L3BA 1N25A 2PBIA 2K40A 4MHGA 3WGGA 1FLIA 2VBYA 2EIJH 1I3AA 4QWQA 3FXQA 3BG5A 1FWZA 2W82A 4LMYA 1IG7A 1KU2A 2CQNA 5E1ZB 5FB2A 5LHGA 1ETQA 1XG1A 4BE0A 3DEEA 4A93J 1FOXA 3BCBA 4NC7A 3I58A 1R5HA 1KU7A 4HAMA 4BXXJ 3ISPA 1WJFA 2RDPA 4IXAA 4RGXA 4A6EA 2OTLI 1SFEA 2QKLB 3CP8A 5E1WA 3EYYA 2JWTA 4CO8A 1VF9A 5F0HA 3EDPA 4LFUA 2A05A 2DFIA 3SEQA 4D1QA 4PZJA 3HYIA 1Y56A 3D5RC 4ABZA 3E1SA 3GTJJ 3NAUA 1Z3YA 1EF4A 1QA6A 2K3FA 3OYGA 1XD7A 2FUG2 2KHMA 3FZVA 4CH7A 3LSGA 3TO7A 2ACJA 1H9TA 3VWBA 3LA2A 5FJ8J 5LGTA 2FMLA 4UNOA 4UB6C 2JRTA 1LEAA 3VB2A 1X3ZB 3K4KA 2ID3A 3JRGA 1Y39A 1K4TA 4GFBA 4PJJA 2PJPA 2WAFA 4XONA 3MVPA 2IGKA 1Y1VJ 2M4GA 3OYBA 1U6GA 2IS2A 3FXRA 3G1MA 2LK2A 2NVQJ 2EIKH 2HGCA 3LFUA 4XLAA 5IOZA 2GOMA 3FDYA 1O3SA 3ZQHA 1MW7A 1TZLA 2P81A 2ZFUA 3KP5A 2Z3YA 3LSTA 5FLMJ 4YEJA 2M0MA 2FQ3A 1R58A 3CO7C 4BJ5C 3RPUA 1G3SA 2WB1N 3JRIA 3F8CA 3I71A 4II3A 1KYZA 2XGXA 3M8FA 4KICA 2JA7J 1IV8A 2B7EA 2EV5A 2LNBA 3PO2J 2IGMA 2M3AA 3H5NA 1U0JA 5J47A 3WG7H 3WU1B 4S0HB 2LF7A 2CRGA 4DZJA 3OWTA 5L3DA 1NK3P 2IRFG 3SFIA 3NARA 4TV7A 2EWNA 3OYCA 2P5KA 2O6GE 4LLLA 4KT5C 1WVRA 1G3YA 4BEHA 4XORA 4JBAA 2CQKA 1U5TB 1NK2P 2WV1A 1Z91A 1OR7C 1SAXA 4HZFA 4B44A 4EM0B 1QNTA 3CO6C 2FQ4A 1LDKB 4LLGF 3S93A 4BNCA 2QSFX 1IRZA 2M8GX 1JJ8C 3VYUB 2DQRA 2O7OA 3LMMA 2HZTA 4W97A 2ELHA 3CF2A 2EFWA 1BOBA 3I3LA 4Y33A 4DYQA 3PIPF 1WSUA 1KU9A 1QHGA 4G7HF 1ZREA 4RB0A 2XSDC
chains in the Genus database with same CATH topology
4IRHA 1ZGAA 1IN5A 3IKTA 3CLOA 2OD5A 3GW2A 2K4JA 4IRIA 2JPCA 4RB3C 3DKWA 1OMIA 3PQJA 1IF1A 2BBYA 5F64A 2JZYA 3DV8A 3ULQB 3BZ6A 4RGRA 1W5SA 3U1DA 1FBQA 3B02A 2QVOA 3LFKA 2FRHA 3GEZA 3V8LA 4EMSA 2H09A 2P6SA 1HKTA 5FO5A 3MZHA 4HX8A 5HLGA 1OPCA 4U7DA 1LDDA 2G7UA 1YW8A 4OU0A 3DQVC 2JT1A 2YU3A 3I0TA 3KP6A 1J5YA 5E8IA 3FMSA 3ZQ7A 2NRAC 2E7XA 2HKOA 2EA2A 3QOPA 1XMAA 1WWXA 4WK8F 4Q47A 1I6XA 3O6BB 3J81Z 2GZWA 2QM3A 3O2PE 1LEBA 1YG2A 3L09A 2ISYA 2FBKA 2VE9A 5ICFA 1RI7A 4ASNA 4XBFA 1Q1HA 5FD5A 1K7AA 1YYVA 1OKRA 2K27A 1TTYA 5H6RA 2P5LC 4A0YA 4FT8A 5BPDA 3I53A 2IA0A 3MFKA 2XAHA 1SFXA 2DK8A 1FNNA 1O3TA 2OZ6A 3T8TA 1XSDA 5DCMA 2ZNYA 3CUQC 3I59A 3I59B 3K2ZA 1J2XA 3KLNA 4XSXF 4O3MA 1R36A 1JHFA 1FPQA 5DD4A 4LK1F 4MQVA 2L54A 2AXLA 4M6YA 1P6RA 3TOAA 5D5UB 2QUFA 4IPAA 4FHTA 4HDUA 3BDDA 2P6TA 3GZ6A 4EJWA 1UB9A 3QP5A 5DCMB 1XGSA 1Z1DA 2CWEA 4HQMA 5A2QK 2P8TA 1Z7UA 2HFHA 2UWMA 3M7GA 4EV0A 1AOYA 1WQ2A 4RAYA 4UV9A 3LQQA 1SMYF 5CLSA 3LA7A 2BEOA 3E6BA 1RUNA 4RGSA 4M9SA 3FF5A 1BOAA 5L3CA 3MWMA 3FMQA 5HDNA 4R1HA 5JR3A 4E70A 3FM3A 2KJBA 2ZNZA 4KYWA 2Z5UA 1Y0UA 2R7FA 2EA4A 2MBFA 5HS8A 3FWEA 2NAZA 2ZO4A 1XSXA 4ZYEA 1LJ9A 1FC3A 4KN7X 2F5DA 3GZ5A 5FLXK 3J80K 5LGUA 1KYWA 4U7BA 2DAOA 1XDUA 2XKOA 3ABTA 4UXNA 1QGPA 2JTVA 2H94A 2RV8A 4O5VA 2KIMA 3SZPA 1T38A 3ZMUA 1BI1A 4OINF 5K1YA 5IT9K 4BH9A 1BI3A 2ZCWA 4HV5A 4KNYA 1F1ZA 5D8KB 3IKVA 3U9GA 1KU3A 3D0SA 1USSA 4P9FA 2OAZA 1TNSA 1ZRFA 4A6DA 4GYGA 2AS5F 2GAUA 2A5YB 2RKHA 3E6CC 3HOSA 4CGZA 1PP7U 2QBYB 3TOBA 4GYIA 3DXJF 3TDZC 2FXAA 1D3YA 4HOBA 1RNLA 4CZZA 1U3EM 2DPUA 3GUDA 3H3ZA 4LB5A 5F6FA 1S7OA 2GA2A 2F2EA 4IF4A 1BI2A 2A68F 4ESJA 2W25A 1ZGJA 4IJAA 4M74A 4XSZF 3F8MA 4AD9A 1ZG5A 3C1DA 2YSRA 4ZYHA 3MEXA 2Z99A 4EGYA 3HRTA 2Y75A 5HDGA 1B9MA 4HX4A 1KQ0A 1SD4A 5TJJA 5E18F 2EFOA 2HR3A 5L3EA 1NHAA 1L3LA 1P4WA 1I27A 3QPHA 5ILSA 5KVRA 2XKPA 3PQKA 3K9TA 5DDGA 3BWGA 2DQLA 4B09A 3JTGA 4KMFA 3QAHA 5E1XA 4EM2A 5ERIA 1B1BA 2IVMA 1YIOA 3BP8A 3HUGA 3RPQA 2CG4A 3KCCA 2W84A 1J9IA 2P5VA 4L9TA 2A69F 4L5IA 3C18A 5J6XA 4L9NA 3QPTA 3RKXA 4CICA 3MCZA 3DPLC 2M1BA 3MZYA 3GYHX 4BHPA 1FP1D 2STWA 3KP4A 2IPQX 4RB2C 3WGHA 4ENKA 4HLXA 4P9UA 2D2WA 4P5OA 1HSJA 2MLKA 4M6XA 4Y17A 1D5VA 3HHHA 4KDPA 2CYYA 1Z6TA 4WCGA 2KJCA 4ENJA 4A12A 1J0RA 4UVAA 2VN2A 2GQQA 3LAJA 1F5TA 1YQAA 3U2RA 1EH7A 4G6QA 4G7OF 2PLYA 4N9HA 2XASA 4UHTA 3WTSC 4BQAA 2STTA 1ZYRF 3WTTC 3FXUA 3NRVA 2K7LA 1FOKA 1XGMA 3K69A 4ZH4F 3DFGA 3SQNA 2W24A 4L9VA 5LLQA 3WTZA 1HBXG 3NEUA 2R3SA 4UUVA 1EH6A 4YIIA 2Y0MA 3KZZA 5L3GA 3HOTA 3QRFF 5K5RA 3AAFA 2C6YA 4AVPA 3R0JA 4I02A 2KIUA 2OBPA 3V7RA 2XAGA 3WE2A 2L4AA 3HTSB 2HEOA 3V7SA 3F6OA 2E1CA 2XAFA 2HKXA 3K0LA 1ZHFA 2LDUA 2K02A 2HDCA 2EK5A 1B9NA 1IN6A 2RQPA 3FHZA 1BC8C 4YFXF 4NQWA 1O3QA 1MKMA 5FFXA 4HF2A 2MH9A 5ILVA 4HW0A 3WTVC 4HLYA 3LAPA 2HWVA 1HXDA 2KKOA 3RTRA 1ZG1A 1GXQA 1W5TA 3KLOA 1LNWA 3VFZA 2NNNA 3M9AA 4M71A 1S6LA 4KMUX 1K78A 4FX4A 1YLFA 1FSEA 1TW3A 3V7CA 3KP2A 2VC1A 2VXZA 1OYYA 1BIAA 4CDGA 2ZJ2A 1O57A 2F5EA 3KE2A 3GWZA 5DUKA 4OMZA 2JSCA 1ON1A 4OOIA 1OR7A 2X4HA 5HOOA 2HYFA 5ICGA 2MH2A 1T39A 6PAXA 3GX4X 1DUXC 1YS6A 2O3FA 2BE5F 2VT3A 1WKMA 3ECHA 2QQBA 3VODA 1YW7A 4LG0A 1Z6RA 4MNUA 1IUYA 2P7CB 3P9CA 4HF0A 3IL2A 3WTUC 4CHUA 5BS6A 2ZBKA 4QLCU 2LKPA 1FX7A 3HRMA 4S04A 4LLNA 4IVNA 1IRGA 3HHGA 4OIOF 1K78B 3C3WA 4WXDA 1HW5A 3OOPA 3WTYC 4M73A 3CUQB 4MQ9F 3T8RA 3DF8A 1TLHB 3IWZA 4KFCA 2V1DA 5LBQA 4GXOA 3JAMZ 2MA3A 2XRNA 1XGOA 3OV8A 4GCVA 1ZG3A 4P96A 3SFZA 2A6HF 4KUMA 2PG4A 2H27A 2Y48A 4KN4X 3DPTA 2RC4A 4UVBA 4HQEA 2MC3A 1R1UA 4A0XA 4U0VA 5CYVA 5JHUA 3TGNA 5JI6A 3E5QA 2FMYA 1Z9CA 3V4GA 2FBIA 3FMRA 4RGUA 3V8JA 3RKYA 1EH8A 2ZMEB 4M9ZA 5IT9Z 2L4MA 4K2EA 3BJ6A 2ISZA 3CJNA 3DP7A 1GVJA 5KK1A 3RJPA 3I64A 3HSRA 2M8EA 2A07F 2QYOA 2UXXA 5LEJA 1FBSA 2WV0A 2EV6A 4XLPF 1CF7A 2DTRA 3W6JB 1FT9A 2X0LA 1O3RA 2PMHA 2QENA 5BQTA 3N97A 4MEYF 2IA2A 2CFXA 1I1SA 2FE3A 2DBBA 2RNJA 2CW0F 4WX9A 4ESBA 2IJLA 5TRDA 2VOOA 3SXYA 2L3DA 3T0YA 3LA3A 1ON2A 1WI9A 2BV6A 1XGNA 2Q0OA 2J5PA 3ZP5A 1FZPB 1SD5A 5HDKA 3T1BA 1SD7A 3K1PA 1F9NA 4EM1A 5D6FA 1U5TC 5D5WB 1IZ1A 3GO5A 3K1MA 3HSFA 4RS8A 3L00A 4ENMA 4I09A 2E7WA 2UXNA 1BBYA 2L02A 1BN5A 2L01A 5BOXA 4LD5A 4OMYA 2PN6A 1W7PD 3BOQA 5HLHA 3L9FA 1XN7A 1D8JA 1DP7P 3KFWX 2V9VA 3R6SA 3G73A 3RIRA 3P9KA 1IRFA 3L7WA 1G6NA 3S2WA 5ED4A 2O8XA 1STZA 3KEOA 3Q9SA 3NQOA 5J8CA 1BIBA 4HBLA 4ZYGA 1KA8A 4EJOA 2YX7A 2HYGD 4A0ZA 2ESNA 1XB4A 2CSOA 3J7AO 4G6DA 4WWCA 2HTJA 4WF2A 4LGWA 3SHFA 3ML6A 1Z05A 4L9JA 4MEXF 5EEHA 3HRSA 4ZYDA 2NNYA 4RAZA 1T0FA 1HQCA 3EUHA 1TBXA 5DEQA 4MGRA 1FYKA 4CYDA 2NYXA 1H0MA 2A6EF 2YX4A 2TDXA 3EETA 4AWXB 2BYVE 1IN4A 3QP6A 1LB2A 2RVCA 1QZYA 3QU3A 1FYLA 1IN8A 2W57A 3KEQA 2WWYA 4U0WA 1X3UA 3KETA 1C0WA 4HF1A 4BHBA 1TQIA 1KQ8A 1LQ1A 2RGVA 2A3SA 1P4AA 5AIPA 5J8FA 1GXPA 2VBXA 4F7ZA 3KP3A 4PGGA 2O03A 5DD8A 1TQPA 3WTXC 1YO5C 4I7HA 1B4AA 1QPMA 3C7JA 1W7PA 4AIHA 1G3TA 5EEGA 3RYPA 1S7AA 3E3VA 4H0EA 5BPIA 2EV0A 2FNPA 5IT3A 1ZAOA 2O0YA 2V1XA 2XAJA 2H6CA 1P4XA 4G8XA 5FGMA 3N4MA 3COAC 4I0AA 1IXCA 3E6MA 3J81K 5JFRA 2VOPA 1DDNA 4KIFA 4UVCA 3M8EA 4KIGA 1IN7A 3REOA 2KRFA 2ZKZA 2XAQA 4L5JA 1KQ9A 3TQNA 3ROUA 2E1NA 3F72A 1SFUA 3TKYA 2QQAA 3TDUC 3WG9A 3GXOA 4GGGA 3RDIA 3VEPA 3IWFA 3RI4A 2RN7A 1W7PB 1XCBA 1R7JA 5LEKA 3I5UA 1U8RA 3JTHA 3WE3A 2PI0A 2WTEA 3GFMA 4G9YA 1USTA 3QU6A 1P2FA 1W4MA 2HTSA 4R79A 2XIGA 2K4BA 4Q4ZF 4PCQA 2ESHA 5E8GA 4Y15A 5D4SA 4MTEA 2CO5A 1K6OA 3F23A 4EJTA 2VBWA 1J59A 4XRFA 3GLXA 4Q48A 5HLIA 1BC7C 2QWWA 5A2QZ 4EJVA 4JK1X 1JE8A 1UHWA 1QQIA 4GO1A 3J80Z 3HTUA 1UFMA 2FBHA 1DPRA 2COMA 4BAYA 1FY7A 3WTWC 2M5WA 4KIBA 4L0YB 5AONA 1F4KA 1OYIA 1D8KA 3ABUA 4PDKA 1UHMA 1BI0A 4R8HA 1MJAA 2OA4A 2XROA 1HKSA 1RUOA 1YTYA 2UZKA 3WGIA 5LHIA 3Q5FA 3JAMK 3BY6A 1O7LA 3R4KA 4G94A 1B59A 2XV4S 1KGSA 2IA1A 1R1VA 5CVJA 1PUEE 3F21A 4AIJA 3E6DA 3WODF 3G3ZA 3HSEA 2DLLA 3P9IA 2HQNA 1JHHA 2R7DA 3GF2A 3BJAA 1TW2A 1EV7A 2GWRA 4LJZF 3H92A 5D5VB 3F8FA 4ZZDA 2ZFWA 3I54A 1BM9A 4BXUA 5FD6A 3ZN0A 2MD5A 3ZMTA 4BHCA 1TNTA 3KP7A 4ON0A 1ODDA 5FFZA 5CVIA 2VE8A 5DYMA 3F8NA 1ZLJA 1FP2A 4Y13A 3BPXA 3WU0A 2MLGA 4OIQF 2OU2A 4Z2YA 1LDJA 1YFHA 2JPBA 5K5OA 5CJ9A 1O7FA 1ZLKA 1MJBA 4FX0A 2OQGA 1T6SA 4CXFA 2LSOA 2M30A 2PFBA 3FM5A 1J7KA 3E5UA 3K1NA 4I98B 2F5CA 1UCRA 2DW4A 2FNAA 1FYMA 4Q5SF 1SD6A 1MD0A 3R61A 5D6EA 2QZ8A 3E97A 4A2UA 4B8XA 1T2KA 1G3WA 3CUOA 4HA8A 5LHHA 1FBUA 2DPDA 1S3JA 2EB7A 2IW5A 5ICEA 2XHKA 2GA1A 2HOEA 1CGPA 2OQRA 3JW4A 2EFNA 2EJRA 5DCFA 2CGPA 5CVUA 1LVAA 1HSTA 2NS0A 1YW9A 4OIRF 4P55A 4JQFA 5HS7A 1MZBA 1S8NA 4M9XA 1V4RA 4MTDA 3D5LA 3JSPA 3BPVA 3F22A 1S29A 4WXHA 2ZMEA 4O6JA 4U88A 1R23A 4D0PA 4YFNF 2G7HA 1G4DA 4LB6B 5H6QA 2WC2A 3MQ0A 1QZZA 2YR2A 2ZXJA 2VBZA 1HKQA 1JGSA 3GFJA 2VODA 5HVQC 1QBJA 5ILUA 1P92A 4XLNF 4RB1A 2BGCA 1U2WA 1BJAA 1J75A 3ZN1A 4YIFA 3CUQA 3GVAA 5LRRA 1MGTA 2EFPA 3BROA 1AWCA 1REPC 2HS5A 3FX3A 5AIQA 2EFQA 2ETHA 2LF8A 2D1HA 2XVCA 4AIKA 5DV5A 1YS7A 4I0BA 1SMTA 3IHUA 3HIFA 1ONVA 3O3KA 3RYRA 5D5XB 2OZUA 1R5GA 2D1VA 1XSVA 4ENNA 4ZZLA 2W85A 2DO7A 3M1EA 3R60A 4HV6A 2VT2A 2YPRA 3HRUA 5CVRA 1H9GA 3ZMSA 3EYIA 2K86A 1RZ4A 4ESFA 2P7VB 4HYEA 3GFLA 1MJ9A 4IHTA 2Q8KA 3LQRA 4N0BA 3BJOA 3H3UA 1VTNC 4A5NA 2V1UA 1PDNC 2IP2A 1ZH5A 1A04A 4S05A 4HX7A 3IRRA 4A5MA 4L18B 3V8KA 4I2OA 4G7ZF 4EJUA 2GXBA 1IAWA 3TO9A 1RIOH 3MAJA 1V3FA 1I5ZA 4EGZA 3ZMZA 5D4RA 2F5FA 4YFKF 3PFIA 2DK5A 5DUIA 5BMZA 3EQLF 1XDSA 3ELKA 1E2XA 4DNCA 4EVIA 1IXRC 4L0ZB 4HDVA 1ZN2A 1JXSA 1MDMB 2J5OA 5D8LB 2FA5A 1K79A 2VC0A 4N9IA 3ECOA 3W6KB 2ADUA 1GHCA 5L3FA 3R0AA 2DI3A 3KZYA 1PP8F 4LK0F 2P4WA 5K5QA 1ULYA 3P7NA 4NB5A 2PEXA 1WRJA 1IW7F 1R1TA 2XUBA 4IHSA 1XCVA 2FEZA 3IC7A 5ICCA 3TO6A 1CF7B 2FSWA 4IRGA 2O61A 2V79A 1U5TA 5HS9A 3F3XA 4OIPF 5JVTA 2D45A 1R00A 4PGHA 1QO0D 4LG0B 2QQ9A 2PQ8A 1I1GA 5FLXZ 2IT0A 1E17A 3Q9VA 1OYWA 2G9WA 1TQMA 3VOEA 3I4PA 2Q2EA 2V6CA 2A61A 3ZMDA 3GFIA 3RKWA 4ETSA 5LRSA 1ZRCA 3ZPLA 3LWFA 2Z9OA 3CDHA 2H6BA 1IXSB 4DQ2A 5CVVA 2M45A 5E20A 2PMUA 5H20A 1MDMA 1HW1A 3JSOA 3F6VA 1XMKA 1R22A 2QLZA 2VONA 3E5XA 3ZMVA 4I01A 3T5XA 1ZRDA 5F1RA 1L0OC 5LGNA 2DT5A 3DEUA 2FOKA 3F8BA 1B6AA 3B73A 4NHJA 3IRQA 2FF4A 2DU9A 4UV8A 2HQRA 3SZTA 1ZARA 4M72A 2FU4A 1U78A 4WXCA 1T98A 4U0YA 2B0LA 2KIFA 2M87A 3L2CA 2GIVA 2QBYA 2Z33A 1FSHA 4KA4A 3ERED 4YG2F 3CTAA 1DPUA 4EQQA 5E17F 2GXGA 1HW2A 4BYYA 5L3BA 2PBIA 4MHGA 3WGGA 1FLIA 2VBYA 4QWQA 3FXQA 1FWZA 4LMYA 1KU2A 5E1ZB 5FB2A 5LHGA 3I58A 1R5HA 1KU7A 4HAMA 3ISPA 2RDPA 4IXAA 4RGXA 4A6EA 1SFEA 5E1WA 4CO8A 3EYYA 3EDPA 4LFUA 2DFIA 4PZJA 3HYIA 1XD7A 3FZVA 3TO7A 2ACJA 1H9TA 3LA2A 5LGTA 2FMLA 4UNOA 3VB2A 2JRTA 1LEAA 2PJPA 1U6GA 3FXRA 2HGCA 1O3SA 3KP5A 2Z3YA 3LSTA 2FQ3A 1R58A 3CO7C 3RPUA 1G3SA 3F8CA 3I71A 1KYZA 2XGXA 3M8FA 4KICA 2EV5A 2LNBA 3WU1B 2LF7A 5L3DA 2IRFG 4TV7A 2EWNA 2P5KA 2O6GE 4LLLA 4KT5C 1G3YA 4JBAA 2CQKA 1U5TB 1Z91A 1SAXA 4HZFA 4EM0B 1QNTA 3CO6C 1LDKB 4LLGF 4BNCA 2DQRA 2HZTA 2EFWA 2ELHA 1WSUA 1KU9A 4G7HF 1ZREA 4RB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IRH A;  1ZGA A;  1IN5 A;  3IKT A;  3CLO A;  2OD5 A;  3GW2 A;  2K4J A;  4IRI A;  2JPC A;  4RB3 C;  3DKW A;  1OMI A;  3PQJ A;  1IF1 A;  2BBY A;  5F64 A;  2JZY A;  3DV8 A;  3ULQ B;  3BZ6 A;  4RGR A;  1W5S A;  3U1D A;  1FBQ A;  3B02 A;  2QVO A;  3LFK A;  2FRH A;  3GEZ A;  3V8L A;  4EMS A;  2H09 A;  2P6S A;  1HKT A;  5FO5 A;  3MZH A;  4HX8 A;  5HLG A;  1OPC A;  4U7D A;  1LDD A;  2G7U A;  1YW8 A;  4OU0 A;  3DQV C;  2JT1 A;  2YU3 A;  3I0T A;  3KP6 A;  1J5Y A;  5E8I A;  3FMS A;  3ZQ7 A;  2NRA C;  2E7X A;  2HKO A;  2EA2 A;  3QOP A;  1XMA A;  1WWX A;  4WK8 F;  4Q47 A;  1I6X A;  3O6B B;  3J81 Z;  2GZW A;  2QM3 A;  3O2P E;  1LEB A;  1YG2 A;  3L09 A;  2ISY A;  2FBK A;  2VE9 A;  5ICF A;  1RI7 A;  4ASN A;  4XBF A;  1Q1H A;  5FD5 A;  1K7A A;  1YYV A;  1OKR A;  2K27 A;  1TTY A;  5H6R A;  2P5L C;  4A0Y A;  4FT8 A;  5BPD A;  3I53 A;  2IA0 A;  3MFK A;  2XAH A;  1SFX A;  2DK8 A;  1FNN A;  1O3T A;  2OZ6 A;  3T8T A;  1XSD A;  5DCM A;  2ZNY A;  3CUQ C;  3I59 A;  3I59 B;  3K2Z A;  1J2X A;  3KLN A;  4XSX F;  4O3M A;  1R36 A;  1JHF A;  1FPQ A;  5DD4 A;  4LK1 F;  4MQV A;  2L54 A;  2AXL A;  4M6Y A;  1P6R A;  3TOA A;  5D5U B;  2QUF A;  4IPA A;  4FHT A;  4HDU A;  3BDD A;  2P6T A;  3GZ6 A;  4EJW A;  1UB9 A;  3QP5 A;  5DCM B;  1XGS A;  1Z1D A;  2CWE A;  4HQM A;  5A2Q K;  2P8T A;  1Z7U A;  2HFH A;  2UWM A;  3M7G A;  4EV0 A;  1AOY A;  1WQ2 A;  4RAY A;  4UV9 A;  3LQQ A;  1SMY F;  5CLS A;  3LA7 A;  2BEO A;  3E6B A;  1RUN A;  4RGS A;  4M9S A;  3FF5 A;  1BOA A;  5L3C A;  3MWM A;  3FMQ A;  5HDN A;  4R1H A;  5JR3 A;  4E70 A;  3FM3 A;  2KJB A;  2ZNZ A;  4KYW A;  2Z5U A;  1Y0U A;  2R7F A;  2EA4 A;  2MBF A;  5HS8 A;  3FWE A;  2NAZ A;  2ZO4 A;  1XSX A;  4ZYE A;  1LJ9 A;  1FC3 A;  4KN7 X;  2F5D A;  3GZ5 A;  5FLX K;  3J80 K;  5LGU A;  1KYW A;  4U7B A;  2DAO A;  1XDU A;  2XKO A;  3ABT A;  4UXN A;  1QGP A;  2JTV A;  2H94 A;  2RV8 A;  4O5V A;  2KIM A;  3SZP A;  1T38 A;  3ZMU A;  1BI1 A;  4OIN F;  5K1Y A;  5IT9 K;  4BH9 A;  1BI3 A;  2ZCW A;  4HV5 A;  4KNY A;  1F1Z A;  5D8K B;  3IKV A;  3U9G A;  1KU3 A;  3D0S A;  1USS A;  4P9F A;  2OAZ A;  1TNS A;  1ZRF A;  4A6D A;  4GYG A;  2AS5 F;  2GAU A;  2A5Y B;  2RKH A;  3E6C C;  3HOS A;  4CGZ A;  1PP7 U;  2QBY B;  3TOB A;  4GYI A;  3DXJ F;  3TDZ C;  2FXA A;  1D3Y A;  4HOB A;  1RNL A;  4CZZ A;  1U3E M;  2DPU A;  3GUD A;  3H3Z A;  4LB5 A;  5F6F A;  1S7O A;  2GA2 A;  2F2E A;  4IF4 A;  1BI2 A;  2A68 F;  4ESJ A;  2W25 A;  1ZGJ A;  4IJA A;  4M74 A;  4XSZ F;  3F8M A;  4AD9 A;  1ZG5 A;  3C1D A;  2YSR A;  4ZYH A;  3MEX A;  2Z99 A;  4EGY A;  3HRT A;  2Y75 A;  5HDG A;  1B9M A;  4HX4 A;  1KQ0 A;  1SD4 A;  5TJJ A;  5E18 F;  2EFO A;  2HR3 A;  5L3E A;  1NHA A;  1L3L A;  1P4W A;  1I27 A;  3QPH A;  5ILS A;  5KVR A;  2XKP A;  3PQK A;  3K9T A;  5DDG A;  3BWG A;  2DQL A;  4B09 A;  3JTG A;  4KMF A;  3QAH A;  5E1X A;  4EM2 A;  5ERI A;  1B1B A;  2IVM A;  1YIO A;  3BP8 A;  3HUG A;  3RPQ A;  2CG4 A;  3KCC A;  2W84 A;  1J9I A;  2P5V A;  4L9T A;  2A69 F;  4L5I A;  3C18 A;  5J6X A;  4L9N A;  3QPT A;  3RKX A;  4CIC A;  3MCZ A;  3DPL C;  2M1B A;  3MZY A;  3GYH X;  4BHP A;  1FP1 D;  2STW A;  3KP4 A;  2IPQ X;  4RB2 C;  3WGH A;  4ENK A;  4HLX A;  4P9U A;  2D2W A;  4P5O A;  1HSJ A;  2MLK A;  4M6X A;  4Y17 A;  1D5V A;  3HHH A;  4KDP A;  2CYY A;  1Z6T A;  4WCG A;  2KJC A;  4ENJ A;  4A12 A;  1J0R A;  4UVA A;  2VN2 A;  2GQQ A;  3LAJ A;  1F5T A;  1YQA A;  3U2R A;  1EH7 A;  4G6Q A;  4G7O F;  2PLY A;  4N9H A;  2XAS A;  4UHT A;  3WTS C;  4BQA A;  2STT A;  1ZYR F;  3WTT C;  3FXU A;  3NRV A;  2K7L A;  1FOK A;  1XGM A;  3K69 A;  4ZH4 F;  3DFG A;  3SQN A;  2W24 A;  4L9V A;  5LLQ A;  3WTZ A;  1HBX G;  3NEU A;  2R3S A;  4UUV A;  1EH6 A;  4YII A;  2Y0M A;  3KZZ A;  5L3G A;  3HOT A;  3QRF F;  5K5R A;  3AAF A;  2C6Y A;  4AVP A;  3R0J A;  4I02 A;  2KIU A;  2OBP A;  3V7R A;  2XAG A;  3WE2 A;  2L4A A;  3HTS B;  2HEO A;  3V7S A;  3F6O A;  2E1C A;  2XAF A;  2HKX A;  3K0L A;  1ZHF A;  2LDU A;  2K02 A;  2HDC A;  2EK5 A;  1B9N A;  1IN6 A;  2RQP A;  3FHZ A;  1BC8 C;  4YFX F;  4NQW A;  1O3Q A;  1MKM A;  5FFX A;  4HF2 A;  2MH9 A;  5ILV A;  4HW0 A;  3WTV C;  4HLY A;  3LAP A;  2HWV A;  1HXD A;  2KKO A;  3RTR A;  1ZG1 A;  1GXQ A;  1W5T A;  3KLO A;  1LNW A;  3VFZ A;  2NNN A;  3M9A A;  4M71 A;  1S6L A;  4KMU X;  1K78 A;  4FX4 A;  1YLF A;  1FSE A;  1TW3 A;  3V7C A;  3KP2 A;  2VC1 A;  2VXZ A;  1OYY A;  1BIA A;  4CDG A;  2ZJ2 A;  1O57 A;  2F5E A;  3KE2 A;  3GWZ A;  5DUK A;  4OMZ A;  2JSC A;  1ON1 A;  4OOI A;  1OR7 A;  2X4H A;  5HOO A;  2HYF A;  5ICG A;  2MH2 A;  1T39 A;  6PAX A;  3GX4 X;  1DUX C;  1YS6 A;  2O3F A;  2BE5 F;  2VT3 A;  1WKM A;  3ECH A;  2QQB A;  3VOD A;  1YW7 A;  4LG0 A;  1Z6R A;  4MNU A;  1IUY A;  2P7C B;  3P9C A;  4HF0 A;  3IL2 A;  3WTU C;  4CHU A;  5BS6 A;  2ZBK A;  4QLC U;  2LKP A;  1FX7 A;  3HRM A;  4S04 A;  4LLN A;  4IVN A;  1IRG A;  3HHG A;  4OIO F;  1K78 B;  3C3W A;  4WXD A;  1HW5 A;  3OOP A;  3WTY C;  4M73 A;  3CUQ B;  4MQ9 F;  3T8R A;  3DF8 A;  1TLH B;  3IWZ A;  4KFC A;  2V1D A;  5LBQ A;  4GXO A;  3JAM Z;  2MA3 A;  2XRN A;  1XGO A;  3OV8 A;  4GCV A;  1ZG3 A;  4P96 A;  3SFZ A;  2A6H F;  4KUM A;  2PG4 A;  2H27 A;  2Y48 A;  4KN4 X;  3DPT A;  2RC4 A;  4UVB A;  4HQE A;  2MC3 A;  1R1U A;  4A0X A;  4U0V A;  5CYV A;  5JHU A;  3TGN A;  5JI6 A;  3E5Q A;  2FMY A;  1Z9C A;  3V4G A;  2FBI A;  3FMR A;  4RGU A;  3V8J A;  3RKY A;  1EH8 A;  2ZME B;  4M9Z A;  5IT9 Z;  2L4M A;  4K2E A;  3BJ6 A;  2ISZ A;  3CJN A;  3DP7 A;  1GVJ A;  5KK1 A;  3RJP A;  3I64 A;  3HSR A;  2M8E A;  2A07 F;  2QYO A;  2UXX A;  5LEJ A;  1FBS A;  2WV0 A;  2EV6 A;  4XLP F;  1CF7 A;  2DTR A;  3W6J B;  1FT9 A;  2X0L A;  1O3R A;  2PMH A;  2QEN A;  5BQT A;  3N97 A;  4MEY F;  2IA2 A;  2CFX A;  1I1S A;  2FE3 A;  2DBB A;  2RNJ A;  2CW0 F;  4WX9 A;  4ESB A;  2IJL A;  5TRD A;  2VOO A;  3SXY A;  2L3D A;  3T0Y A;  3LA3 A;  1ON2 A;  1WI9 A;  2BV6 A;  1XGN A;  2Q0O A;  2J5P A;  3ZP5 A;  1FZP B;  1SD5 A;  5HDK A;  3T1B A;  1SD7 A;  3K1P A;  1F9N A;  4EM1 A;  5D6F A;  1U5T C;  5D5W B;  1IZ1 A;  3GO5 A;  3K1M A;  3HSF A;  4RS8 A;  3L00 A;  4ENM A;  4I09 A;  2E7W A;  2UXN A;  1BBY A;  2L02 A;  1BN5 A;  2L01 A;  5BOX A;  4LD5 A;  4OMY A;  2PN6 A;  1W7P D;  3BOQ A;  5HLH A;  3L9F A;  1XN7 A;  1D8J A;  1DP7 P;  3KFW X;  2V9V A;  3R6S A;  3G73 A;  3RIR A;  3P9K A;  1IRF A;  3L7W A;  1G6N A;  3S2W A;  5ED4 A;  2O8X A;  1STZ A;  3KEO A;  3Q9S A;  3NQO A;  5J8C A;  1BIB A;  4HBL A;  4ZYG A;  1KA8 A;  4EJO A;  2YX7 A;  2HYG D;  4A0Z A;  2ESN A;  1XB4 A;  2CSO A;  3J7A O;  4G6D A;  4WWC A;  2HTJ A;  4WF2 A;  4LGW A;  3SHF A;  3ML6 A;  1Z05 A;  4L9J A;  4MEX F;  5EEH A;  3HRS A;  4ZYD A;  2NNY A;  4RAZ A;  1T0F A;  1HQC A;  3EUH A;  1TBX A;  5DEQ A;  4MGR A;  1FYK A;  4CYD A;  2NYX A;  1H0M A;  2A6E F;  2YX4 A;  2TDX A;  3EET A;  4AWX B;  2BYV E;  1IN4 A;  3QP6 A;  1LB2 A;  2RVC A;  1QZY A;  3QU3 A;  1FYL A;  1IN8 A;  2W57 A;  3KEQ A;  2WWY A;  4U0W A;  1X3U A;  3KET A;  1C0W A;  4HF1 A;  4BHB A;  1TQI A;  1KQ8 A;  1LQ1 A;  2RGV A;  2A3S A;  1P4A A;  5AIP A;  5J8F A;  1GXP A;  2VBX A;  4F7Z A;  3KP3 A;  4PGG A;  2O03 A;  5DD8 A;  1TQP A;  3WTX C;  1YO5 C;  4I7H A;  1B4A A;  1QPM A;  3C7J A;  1W7P A;  4AIH A;  1G3T A;  5EEG A;  3RYP A;  1S7A A;  3E3V A;  4H0E A;  5BPI A;  2EV0 A;  2FNP A;  5IT3 A;  1ZAO A;  2O0Y A;  2V1X A;  2XAJ A;  2H6C A;  1P4X A;  4G8X A;  5FGM A;  3N4M A;  3COA C;  4I0A A;  1IXC A;  3E6M A;  3J81 K;  5JFR A;  2VOP A;  1DDN A;  4KIF A;  4UVC A;  3M8E A;  4KIG A;  1IN7 A;  3REO A;  2KRF A;  2ZKZ A;  2XAQ A;  4L5J A;  1KQ9 A;  3TQN A;  3ROU A;  2E1N A;  3F72 A;  1SFU A;  3TKY A;  2QQA A;  3TDU C;  3WG9 A;  3GXO A;  4GGG A;  3RDI A;  3VEP A;  3IWF A;  3RI4 A;  2RN7 A;  1W7P B;  1XCB A;  1R7J A;  5LEK A;  3I5U A;  1U8R A;  3JTH A;  3WE3 A;  2PI0 A;  2WTE A;  3GFM A;  4G9Y A;  1UST A;  3QU6 A;  1P2F A;  1W4M A;  2HTS A;  4R79 A;  2XIG A;  2K4B A;  4Q4Z F;  4PCQ A;  2ESH A;  5E8G A;  4Y15 A;  5D4S A;  4MTE A;  2CO5 A;  1K6O A;  3F23 A;  4EJT A;  2VBW A;  1J59 A;  4XRF A;  3GLX A;  4Q48 A;  5HLI A;  1BC7 C;  2QWW A;  5A2Q Z;  4EJV A;  4JK1 X;  1JE8 A;  1UHW A;  1QQI A;  4GO1 A;  3J80 Z;  3HTU A;  1UFM A;  2FBH A;  1DPR A;  2COM A;  4BAY A;  1FY7 A;  3WTW C;  2M5W A;  4KIB A;  4L0Y B;  5AON A;  1F4K A;  1OYI A;  1D8K A;  3ABU A;  4PDK A;  1UHM A;  1BI0 A;  4R8H A;  1MJA A;  2OA4 A;  2XRO A;  1HKS A;  1RUO A;  1YTY A;  2UZK A;  3WGI A;  5LHI A;  3Q5F A;  3JAM K;  3BY6 A;  1O7L A;  3R4K A;  4G94 A;  1B59 A;  2XV4 S;  1KGS A;  2IA1 A;  1R1V A;  5CVJ A;  1PUE E;  3F21 A;  4AIJ A;  3E6D A;  3WOD F;  3G3Z A;  3HSE A;  2DLL A;  3P9I A;  2HQN A;  1JHH A;  2R7D A;  3GF2 A;  3BJA A;  1TW2 A;  1EV7 A;  2GWR A;  4LJZ F;  3H92 A;  5D5V B;  3F8F A;  4ZZD A;  2ZFW A;  3I54 A;  1BM9 A;  4BXU A;  5FD6 A;  3ZN0 A;  2MD5 A;  3ZMT A;  4BHC A;  1TNT A;  3KP7 A;  4ON0 A;  1ODD A;  5FFZ A;  5CVI A;  2VE8 A;  5DYM A;  3F8N A;  1ZLJ A;  1FP2 A;  4Y13 A;  3BPX A;  3WU0 A;  2MLG A;  4OIQ F;  2OU2 A;  4Z2Y A;  1LDJ A;  1YFH A;  2JPB A;  5K5O A;  5CJ9 A;  1O7F A;  1ZLK A;  1MJB A;  4FX0 A;  2OQG A;  1T6S A;  4CXF A;  2LSO A;  2M30 A;  2PFB A;  3FM5 A;  1J7K A;  3E5U A;  3K1N A;  4I98 B;  2F5C A;  1UCR A;  2DW4 A;  2FNA A;  1FYM A;  4Q5S F;  1SD6 A;  1MD0 A;  3R61 A;  5D6E A;  2QZ8 A;  3E97 A;  4A2U A;  4B8X A;  1T2K A;  1G3W A;  3CUO A;  4HA8 A;  5LHH A;  1FBU A;  2DPD A;  1S3J A;  2EB7 A;  2IW5 A;  5ICE A;  2XHK A;  2GA1 A;  2HOE A;  1CGP A;  2OQR A;  3JW4 A;  2EFN A;  2EJR A;  5DCF A;  2CGP A;  5CVU A;  1LVA A;  1HST A;  2NS0 A;  1YW9 A;  4OIR F;  4P55 A;  4JQF A;  5HS7 A;  1MZB A;  1S8N A;  4M9X A;  1V4R A;  4MTD A;  3D5L A;  3JSP A;  3BPV A;  3F22 A;  1S29 A;  4WXH A;  2ZME A;  4O6J A;  4U88 A;  1R23 A;  4D0P A;  4YFN F;  2G7H A;  1G4D A;  4LB6 B;  5H6Q A;  2WC2 A;  3MQ0 A;  1QZZ A;  2YR2 A;  2ZXJ A;  2VBZ A;  1HKQ A;  1JGS A;  3GFJ A;  2VOD A;  5HVQ C;  1QBJ A;  5ILU A;  1P92 A;  4XLN F;  4RB1 A;  2BGC A;  1U2W A;  1BJA A;  1J75 A;  3ZN1 A;  4YIF A;  3CUQ A;  3GVA A;  5LRR A;  1MGT A;  2EFP A;  3BRO A;  1AWC A;  1REP C;  2HS5 A;  3FX3 A;  5AIQ A;  2EFQ A;  2ETH A;  2LF8 A;  2D1H A;  2XVC A;  4AIK A;  5DV5 A;  1YS7 A;  4I0B A;  1SMT A;  3IHU A;  3HIF A;  1ONV A;  3O3K A;  3RYR A;  5D5X B;  2OZU A;  1R5G A;  2D1V A;  1XSV A;  4ENN A;  4ZZL A;  2W85 A;  2DO7 A;  3M1E A;  3R60 A;  4HV6 A;  2VT2 A;  2YPR A;  3HRU A;  5CVR A;  1H9G A;  3ZMS A;  3EYI A;  2K86 A;  1RZ4 A;  4ESF A;  2P7V B;  4HYE A;  3GFL A;  1MJ9 A;  4IHT A;  2Q8K A;  3LQR A;  4N0B A;  3BJO A;  3H3U A;  1VTN C;  4A5N A;  2V1U A;  1PDN C;  2IP2 A;  1ZH5 A;  1A04 A;  4S05 A;  4HX7 A;  3IRR A;  4A5M A;  4L18 B;  3V8K A;  4I2O A;  4G7Z F;  4EJU A;  2GXB A;  1IAW A;  3TO9 A;  1RIO H;  3MAJ A;  1V3F A;  1I5Z A;  4EGZ A;  3ZMZ A;  5D4R A;  2F5F A;  4YFK F;  3PFI A;  2DK5 A;  5DUI A;  5BMZ A;  3EQL F;  1XDS A;  3ELK A;  1E2X A;  4DNC A;  4EVI A;  1IXR C;  4L0Z B;  4HDV A;  1ZN2 A;  1JXS A;  1MDM B;  2J5O A;  5D8L B;  2FA5 A;  1K79 A;  2VC0 A;  4N9I A;  3ECO A;  3W6K B;  2ADU A;  1GHC A;  5L3F A;  3R0A A;  2DI3 A;  3KZY A;  1PP8 F;  4LK0 F;  2P4W A;  5K5Q A;  1ULY A;  3P7N A;  4NB5 A;  2PEX A;  1WRJ A;  1IW7 F;  1R1T A;  2XUB A;  4IHS A;  1XCV A;  2FEZ A;  3IC7 A;  5ICC A;  3TO6 A;  1CF7 B;  2FSW A;  4IRG A;  2O61 A;  2V79 A;  1U5T A;  5HS9 A;  3F3X A;  4OIP F;  5JVT A;  2D45 A;  1R00 A;  4PGH A;  1QO0 D;  4LG0 B;  2QQ9 A;  2PQ8 A;  1I1G A;  5FLX Z;  2IT0 A;  1E17 A;  3Q9V A;  1OYW A;  2G9W A;  1TQM A;  3VOE A;  3I4P A;  2Q2E A;  2V6C A;  2A61 A;  3ZMD A;  3GFI A;  3RKW A;  4ETS A;  5LRS A;  1ZRC A;  3ZPL A;  3LWF A;  2Z9O A;  3CDH A;  2H6B A;  1IXS B;  4DQ2 A;  5CVV A;  2M45 A;  5E20 A;  2PMU A;  5H20 A;  1MDM A;  1HW1 A;  3JSO A;  3F6V A;  1XMK A;  1R22 A;  2QLZ A;  2VON A;  3E5X A;  3ZMV A;  4I01 A;  3T5X A;  1ZRD A;  5F1R A;  1L0O C;  5LGN A;  2DT5 A;  3DEU A;  2FOK A;  3F8B A;  1B6A A;  3B73 A;  4NHJ A;  3IRQ A;  2FF4 A;  2DU9 A;  4UV8 A;  2HQR A;  3SZT A;  1ZAR A;  4M72 A;  2FU4 A;  1U78 A;  4WXC A;  1T98 A;  4U0Y A;  2B0L A;  2KIF A;  2M87 A;  3L2C A;  2GIV A;  2QBY A;  2Z33 A;  1FSH A;  4KA4 A;  3ERE D;  4YG2 F;  3CTA A;  1DPU A;  4EQQ A;  5E17 F;  2GXG A;  1HW2 A;  4BYY A;  5L3B A;  2PBI A;  4MHG A;  3WGG A;  1FLI A;  2VBY A;  4QWQ A;  3FXQ A;  1FWZ A;  4LMY A;  1KU2 A;  5E1Z B;  5FB2 A;  5LHG A;  3I58 A;  1R5H A;  1KU7 A;  4HAM A;  3ISP A;  2RDP A;  4IXA A;  4RGX A;  4A6E A;  1SFE A;  5E1W A;  4CO8 A;  3EYY A;  3EDP A;  4LFU A;  2DFI A;  4PZJ A;  3HYI A;  1XD7 A;  3FZV A;  3TO7 A;  2ACJ A;  1H9T A;  3LA2 A;  5LGT A;  2FML A;  4UNO A;  3VB2 A;  2JRT A;  1LEA A;  2PJP A;  1U6G A;  3FXR A;  2HGC A;  1O3S A;  3KP5 A;  2Z3Y A;  3LST A;  2FQ3 A;  1R58 A;  3CO7 C;  3RPU A;  1G3S A;  3F8C A;  3I71 A;  1KYZ A;  2XGX A;  3M8F A;  4KIC A;  2EV5 A;  2LNB A;  3WU1 B;  2LF7 A;  5L3D A;  2IRF G;  4TV7 A;  2EWN A;  2P5K A;  2O6G E;  4LLL A;  4KT5 C;  1G3Y A;  4JBA A;  2CQK A;  1U5T B;  1Z91 A;  1SAX A;  4HZF A;  4EM0 B;  1QNT A;  3CO6 C;  1LDK B;  4LLG F;  4BNC A;  2DQR A;  2HZT A;  2EFW A;  2ELH A;  1WSU A;  1KU9 A;  4G7H F;  1ZRE A;  4RB0 A; 
#chains in the Genus database with same CATH topology
 4IRH A;  3UR3 C;  1ZGA A;  3IH4 A;  1IN5 A;  1F36 A;  3IKT A;  3CLO A;  2OD5 A;  2DMT A;  2HYJ A;  3GW2 A;  2K4J A;  4IRI A;  2JPC A;  4RB3 C;  1SFK A;  2DDB A;  4B3A A;  4XRS A;  1GT0 C;  2MC4 A;  3BR1 A;  3OR1 C;  4Y7N J;  2LY2 A;  3FKI J;  3DKW A;  1GV5 A;  1J09 A;  1OMI A;  3PQJ A;  1IF1 A;  2BBY A;  5F64 A;  3RQ4 A;  2JZY A;  3DV8 A;  3ULQ B;  3BZ6 A;  4A3C J;  1YE9 A;  4RGR A;  1X58 A;  1W5S A;  3U1D A;  3CCS I;  1FBQ A;  5FKN A;  3L1P A;  2M0C A;  3QPS A;  2Z16 A;  3B02 A;  3PUB A;  2HQ5 A;  1Y0N A;  1QU3 A;  2QVO A;  3IUO A;  3LFK A;  1JI8 A;  3AFH A;  4BXF A;  2FRH A;  2JUG A;  2Y2Z A;  3GEZ A;  5KCM A;  1WJ5 A;  2CUJ A;  3V8L A;  4XOP A;  5EZH A;  5HOD A;  4ZJZ A;  4BDY A;  2WAQ N;  3EUA A;  4EMS A;  3K6G A;  3L2Q A;  2H09 A;  3M8J A;  2P6S A;  4YRV A;  4LIV A;  2F4O B;  1HKT A;  3LL7 A;  5FO5 A;  4BL0 B;  3MZH A;  4HX8 A;  5HLG A;  2KQR A;  1MSF C;  1OPC A;  4U7D A;  2R7T A;  1LDD A;  2G7U A;  1YW8 A;  4OU0 A;  3K10 A;  1D0Y A;  2ZME C;  3DQV C;  1OLT A;  2JT1 A;  2YU3 A;  3I0T A;  4RLQ A;  1T56 A;  3KP6 A;  2M7A A;  1J5Y A;  5E8I A;  3FMS A;  2DOE A;  3ZQ7 A;  4OAZ A;  2NRA C;  3BC8 A;  4JX6 A;  2E7X A;  2HKO A;  2EA2 A;  3QOP A;  3G71 I;  3TBI A;  1XMA A;  1WWX A;  4WK8 F;  4B4C A;  5GAG J;  3TW6 A;  4AU7 A;  4Q47 A;  1I6X A;  4HNT A;  3O6B B;  3S16 J;  3J81 Z;  2GZW A;  3G2B A;  1SVM A;  3PNV A;  2QM3 A;  3O2P E;  4XMY A;  1LEB A;  3M3Y J;  2OC6 A;  1YG2 A;  3L09 A;  2LG4 A;  3FBI B;  2ISY A;  2XPW A;  1JKR C;  4BQN A;  1JUM A;  1R4M B;  4I99 C;  3OYK A;  2FBK A;  3KYD B;  3CJR B;  5ICF A;  2VE9 A;  4IO9 F;  1RI7 A;  2OF7 A;  4ASN A;  2G0E A;  3HJE A;  4XBF A;  1Q1H A;  4GRI A;  2EIM H;  5FD5 A;  1R71 A;  1K7A A;  1YYV A;  1OKR A;  2K27 A;  1TTY A;  4IL6 C;  4ZDL A;  5H6R A;  2P5L C;  2XSJ C;  4BQQ A;  4A0Y A;  4FT8 A;  5BPD A;  3CDL A;  3ABL H;  3I53 A;  2IA0 A;  3MN2 A;  3MFK A;  3O8H A;  2XAH A;  1SFX A;  1Z77 A;  2DK8 A;  2K3P A;  1FNN A;  1O3T A;  2OUM A;  2GIZ A;  2OZ6 A;  1VQ8 I;  3T8T A;  1XSD A;  2ME0 A;  5DCM A;  4XLC A;  2ZNY A;  4ITV A;  3CUQ C;  3I59 A;  4EEF G;  5C3E J;  3TMO A;  3K4B A;  3I59 B;  1LUJ B;  4IHW A;  3TW7 A;  3K2Z A;  2PJR B;  1J2X A;  3S3O A;  2CFO A;  3KLN A;  4ANJ A;  4XLF A;  4XSX F;  4QSH A;  1R36 A;  4O3M A;  1JHF A;  1FPQ A;  2W7N A;  1X1C A;  2X6Y A;  2R0Q C;  5DD4 A;  1MBK A;  4LK1 F;  1TT5 B;  4AC0 A;  1FJL A;  4MQV A;  2L54 A;  4Y3O A;  2A6T A;  2AXL A;  4M6Y A;  1P6R A;  1OCP A;  3TOA A;  5D5U B;  2QUF A;  4IPA A;  2HXI A;  4FHT A;  5HLT A;  2DA7 A;  4HDU A;  3BDD A;  2P6T A;  3GZ6 A;  4EJW A;  1UB9 A;  1ZEL A;  3QP5 A;  2XB0 X;  5DCM B;  4A3J J;  5TIS C;  5GAE J;  1XGS A;  2YUS A;  3OYH A;  1Z1D A;  2CWE A;  3S8P A;  4H4K C;  3HGY A;  4HQM A;  5A2Q K;  2P8T A;  1NG7 A;  1Z7U A;  1A6I A;  2HFH A;  3KX2 A;  2B9S A;  3ONQ A;  3BLY A;  2UWM A;  3M7G A;  5F0F A;  2O9L A;  2LP0 A;  4DJA A;  1U8B A;  1B8I B;  4QPO A;  5DS9 A;  4EV0 A;  2R7Z J;  3HEF A;  1WQ2 A;  1AOY A;  4RAY A;  2ZJR F;  2Z2S B;  4UV9 A;  3LQQ A;  1SMY F;  1WH5 A;  3QOD A;  2EZI A;  1QVT A;  3LA7 A;  5CLS A;  2BEO A;  3CJQ B;  1RR8 C;  4PSX A;  3E6B A;  1RUN A;  4RGS A;  2V4J C;  1QPI A;  4M9S A;  1O4X A;  1A31 A;  3FF5 A;  1PVE A;  3ASN H;  1BOA A;  5L3C A;  3MWM A;  2L5Q A;  3FMQ A;  3OL3 A;  5HDN A;  2E5N A;  4BE2 A;  4R1H A;  5JR3 A;  4AM3 A;  4E70 A;  3SJM A;  3FM3 A;  2KJB A;  2ZNZ A;  1TP4 A;  4KYW A;  2Z5U A;  1Y0U A;  3H1C A;  2IBD A;  2R7F A;  1I6H J;  2EA4 A;  2MBF A;  5HS8 A;  3I55 I;  3ZQI A;  3FWE A;  2Y69 H;  2NAZ A;  2XF6 A;  2ZO4 A;  4M3B A;  1I50 J;  1XSX A;  4ZYE A;  1KZH A;  1LJ9 A;  1FC3 A;  4KN7 X;  2F5D A;  3GZ5 A;  3ZGK A;  1LKX A;  5FLX K;  3J80 K;  2DMP A;  5LGU A;  5EZG A;  1KYW A;  2Y9Z A;  4U7B A;  1IJW C;  1XDU A;  2DAO A;  2RAE A;  2XKO A;  3OSG A;  3ABT A;  4UXN A;  1QGP A;  5M3F J;  2JTV A;  2W48 A;  1JT6 A;  2H94 A;  2LYC A;  2RV8 A;  1V5E A;  3I4M J;  4O5V A;  3ZQG A;  2KIM A;  2VLA A;  3RQI A;  3SZP A;  4F92 B;  1T38 A;  3S1Q J;  4DIQ A;  1W36 C;  3ZMU A;  1Z7L A;  2LFB A;  1BI1 A;  4OIN F;  3ZRG A;  5K1Y A;  1JTY A;  2QEX I;  5IT9 K;  1G59 A;  2Y9Y A;  4BH9 A;  4BS9 A;  3DBH B;  1BI3 A;  5M5Y J;  2ZCW A;  3PFY A;  3S1N J;  4HV5 A;  4KNY A;  2LMD A;  1F1Z A;  3TL4 X;  2YS9 A;  5D8K B;  2X6W A;  3OS2 A;  3IKV A;  1K6Y A;  3U9G A;  1KU3 A;  2XRL A;  3D0S A;  3OYN A;  1USS A;  4P9F A;  2OAZ A;  1TNS A;  2YU9 J;  4X1E A;  1ZRF A;  4B48 A;  4A6D A;  2CU7 A;  3H35 A;  4GYG A;  2AS5 F;  2GAU A;  4RA2 A;  4HPQ A;  1AKH B;  2A5Y B;  2RKH A;  5IP6 A;  3E6C C;  4I6Z A;  3HOS A;  1X3W B;  3CMA I;  3G1L A;  4CGZ A;  5IY5 H;  2MFZ A;  1IO2 A;  1PP7 U;  2IGN A;  2R7R A;  1HA8 A;  2LRE A;  3JRD A;  2QBY B;  3TOB A;  1ENH A;  2K9M A;  3H3V K;  1A5J A;  1DQU A;  4GYI A;  3DXJ F;  1DGR M;  4PFP A;  3TDZ C;  3AL0 C;  5IP7 J;  2FXA A;  4IHY A;  1D3Y A;  4HOB A;  1F43 A;  1RNL A;  4CZZ A;  3MD2 A;  1U3E M;  2DPU A;  3GUD A;  3H3Z A;  4LB5 A;  5F6F A;  1S7O A;  3HOZ J;  2EIN H;  2GA2 A;  2F2E A;  4IF4 A;  1BI2 A;  2CS3 A;  3OS0 A;  2EIL H;  2A68 F;  2OCC H;  4ESJ A;  2W25 A;  4XK4 A;  1WJC A;  1JUP A;  1ZGJ A;  4NNJ A;  4IJA A;  4M74 A;  4XSZ F;  3F8M A;  1E3O C;  2XC7 A;  4AD9 A;  1ZG5 A;  5C4X J;  2XDV A;  3K4L A;  1ACI A;  3C1D A;  3Q3S A;  3K4M A;  3LSI A;  2YSR A;  4ZYH A;  3MKL A;  1WPK A;  3CLQ A;  2WBM A;  1B72 A;  1ETO A;  2Q1Z B;  2MAB A;  3MEX A;  2VPL A;  5B1A H;  2Z99 A;  4EGY A;  3HRT A;  2Y75 A;  5HDG A;  2KFD A;  1B9M A;  4HX4 A;  1KQ0 A;  3QYF A;  3S2H J;  3GLL A;  1SD4 A;  3JRE A;  2I8D A;  3BTJ A;  5TJJ A;  3RZO J;  5E18 F;  2EFO A;  1MH3 A;  2HR3 A;  1XS9 A;  2PJR A;  5L3E A;  1NHA A;  3SYT A;  3W2V A;  5FRO A;  2CW8 A;  1R9T J;  2V9K A;  2LRD A;  1L3L A;  1P4W A;  1I27 A;  3QPH A;  2XB5 A;  5ILS A;  5KVR A;  2XKP A;  1DU6 A;  3PQK A;  3K9T A;  5DDG A;  3WHC A;  2HDD A;  3BWG A;  2F6C A;  2GOX B;  2MYS A;  2DQL A;  4B09 A;  3JTG A;  1OCZ H;  1Y8R B;  4KMF A;  3QAH A;  3H0D A;  1UJ8 A;  5E1X A;  3QYB A;  1UHS A;  2E2J J;  3HL2 A;  3CCU I;  4EM2 A;  3BR0 A;  3CC7 I;  5ERI A;  1W36 D;  2IXS A;  1WFX A;  3RZD J;  1B1B A;  2DCE A;  2IVM A;  1YIO A;  3BP8 A;  5CQE A;  4C2T A;  3HUG A;  4BKX A;  3HDD A;  1W1W E;  2R7W A;  2CUE A;  3RPQ A;  5B3S H;  2LD5 A;  3VYR B;  2CG4 A;  3Q0W A;  1HCR A;  1DU0 A;  3KCC A;  2IS6 A;  2W84 A;  3QQA A;  1J9I A;  2P5V A;  4L9T A;  2A69 F;  4N4O B;  4J01 A;  4L5I A;  3C18 A;  5J6X A;  2E2H J;  1RKT A;  4L9N A;  3QPT A;  3RKX A;  4CIC A;  3MCZ A;  2E35 A;  5J4V A;  2ID6 A;  3DPL C;  2M1B A;  3MZY A;  3ZQL A;  3GYH X;  3HPG A;  2VQC A;  4BHP A;  1FP1 D;  1MBJ A;  1ZKG A;  2STW A;  3KP4 A;  1S5L C;  2IPQ X;  2XF5 A;  3EUH C;  4CCK A;  3HM5 A;  4RB2 C;  2E71 A;  3LSR A;  3WGH A;  1JKO C;  4ENK A;  1ZR4 A;  1QVU A;  3DTI A;  4HLX A;  4P9U A;  4F52 A;  2D2W A;  4DGW B;  4P5O A;  2AO9 A;  1HSJ A;  3JRF A;  3B6C A;  2MLK A;  4G6T B;  4M6X A;  4Y17 A;  1D5V A;  3W2A A;  3HHH A;  4KDP A;  3S15 J;  2CYY A;  1Z6T A;  4WCG A;  2CQX A;  1EKE A;  2KJC A;  3S2D J;  4ENJ A;  2DOD A;  4A12 A;  3FIS A;  1J0R A;  1VQ4 I;  4UVA A;  2NOG A;  2VN2 A;  2GQQ A;  3LAJ A;  4M6V A;  1TWH J;  1RR7 A;  1F5T A;  2UUZ A;  3SZG A;  1YQA A;  4CCL A;  3U2R A;  4RM3 A;  1EH7 A;  2EQR A;  4G6Q A;  2K9Q A;  4G7O F;  3CQZ J;  5EJC A;  2PLY A;  4N9H A;  4RBO A;  2XAS A;  4UHT A;  3AG4 H;  3WTS C;  4BQA A;  1TWG J;  2STT A;  1ZYR F;  5IOY A;  3DTE A;  4IQ4 A;  4DYR A;  4Y52 J;  3WTT C;  1TWC J;  4FE4 A;  3OMY A;  3FXU A;  3NRV A;  2K7L A;  1FOK A;  1XGM A;  3K69 A;  4ZH4 F;  3DFG A;  3SQN A;  2W24 A;  4L9V A;  2KDZ A;  4MO7 A;  5LLQ A;  3WTZ A;  1HBX G;  4NC8 A;  1TT0 A;  2R3S A;  3NEU A;  1N75 A;  3WU2 C;  4UUV A;  1EH6 A;  4YII A;  2Y0M A;  3KZZ A;  4RM2 A;  5L3G A;  3HOT A;  2DMQ A;  3QRF F;  3PSI A;  5K5R A;  1W5C C;  2L7Z A;  5CPR B;  4DYC A;  4KIT B;  4G12 A;  3BZC A;  3AAF A;  2C6Y A;  4AVP A;  3R0J A;  1R4N B;  2VKE A;  3AKZ A;  3DKY A;  1TL8 A;  1LFU P;  4I02 A;  2L9V A;  2KIU A;  2OBP A;  1QHH D;  3FIW A;  3V7R A;  3MKY B;  2XAG A;  3WE2 A;  3CCE I;  4PJL A;  1BJZ A;  2L4A A;  3HTS B;  4XKW A;  2ICW G;  5DTD A;  2HEO A;  3GME A;  3V7S A;  2LR8 A;  4RAF A;  3F6O A;  1IC8 A;  1PYV A;  1ERD A;  3GTK J;  1U9O A;  2IEK A;  5F04 A;  2E1C A;  2XAF A;  2HKX A;  4J00 A;  3K0L A;  1Z3X A;  2ELJ A;  1WHU A;  1ZHF A;  2LDU A;  4BAC A;  3H5A A;  2K02 A;  4A3K J;  2R5Y A;  2EK5 A;  2HDC A;  1B9N A;  1IN6 A;  4XKB A;  1VQM I;  1N78 A;  2RQP A;  3FHZ A;  1BC8 C;  1FIP A;  3HBL A;  4YFX F;  4NQW A;  1CQT A;  1O3Q A;  1MKM A;  4CCO A;  2CV2 A;  5FFX A;  4HF2 A;  1ETX A;  2DOA A;  2MH9 A;  3H36 A;  5ILV A;  4HW0 A;  1Y6I A;  4PK4 A;  2VPR A;  2KZV A;  2IGO A;  3WTV C;  3OYL A;  1UEL B;  4MIM A;  4D7N A;  4HLY A;  3LAP A;  2R7S A;  2HWV A;  2VJJ A;  1IRX A;  4W1U A;  1HXD A;  2COB A;  2XPV A;  2KKO A;  5E3L A;  5IP9 J;  3RTR A;  1ZG1 A;  3C2B A;  2VJ5 A;  3F9K A;  2I5U A;  5H2F C;  4UB8 C;  2WAE A;  1GXQ A;  1W5T A;  3KLO A;  1LNW A;  4M3G A;  3VFZ A;  2NNN A;  3M9A A;  2V6E A;  4M71 A;  1S6L A;  4D9J A;  4QTR A;  3LSH A;  2KIQ A;  4KMU X;  5J4Y A;  1K78 A;  4FX4 A;  3K7A J;  4EAT A;  1YLF A;  4CUG A;  4C3H J;  1FSE A;  1TW3 A;  3V7C A;  1H88 C;  3KP2 A;  3RKQ A;  2VC1 A;  2VXZ A;  1OYY A;  2EBI A;  1BIA A;  2RQQ A;  2L2O A;  4CDG A;  3MKZ A;  3CME I;  2ZJ2 A;  1O57 A;  2EZK A;  2F5E A;  3K2A A;  3KE2 A;  3GWZ A;  5DUK A;  2VXD A;  4OMZ A;  2JSC A;  3OL4 A;  1BR4 A;  1ON1 A;  4OOI A;  1OR7 A;  5FKL A;  4KIS A;  5EGO A;  4XIC A;  4ZC3 A;  2X4H A;  2KIS A;  5B66 C;  2R93 J;  5HOO A;  4RLF A;  2HYF A;  5ICG A;  2AQF A;  3EPZ A;  4M3E A;  5BNG A;  3FHN A;  2MH2 A;  1T39 A;  3N05 A;  6PAX A;  3ZQC A;  2BZT A;  3M07 A;  3KZI C;  3GX4 X;  3CC2 I;  2HI3 A;  1DUX C;  4E7J A;  3DLA A;  1YS6 A;  5EG0 A;  1MH4 A;  2M34 A;  2O3F A;  2BE5 F;  2VT3 A;  1WKM A;  3ECH A;  4XLH A;  2QQB A;  3VOD A;  4E7H A;  1BW6 A;  1YW7 A;  4LG0 A;  1Z6R A;  3DU5 A;  4DOZ A;  4MNU A;  1SAN A;  2DMU A;  1IUY A;  2LBF A;  2P7C B;  5J3L A;  3P9C A;  4CCN A;  2JVG A;  4HF0 A;  3SEZ A;  3IL2 A;  1ZQ3 P;  3WTU C;  4CHU A;  5BS6 A;  2ZBK A;  4CSW A;  4QLC U;  2LKP A;  1FX7 A;  3HRM A;  4S04 A;  4LLN A;  4IVN A;  1IRG A;  3HHG A;  1RET A;  3OIQ A;  2BVM A;  4OIO F;  2JN6 A;  1K78 B;  2DN0 A;  1W0U A;  3C3W A;  4IKF A;  4WXD A;  4XR6 A;  4U87 A;  1HW5 A;  3OOP A;  3WTY C;  4M73 A;  2R7X A;  3CUQ B;  1FOY A;  3KYC B;  4MQ9 F;  3T8R A;  2O8K A;  3AG3 H;  3DF8 A;  1P7J A;  5F08 A;  1TLH B;  3IWZ A;  4KFC A;  2GXA A;  3HPH A;  3DBR B;  2V1D A;  5LBQ A;  4GXO A;  3JAM Z;  4NBQ A;  2F5V A;  5JLW A;  2MA3 A;  2XRN A;  4FQG A;  1XGO A;  3OV8 A;  1FOW A;  1OCC H;  4GCV A;  1ZG3 A;  4P96 A;  3GTM J;  2EZL A;  3SFZ A;  2DMN A;  3VDX A;  2A6H F;  1MNE A;  4KUM A;  2PG4 A;  2H27 A;  2DFH A;  3VPR A;  3JRC A;  2Y48 A;  4E7I A;  4KN4 X;  3DPT A;  5TGT A;  2RC4 A;  4UVB A;  4HQE A;  2MC3 A;  1B8I A;  1R1U A;  4V19 K;  1HDP A;  4A0X A;  4U0V A;  5CYV A;  4F91 B;  4JOM A;  5LD2 C;  2CQ7 A;  3QYE A;  5GAH J;  1LFP A;  5JHU A;  2DT7 B;  2HU9 A;  3TGN A;  2R92 J;  2QQ8 A;  1ZK8 A;  4A3D J;  5JI6 A;  3E5Q A;  1BR2 A;  2FMY A;  4HEA 2;  1Z9C A;  3W3C A;  5IYB J;  3V4G A;  4XRS G;  2FBI A;  3FMR A;  4RGU A;  3V8J A;  2KPM A;  5IPA A;  2X85 A;  3RKY A;  1EH8 A;  2ZME B;  1X2N A;  2PMZ A;  4M9Z A;  5IT9 Z;  2L4M A;  3OYM A;  4K2E A;  3ZXS A;  2HOT A;  2BW3 A;  1WZ2 A;  3BJ6 A;  3K4C A;  2ISZ A;  4FCY A;  2DA1 A;  3CJN A;  3CCY A;  3DP7 A;  4HRI A;  3BTL A;  1GVJ A;  3OR2 C;  5KK1 A;  4E7S A;  2BY2 A;  3RJP A;  3I64 A;  1APL C;  3HSR A;  1V54 H;  2M8E A;  4E6K G;  2A07 F;  2QYO A;  2IS1 A;  2UXX A;  2DFF A;  1M1E B;  2KRC A;  1FBS A;  2WV0 A;  5LEJ A;  5FKM A;  2EV6 A;  1H89 C;  4XLP F;  2VIX A;  2HOA A;  3MMY B;  2R5Z B;  3HC7 A;  1ITY A;  2E1O A;  3TED A;  4CCM A;  2DA2 A;  3BR3 A;  2ZSI B;  2NVT J;  2W00 A;  4V2F A;  4A3F J;  1CF7 A;  2DTR A;  3W6J B;  2HDW A;  1FT9 A;  4RMN A;  2X0L A;  1O3R A;  4IHV A;  4YIR X;  1RPW A;  2PMH A;  2QEN A;  5BQT A;  3VYS B;  2LTP A;  3H0G J;  3N97 A;  2D5V A;  1BR1 A;  4MEY F;  1HDD C;  2DXI A;  2IA2 A;  2CFX A;  3A4C A;  3GBG A;  3J7A Y;  2NS7 A;  1I1S A;  2FE3 A;  2I10 A;  1P9Q C;  4B43 A;  2DBB A;  2RNJ A;  2HNH A;  1OCO H;  2EH3 A;  1U9N A;  2CW0 F;  4WX9 A;  4ESB A;  2IJL A;  3QWL A;  5TRD A;  2VOO A;  2ZJP F;  3SXY A;  2L3D A;  3T0Y A;  1JKQ C;  1HC8 A;  3LA3 A;  5M5W J;  1BL0 A;  1IDY A;  1ON2 A;  3NWT A;  4E7Z A;  4A3L J;  1WI9 A;  2DYR H;  2BV6 A;  1XGN A;  4A69 C;  2Z1D A;  2Q0O A;  1V5G A;  2J5P A;  2QKM B;  4D7M A;  3ZP5 A;  2X6O A;  3BG9 A;  3L2R A;  4UUS A;  9ANT A;  1FZP B;  1T95 A;  1SD5 A;  5HDK A;  4X0G A;  5CQG A;  1T33 A;  4Y4R A;  3T1B A;  1SD7 A;  1LVK A;  3K1P A;  1AA7 A;  1F9N A;  4EM1 A;  5D6F A;  1PJR A;  1U5T C;  2LKX A;  1JT0 A;  4PSW A;  5D5W B;  1E3P A;  1IZ1 A;  2RRE A;  4IX7 A;  3GO5 A;  1BW5 A;  3K1M A;  3HSF A;  4RS8 A;  3A1Y A;  3L00 A;  2CV1 A;  4ENM A;  2OV7 A;  2HPI A;  2UXN A;  2E7W A;  4I09 A;  4BE1 A;  2QGU A;  3CCQ I;  1X1B A;  4MFD A;  1BBY A;  2L02 A;  4M3F A;  1BN5 A;  2L01 A;  2JA6 J;  5BOX A;  4LD5 A;  4OMY A;  2PN6 A;  3OYD A;  3OSF A;  3ZOB A;  3TP0 A;  1W7P D;  3CCM I;  3OYI A;  3BOQ A;  5K7F A;  2X1C A;  3L9F A;  5HLH A;  1A35 A;  1XN7 A;  2O5R A;  4BUP A;  1TC3 C;  1D8J A;  1MBF A;  1DP7 P;  2K9L A;  2BXY A;  2WA0 A;  3KFW X;  3UNG C;  2V9V A;  3R6S A;  3G73 A;  3H9G A;  3RIR A;  3P9K A;  2LKS A;  2V9P A;  1IRF A;  3L7W A;  2DOF A;  4AUX A;  3LNQ A;  3FXM A;  1G6N A;  3S2W A;  1V5F A;  5ED4 A;  5K7H A;  2O8X A;  5IYC J;  1STZ A;  3KEO A;  3Q9S A;  3S3N A;  2E5Z A;  1Z67 A;  3NQO A;  5J8C A;  1BIB A;  1MIJ A;  1VQO I;  2QSH X;  3GTO J;  4HBL A;  4ZYG A;  2R5Y B;  5F27 A;  2QCO A;  1SAU A;  2GBY A;  1XMX A;  1KA8 A;  4EJO A;  3TP3 A;  2YX7 A;  1UG2 A;  3DTK A;  2HYG D;  4A0Z A;  2ESN A;  3J7Y J;  1XB4 A;  2CSO A;  3J7A O;  5IYD J;  4G6D A;  2DA4 A;  3HKZ A;  4WWC A;  2HTJ A;  4WF2 A;  4LGW A;  3BTI A;  3SHF A;  3ML6 A;  1Z05 A;  3G4S I;  1SFO J;  5M5X J;  4L9J A;  4MEX F;  3HOV J;  5EEH A;  3HRS A;  4DBR A;  3B6A A;  4ZYD A;  3A02 A;  2NNY A;  4RAZ A;  3W2W A;  1T0F A;  1MMG A;  1TWA J;  5EEA A;  1HQC A;  4PUS A;  3EUH A;  4FET A;  1TBX A;  5DEQ A;  2WAD A;  4MGR A;  2H1L A;  1FYK A;  4CYD A;  2NYX A;  2DA5 A;  1H0M A;  2A6E F;  2H8R A;  1VQK I;  3CCJ I;  2YX4 A;  2TDX A;  2XGC A;  3BG6 A;  3EET A;  1W0T A;  4AWX B;  2BYV E;  2NVX J;  1IN4 A;  3LSP A;  4DZP A;  3QP6 A;  4II2 A;  1YIT I;  1LB2 A;  4CZC A;  2DA6 A;  2RVC A;  3ZQQ A;  1QZY A;  3ESW B;  5HNF A;  3K70 C;  3P5J A;  3QU3 A;  1FYL A;  1IN8 A;  2W57 A;  3CMY A;  3KEQ A;  2WWY A;  4U0W A;  3S3M A;  4NUB A;  1X3U A;  3D5S C;  4MLO A;  4B47 A;  3KET A;  4IOA F;  1A36 A;  1C0W A;  4HF1 A;  3OY9 A;  4BHB A;  1TQI A;  1KQ8 A;  1LQ1 A;  2RGV A;  3CJT B;  3LSJ A;  2BY1 A;  2R7V A;  2VKV A;  4HNU A;  2A3S A;  4A3M J;  1P4A A;  5AIP A;  5J8F A;  2QSG X;  1GXP A;  2L7M P;  3S32 A;  1VI0 A;  2VBX A;  4F7Z A;  3KP3 A;  5FKO A;  2HVQ A;  4PGG A;  1I3Q J;  1P7I A;  2O03 A;  2JUC A;  1D1C A;  4QIW N;  2Q2E B;  5DD8 A;  1TQP A;  2FD5 A;  1AHD P;  3WTX C;  4BY7 J;  1YO5 C;  4I7H A;  1B4A A;  1QPM A;  2E60 A;  3CZ6 A;  1K61 A;  4D5F A;  3C7J A;  3L2V A;  1W7P A;  4AIH A;  1VQN I;  4AYB A;  1G3T A;  1WJB A;  5EEG A;  2BY0 A;  4C3I J;  3HOX J;  3I4N J;  1GVD A;  3RYP A;  4NDL A;  1S7A A;  3E3V A;  4H0E A;  5JLX A;  5BPI A;  2EV0 A;  2FNP A;  2AQE A;  1ZAO A;  5IT3 A;  2O0Y A;  2V1X A;  2XAJ A;  2H6C A;  1P4X A;  2MG4 A;  1YI2 I;  4G8X A;  2MW8 A;  5FGM A;  3N4M A;  2JMW A;  2DDA A;  1SC7 A;  3COA C;  4I0A A;  4BU2 A;  1YX5 A;  1IXC A;  3CES A;  3E6M A;  3J81 K;  5JFR A;  2X1E A;  1VQL I;  3ZR8 X;  2VOP A;  1WJA A;  3I9V 2;  1DDN A;  4KIF A;  2NXN B;  3RCO A;  1GV2 A;  1I39 A;  4UVC A;  3JR9 A;  3M8E A;  4LOC A;  4KIG A;  4NC6 A;  2DA3 A;  1IN7 A;  3REO A;  2KRF A;  2ZKZ A;  2VUM J;  4BQO A;  2XAQ A;  2UV1 A;  4L5J A;  1KQ9 A;  2M4K A;  3TQN A;  3ROU A;  2E1N A;  5CKT A;  3UKG A;  3F72 A;  1SFU A;  3TKY A;  3OYE A;  4HNV A;  2QQA A;  4UUT A;  3TDU C;  3WG9 A;  3GXO A;  2V7F A;  3CCL I;  2FOW A;  5DM7 F;  4GGG A;  3RDI A;  2QF7 A;  3VEP A;  5KAI C;  2VQL A;  3C2H A;  4E7L A;  4XL9 A;  2CW7 A;  5EGO B;  2HPM A;  2QA4 I;  3IWF A;  1SVL A;  3PIO F;  3BCA A;  2KL4 A;  2RN7 A;  3IH2 A;  1W7P B;  1XCB A;  3RI4 A;  1NH3 A;  1IDZ A;  3FKJ A;  2WB1 A;  3OS1 A;  2X51 A;  3E0J B;  1JUS A;  2X6X A;  4DW6 A;  5KHD A;  1RRJ A;  5E3N A;  2JSP A;  3GCM A;  1R7J A;  4DBQ A;  4CYC B;  5B5E C;  5LEK A;  2Y31 A;  4OWR B;  3I5U A;  1U8R A;  3JTH A;  4PJ0 C;  3WE3 A;  3DLL F;  4A3B J;  2PI0 A;  2WTE A;  3DWL E;  2ZJQ F;  4ZDP A;  3GFM A;  2JQ7 A;  4G9Y A;  3BG3 A;  3O8G A;  4PJN A;  1D1A A;  3H5R A;  1UST A;  3QU6 A;  2L9R A;  2ZXH A;  1P2F A;  4B1R A;  3K70 D;  1W4M A;  2HTS A;  4R79 A;  2XIG A;  2K4B A;  3A01 A;  4Q4Z F;  4PCQ A;  1YHQ I;  2ESH A;  5E8G A;  4Y15 A;  5D4S A;  1D0Z A;  4MTE A;  2CO5 A;  1ETW A;  1K6O A;  3F23 A;  3BQY A;  3KIO A;  1JJ6 C;  2L9S A;  2VBW A;  3FBN B;  1J59 A;  4EJT A;  4XRF A;  3IH3 A;  4OAY A;  2XGE A;  3GLX A;  4Q48 A;  1QRY A;  5HLI A;  2KMU A;  1BC7 C;  2QWW A;  5A2Q Z;  3L2W A;  1DGW Y;  4FIS A;  4EJV A;  1X2M A;  4NQW B;  4JK1 X;  4XM3 A;  3D1N I;  4JX4 A;  1JE8 A;  3QPL A;  1UHW A;  1E0E A;  1QQI A;  4GO1 A;  1OCR H;  1IV6 A;  3J80 Z;  3HTU A;  1VFC A;  1UFM A;  1LE8 A;  2FBH A;  2R7U A;  1DPR A;  3W6V A;  2COM A;  4BAY A;  1FY7 A;  3WTW C;  2WY8 Q;  2M5W A;  1T8I A;  5LFA A;  1FMV A;  4KIB A;  4L0Y B;  5AON A;  1F4K A;  3CDI A;  1OYI A;  3VYT B;  2AHQ A;  1D8K A;  3OIO A;  3ABU A;  4XKV A;  4PDK A;  1UHM A;  2VB6 A;  1ZTR A;  1BI0 A;  2W1O A;  2H8W A;  4R8H A;  1MJA A;  3HG9 A;  2M2E A;  2OA4 A;  2XRO A;  1HKS A;  1RUO A;  1YTY A;  2UZK A;  1MMS A;  2ECB A;  5LHI A;  3WGI A;  3Q5F A;  4IQJ A;  4KT6 A;  1V55 H;  2JJ7 A;  3IAM 2;  3BT9 A;  3JAM K;  4E7K A;  3BY6 A;  2M7B A;  1O7L A;  3R4K A;  3SDG A;  3LOC A;  4L5E A;  2F4I A;  4G94 A;  1B59 A;  4HSR A;  2XV4 S;  1KGS A;  2IA1 A;  1R1V A;  3A01 B;  1ZR2 A;  5CVJ A;  1PUE E;  1Z21 A;  2E34 A;  3F21 A;  4AIJ A;  3E6D A;  3JRH A;  3WOD F;  3S1M J;  3G3Z A;  3OYA A;  3HSE A;  5J1Y A;  2DLL A;  3P9I A;  2HQN A;  1JHH A;  2PMZ N;  3VSK A;  2R7D A;  3LSM A;  2H1K A;  4UY8 I;  4BY1 J;  3JRB A;  3GF2 A;  3BJA A;  1NG6 A;  1TW2 A;  1EV7 A;  2DYS H;  2GWR A;  4LJZ F;  3H92 A;  5D5V B;  3F8F A;  4N4N B;  4ZZD A;  2ZFW A;  3I54 A;  1BM9 A;  3X2Q H;  4BXU A;  1GLN A;  5FD6 A;  3ZN0 A;  2MD5 A;  3EUK L;  2CMP A;  3ZMT A;  4BHC A;  1TNT A;  3RPU D;  3IAS 2;  3KP7 A;  4ON0 A;  3ASO H;  1D5Y A;  1ODD A;  1JTX A;  2E36 A;  5FFZ A;  3PNY A;  2GM4 A;  5CVI A;  3HGG A;  2CUZ A;  3J7Z I;  2VE8 A;  2L0K A;  5B1B H;  2R7Q A;  2VAS A;  5DYM A;  2FJ1 A;  4PJM A;  3F8N A;  1ZLJ A;  1X1D A;  1OFC X;  1FP2 A;  4Y13 A;  3CD6 I;  3BPX A;  3U21 A;  3WU0 A;  3BR2 A;  4XN3 A;  2N8G A;  2ZC2 A;  3AG1 H;  5M3M J;  2MLG A;  3CCV I;  1RES A;  4OIQ F;  2ZSH B;  2OU2 A;  4Z2Y A;  3HOU J;  1LDJ A;  1YFH A;  2JPB A;  4FTH A;  2CQQ A;  5K5O A;  3H9Q A;  1GDT A;  4YEL A;  2DT6 A;  2L7F P;  1O7F A;  5CJ9 A;  3IP4 B;  4HG2 A;  1ZLK A;  1MJB A;  2BOL A;  2R7O A;  3G1O A;  4FX0 A;  1Y1W J;  2TCT A;  2OQG A;  2OPT A;  2OCE A;  1T6S A;  4IEJ A;  2LSO A;  4CXF A;  1ETK A;  2IS4 A;  2M30 A;  2PFB A;  1DP3 A;  3OIP A;  3FM5 A;  1J7K A;  3E5U A;  1KON A;  3K1N A;  4I98 B;  1MMA A;  3CP2 A;  2CUF A;  2F5C A;  5EDN A;  1UCR A;  2DW4 A;  1HLV A;  1S72 I;  2FNA A;  4CCJ A;  1FYM A;  3ABM H;  1R49 A;  4JX5 A;  5FRM A;  3E7L A;  4Q5S F;  2AXT C;  3ZQF A;  1SD6 A;  1MBH A;  1MD0 A;  3BR5 A;  4PFO A;  2VJ4 A;  3DBL B;  3R61 A;  3MZ8 A;  5D6E A;  4AVZ A;  2QZ8 A;  2NS8 A;  3E97 A;  3A2K A;  4A2U A;  4B8X A;  3FK6 A;  4I76 A;  1PUF A;  1T2K A;  1G3W A;  3CUO A;  2LY1 A;  2K85 A;  3GTG J;  4HA8 A;  4XNF A;  5LHH A;  1WJE A;  2GLO A;  1FBU A;  2JRM A;  2XF7 A;  3FXL A;  2K5C A;  3DPU A;  1AU7 A;  4J19 A;  2DPD A;  1S3J A;  2EB7 A;  2IW5 A;  2E1M B;  5ICE A;  2XHK A;  4IZZ A;  1VND A;  2MSY A;  2GA1 A;  2HOE A;  1CGP A;  2OQR A;  3JRA A;  3JW4 A;  2EFN A;  2EJR A;  4GDF A;  3S17 J;  5DCF A;  2CGP A;  5CVU A;  2XAU A;  4XOT A;  1LVA A;  3GZN B;  4BEH B;  1HST A;  1K4S A;  2NS0 A;  3KPH A;  1YW9 A;  5J40 A;  4OIR F;  4BBR J;  2R4G A;  5F0C A;  4P55 A;  4F93 B;  5E3M A;  5KNL A;  4F55 A;  1LE8 B;  4JQF A;  5HS7 A;  3CCR I;  1MZB A;  1SVO A;  1S8N A;  1WCM J;  4M9X A;  1V4R A;  4MTD A;  3D5L A;  2WY7 Q;  3JSP A;  5K7Z A;  2ZXW H;  3BPV A;  1BA5 A;  3F22 A;  3AL0 B;  5C44 J;  3VSL A;  3Q0V A;  3U1K A;  1S29 A;  1GUU A;  4A3I J;  2E1M C;  4WXH A;  1OCT C;  1NTC A;  2ZME A;  4O6J A;  4U88 A;  1R23 A;  5C4J J;  2Y0S A;  2BXZ A;  1OQY A;  4UUS B;  1FTT A;  4D0P A;  4YFN F;  1YJ9 I;  1XTA A;  2G7H A;  1G4D A;  2LC2 A;  3PUF A;  4LB6 B;  3LSK A;  5H6Q A;  1LPQ A;  2WC2 A;  3MQ0 A;  1QZZ A;  1FEX A;  2YR2 A;  5EF6 A;  1UG0 A;  2ZXJ A;  2VBZ A;  2A5W A;  4BBS J;  1HKQ A;  3HKZ N;  1JGS A;  3GFJ A;  2LLK A;  2VOD A;  1G2H A;  2KZG A;  5HVQ C;  1YRN A;  1QBJ A;  4ZTJ A;  5ILU A;  1P92 A;  1T08 B;  4XLN F;  2B63 J;  4RB1 A;  2BGC A;  1U2W A;  5GPC A;  4M3D A;  1BJA A;  3HUG B;  1J75 A;  4BDZ A;  1EJ9 A;  3ZN1 A;  4XKC A;  4YIF A;  3CUQ A;  2MD0 A;  3HXL A;  1N77 A;  2OTJ I;  3GVA A;  5LRR A;  2JA5 J;  4ZTF A;  3A03 A;  1VQ5 I;  1MGT A;  2EFP A;  3FXO A;  2VKD A;  3BRO A;  1AWC A;  1REP C;  1RKW A;  2HS5 A;  2X9D A;  2ELK A;  1YOV B;  5KAF C;  3FX3 A;  3SDB A;  5AIQ A;  5GTH C;  2EFQ A;  2ETH A;  2LF8 A;  3A0B C;  3GTP J;  3HZJ A;  2D1H A;  3Q0U A;  2XVC A;  4JP0 A;  1ETY A;  1YIJ I;  4AIK A;  1UZC A;  3PNT A;  3DCF A;  5DV5 A;  2R5Z A;  3CF5 F;  2VQG A;  2ECC A;  1EA3 A;  1YS7 A;  4F3Q A;  4I0B A;  1X4O A;  1SMT A;  3IHU A;  3HIF A;  1ONV A;  3O3K A;  3OOU A;  3C2G A;  4P1W A;  3I56 I;  1WH7 A;  4Z6Y A;  3RYR A;  4C2M J;  3K4N A;  3BTC A;  5D5X B;  1Y8Q B;  2OZU A;  1R5G A;  3DKX A;  1MBE A;  3KYL A;  5EYR A;  2D1V A;  2NVY J;  3V42 A;  5DM6 F;  1XSV A;  4ENN A;  5J1U A;  3PM1 A;  2XGD A;  4ZZL A;  2W85 A;  2DO7 A;  4XRM A;  4CA0 A;  1JGG A;  1E3H A;  3M1E A;  3DEW A;  4XN0 A;  3R60 A;  3HB9 A;  5F1J A;  1OJL A;  4HV6 A;  2VT2 A;  2YPR A;  3HRU A;  2HVS A;  5CVR A;  1H9G A;  4FE7 A;  3GTQ J;  2LBF B;  3WHB A;  1IGN A;  2X48 A;  3ZMS A;  3FXK A;  4LIT A;  3EYI A;  2K86 A;  1VQ7 I;  2LOO A;  1RZ4 A;  2NOJ B;  2BW3 B;  4ESF A;  3L2U A;  2P7V B;  4BGD A;  4HYE A;  4AYB N;  3BR6 A;  3GFL A;  2DJN A;  3CC4 I;  1MJ9 A;  2Y0S N;  5E3O A;  4D5C A;  2Q8K A;  4IHT A;  1WGX A;  3LQR A;  3PO3 J;  4KJZ A;  4N0B A;  3BJO A;  3QOE A;  4A3E J;  2EZH A;  3H3U A;  1RC9 A;  1VTN C;  3ZCO A;  1YJN I;  1FTZ A;  4A5N A;  2V1U A;  4B3X A;  1PDN C;  2IP2 A;  1ZH5 A;  2DFE A;  2JK3 A;  1A04 A;  4S05 A;  1X4P A;  4HX7 A;  1XC5 A;  3IRR A;  2JA2 A;  4A5M A;  5EG0 B;  4L18 B;  3CMM A;  2V1N A;  3V8K A;  4I2O A;  4G7Z F;  1D1B A;  1YX3 A;  4EJU A;  2BVL A;  2GXB A;  1IAW A;  4BJ6 C;  4A3G J;  3TO9 A;  1X1P A;  1T0F C;  1S9H A;  1RIO H;  1ORK A;  2WAQ A;  3S14 J;  4RDU A;  3MAJ A;  1V3F A;  5FLV A;  1R6R A;  2HQA A;  2VL8 A;  3OYF A;  1I5Z A;  4E4H A;  4EGZ A;  1OIS A;  4LG3 A;  3ZMZ A;  5D4R A;  1FIA A;  2F5F A;  2IAI A;  2KLO A;  5GPA A;  4YFK F;  3PFI A;  1ZGW A;  3OYJ A;  1UAA A;  2DK5 A;  2FX0 A;  5DUI A;  5BMZ A;  2LH9 A;  3EQL F;  4ZYA A;  3HOY J;  1XDS A;  4BJT A;  2PX9 A;  3ELK A;  1E2X A;  3FK7 A;  3AG2 H;  5FKK A;  4DNC A;  4EVI A;  1VQ9 I;  1IXR C;  4L0Z B;  4HDV A;  1ZN2 A;  5GAD J;  1MND A;  1JXS A;  4HST A;  2J5O A;  2ZXI A;  1MDM B;  1Z0X A;  2L9N A;  2FA5 A;  4RAG A;  5D8L B;  2E19 A;  1JKP C;  1K79 A;  2VC0 A;  4N9I A;  3IV5 A;  5J1R A;  4XID A;  3ECO A;  2HZD A;  3W6K B;  2F48 A;  2ADU A;  1VZ0 A;  1K83 J;  1GHC A;  5FRN A;  5L3F A;  3R0A A;  2Y30 A;  2DI3 A;  1R5I D;  3DU6 A;  3KZY A;  4QPQ A;  1PP8 F;  4LK0 F;  1MNM C;  2P4W A;  5K5Q A;  3H9J A;  1ULY A;  3P7N A;  2CV0 A;  4NB5 A;  2PEX A;  4IOC F;  4XLE A;  1WRJ A;  1IW7 F;  1R1T A;  2BY3 A;  2XUB A;  3GTL J;  4IHS A;  3KEY A;  1Q1V A;  1XCV A;  2FEZ A;  3IC7 A;  1WJD A;  5ICC A;  4C30 A;  1G8X A;  4MFE A;  3TO6 A;  1MMN A;  2FSW A;  3G6E I;  1CF7 B;  2VKH A;  3BG7 A;  4IRG A;  2O61 A;  3RSN A;  2V79 A;  1FMW A;  2HOS A;  1TWF J;  1U5T A;  2CJJ A;  1WI3 A;  5HS9 A;  3BQZ A;  3F3X A;  4OIP F;  1B72 B;  5JVT A;  1PUF B;  2D45 A;  1R00 A;  2BHY A;  4PGH A;  2CH0 A;  5JHF A;  2BHZ A;  3ERM A;  5E79 C;  3ABK H;  1QO0 D;  4LG0 B;  3A0H C;  2QQ9 A;  2JVH A;  2PQ8 A;  1I1G A;  5FLX Z;  2IT0 A;  1E17 A;  3Q9V A;  1OYW A;  1MMD A;  2G9W A;  2K9S A;  1HF0 A;  1TQM A;  3VOE A;  3I4P A;  4AID A;  2Q2E A;  2V6C A;  1HOM A;  2A61 A;  2XPU A;  3ZMD A;  1MSE C;  3GFI A;  3RKW A;  5JVG F;  1YRN B;  4ETS A;  5LRS A;  3NWS A;  1S7E A;  1ZRC A;  2W4S A;  3ZPL A;  3LWF A;  2K9N A;  5GP9 A;  4V2G A;  2VQH A;  1XPX A;  2Z9O A;  3CDH A;  1MBG A;  2H6B A;  1IXS B;  2KDO A;  4DQ2 A;  2RNG A;  2DJI A;  3BZK A;  5CVV A;  2M45 A;  5E20 A;  2PMU A;  5H20 A;  3M4O J;  1MDM A;  2M9H A;  2X1D A;  1IUF A;  1HW1 A;  3K4J A;  3JSO A;  3FXJ A;  3F6V A;  1XMK A;  1R22 A;  2QLZ A;  1AKH A;  2VON A;  3JCU C;  3E5X A;  3PSF A;  4XQF A;  2NVU B;  3ZMV A;  2HVR A;  4C2U A;  2ZB9 A;  4I01 A;  3T5X A;  1ZRD A;  3PL8 A;  5F1R A;  1L0O C;  5LGN A;  2DT5 A;  4ZDO A;  1VQP I;  4C9Y A;  2MGQ A;  4X6A J;  3DEU A;  2FOK A;  3F8B A;  1VQ6 I;  1LFB A;  1B6A A;  1QZE A;  3B73 A;  2E2I J;  4NHJ A;  3PJR A;  5GTI C;  2ME6 A;  3IRQ A;  2FF4 A;  2L7K A;  2DU9 A;  4UV8 A;  2HQR A;  2VI6 A;  1ZAR A;  3SZT A;  4FAS D;  4M72 A;  2FU4 A;  1U78 A;  4WXC A;  2JA8 J;  1T98 A;  2DTZ A;  2P0W A;  4U0Y A;  2B0L A;  2KIF A;  2KRH A;  1SEU A;  2M87 A;  1X1A A;  3L2C A;  2GIV A;  2LY9 A;  4JYK A;  2QBY A;  2LVS A;  1H8A C;  1A6Q A;  2F4M B;  1XX5 A;  2TRT A;  2OJE D;  1POG A;  1UMQ A;  1X19 A;  2Z33 A;  1FSH A;  4KA4 A;  1D0X A;  4IHX A;  3ERE D;  5HNH A;  4YG2 F;  2V26 A;  2VJI A;  1ETV A;  3CTA A;  4CYC A;  3S1R J;  4C3J J;  3M1C A;  3HOW J;  3MKW B;  2KP6 A;  1YJW I;  1DPU A;  2EPF A;  4EQQ A;  5E17 F;  3F0C A;  2GXG A;  4LIU A;  2HXO A;  1HW2 A;  4BYY A;  2KT0 A;  5L3B A;  1N25 A;  2PBI A;  2K40 A;  4MHG A;  3WGG A;  1FLI A;  2VBY A;  2EIJ H;  1I3A A;  4QWQ A;  3FXQ A;  3BG5 A;  1FWZ A;  2W82 A;  4LMY A;  1IG7 A;  1KU2 A;  2CQN A;  5E1Z B;  5FB2 A;  5LHG A;  1ETQ A;  1XG1 A;  4BE0 A;  3DEE A;  4A93 J;  1FOX A;  3BCB A;  4NC7 A;  3I58 A;  1R5H A;  1KU7 A;  4HAM A;  4BXX J;  3ISP A;  1WJF A;  2RDP A;  4IXA A;  4RGX A;  4A6E A;  2OTL I;  1SFE A;  2QKL B;  3CP8 A;  5E1W A;  3EYY A;  2JWT A;  4CO8 A;  1VF9 A;  5F0H A;  3EDP A;  4LFU A;  2A05 A;  2DFI A;  3SEQ A;  4D1Q A;  4PZJ A;  3HYI A;  1Y56 A;  3D5R C;  4ABZ A;  3E1S A;  3GTJ J;  3NAU A;  1Z3Y A;  1EF4 A;  1QA6 A;  2K3F A;  3OYG A;  1XD7 A;  2FUG 2;  2KHM A;  3FZV A;  4CH7 A;  3LSG A;  3TO7 A;  2ACJ A;  1H9T A;  3VWB A;  3LA2 A;  5FJ8 J;  5LGT A;  2FML A;  4UNO A;  4UB6 C;  2JRT A;  1LEA A;  3VB2 A;  1X3Z B;  3K4K A;  2ID3 A;  3JRG A;  1Y39 A;  1K4T A;  4GFB A;  4PJJ A;  2PJP A;  2WAF A;  4XON A;  3MVP A;  2IGK A;  1Y1V J;  2M4G A;  3OYB A;  1U6G A;  2IS2 A;  3FXR A;  3G1M A;  2LK2 A;  2NVQ J;  2EIK H;  2HGC A;  3LFU A;  4XLA A;  5IOZ A;  2GOM A;  3FDY A;  1O3S A;  3ZQH A;  1MW7 A;  1TZL A;  2P81 A;  2ZFU A;  3KP5 A;  2Z3Y A;  3LST A;  5FLM J;  4YEJ A;  2M0M A;  2FQ3 A;  1R58 A;  3CO7 C;  4BJ5 C;  3RPU A;  1G3S A;  2WB1 N;  3JRI A;  3F8C A;  3I71 A;  4II3 A;  1KYZ A;  2XGX A;  3M8F A;  4KIC A;  2JA7 J;  1IV8 A;  2B7E A;  2EV5 A;  2LNB A;  3PO2 J;  2IGM A;  2M3A A;  3H5N A;  1U0J A;  5J47 A;  3WG7 H;  3WU1 B;  4S0H B;  2LF7 A;  2CRG A;  4DZJ A;  3OWT A;  5L3D A;  1NK3 P;  2IRF G;  3SFI A;  3NAR A;  4TV7 A;  2EWN A;  3OYC A;  2P5K A;  2O6G E;  4LLL A;  4KT5 C;  1WVR A;  1G3Y A;  4BEH A;  4XOR A;  4JBA A;  2CQK A;  1U5T B;  1NK2 P;  2WV1 A;  1Z91 A;  1OR7 C;  1SAX A;  4HZF A;  4B44 A;  4EM0 B;  1QNT A;  3CO6 C;  2FQ4 A;  1LDK B;  4LLG F;  3S93 A;  4BNC A;  2QSF X;  1IRZ A;  2M8G X;  1JJ8 C;  3VYU B;  2DQR A;  2O7O A;  3LMM A;  2HZT A;  4W97 A;  2ELH A;  3CF2 A;  2EFW A;  1BOB A;  3I3L A;  4Y33 A;  4DYQ A;  3PIP F;  1WSU A;  1KU9 A;  1QHG A;  4G7H F;  1ZRE A;  4RB0 A;  2XSD C; 
#chains in the Genus database with same CATH homology
 4IRH A;  1ZGA A;  1IN5 A;  3IKT A;  3CLO A;  2OD5 A;  3GW2 A;  2K4J A;  4IRI A;  2JPC A;  4RB3 C;  3DKW A;  1OMI A;  3PQJ A;  1IF1 A;  2BBY A;  5F64 A;  2JZY A;  3DV8 A;  3ULQ B;  3BZ6 A;  4RGR A;  1W5S A;  3U1D A;  1FBQ A;  3B02 A;  2QVO A;  3LFK A;  2FRH A;  3GEZ A;  3V8L A;  4EMS A;  2H09 A;  2P6S A;  1HKT A;  5FO5 A;  3MZH A;  4HX8 A;  5HLG A;  1OPC A;  4U7D A;  1LDD A;  2G7U A;  1YW8 A;  4OU0 A;  3DQV C;  2JT1 A;  2YU3 A;  3I0T A;  3KP6 A;  1J5Y A;  5E8I A;  3FMS A;  3ZQ7 A;  2NRA C;  2E7X A;  2HKO A;  2EA2 A;  3QOP A;  1XMA A;  1WWX A;  4WK8 F;  4Q47 A;  1I6X A;  3O6B B;  3J81 Z;  2GZW A;  2QM3 A;  3O2P E;  1LEB A;  1YG2 A;  3L09 A;  2ISY A;  2FBK A;  2VE9 A;  5ICF A;  1RI7 A;  4ASN A;  4XBF A;  1Q1H A;  5FD5 A;  1K7A A;  1YYV A;  1OKR A;  2K27 A;  1TTY A;  5H6R A;  2P5L C;  4A0Y A;  4FT8 A;  5BPD A;  3I53 A;  2IA0 A;  3MFK A;  2XAH A;  1SFX A;  2DK8 A;  1FNN A;  1O3T A;  2OZ6 A;  3T8T A;  1XSD A;  5DCM A;  2ZNY A;  3CUQ C;  3I59 A;  3I59 B;  3K2Z A;  1J2X A;  3KLN A;  4XSX F;  4O3M A;  1R36 A;  1JHF A;  1FPQ A;  5DD4 A;  4LK1 F;  4MQV A;  2L54 A;  2AXL A;  4M6Y A;  1P6R A;  3TOA A;  5D5U B;  2QUF A;  4IPA A;  4FHT A;  4HDU A;  3BDD A;  2P6T A;  3GZ6 A;  4EJW A;  1UB9 A;  3QP5 A;  5DCM B;  1XGS A;  1Z1D A;  2CWE A;  4HQM A;  5A2Q K;  2P8T A;  1Z7U A;  2HFH A;  2UWM A;  3M7G A;  4EV0 A;  1AOY A;  1WQ2 A;  4RAY A;  4UV9 A;  3LQQ A;  1SMY F;  5CLS A;  3LA7 A;  2BEO A;  3E6B A;  1RUN A;  4RGS A;  4M9S A;  3FF5 A;  1BOA A;  5L3C A;  3MWM A;  3FMQ A;  5HDN A;  4R1H A;  5JR3 A;  4E70 A;  3FM3 A;  2KJB A;  2ZNZ A;  4KYW A;  2Z5U A;  1Y0U A;  2R7F A;  2EA4 A;  2MBF A;  5HS8 A;  3FWE A;  2NAZ A;  2ZO4 A;  1XSX A;  4ZYE A;  1LJ9 A;  1FC3 A;  4KN7 X;  2F5D A;  3GZ5 A;  5FLX K;  3J80 K;  5LGU A;  1KYW A;  4U7B A;  2DAO A;  1XDU A;  2XKO A;  3ABT A;  4UXN A;  1QGP A;  2JTV A;  2H94 A;  2RV8 A;  4O5V A;  2KIM A;  3SZP A;  1T38 A;  3ZMU A;  1BI1 A;  4OIN F;  5K1Y A;  5IT9 K;  4BH9 A;  1BI3 A;  2ZCW A;  4HV5 A;  4KNY A;  1F1Z A;  5D8K B;  3IKV A;  3U9G A;  1KU3 A;  3D0S A;  1USS A;  4P9F A;  2OAZ A;  1TNS A;  1ZRF A;  4A6D A;  4GYG A;  2AS5 F;  2GAU A;  2A5Y B;  2RKH A;  3E6C C;  3HOS A;  4CGZ A;  1PP7 U;  2QBY B;  3TOB A;  4GYI A;  3DXJ F;  3TDZ C;  2FXA A;  1D3Y A;  4HOB A;  1RNL A;  4CZZ A;  1U3E M;  2DPU A;  3GUD A;  3H3Z A;  4LB5 A;  5F6F A;  1S7O A;  2GA2 A;  2F2E A;  4IF4 A;  1BI2 A;  2A68 F;  4ESJ A;  2W25 A;  1ZGJ A;  4IJA A;  4M74 A;  4XSZ F;  3F8M A;  4AD9 A;  1ZG5 A;  3C1D A;  2YSR A;  4ZYH A;  3MEX A;  2Z99 A;  4EGY A;  3HRT A;  2Y75 A;  5HDG A;  1B9M A;  4HX4 A;  1KQ0 A;  1SD4 A;  5TJJ A;  5E18 F;  2EFO A;  2HR3 A;  5L3E A;  1NHA A;  1L3L A;  1P4W A;  1I27 A;  3QPH A;  5ILS A;  5KVR A;  2XKP A;  3PQK A;  3K9T A;  5DDG A;  3BWG A;  2DQL A;  4B09 A;  3JTG A;  4KMF A;  3QAH A;  5E1X A;  4EM2 A;  5ERI A;  1B1B A;  2IVM A;  1YIO A;  3BP8 A;  3HUG A;  3RPQ A;  2CG4 A;  3KCC A;  2W84 A;  1J9I A;  2P5V A;  4L9T A;  2A69 F;  4L5I A;  3C18 A;  5J6X A;  4L9N A;  3QPT A;  3RKX A;  4CIC A;  3MCZ A;  3DPL C;  2M1B A;  3MZY A;  3GYH X;  4BHP A;  1FP1 D;  2STW A;  3KP4 A;  2IPQ X;  4RB2 C;  3WGH A;  4ENK A;  4HLX A;  4P9U A;  2D2W A;  4P5O A;  1HSJ A;  2MLK A;  4M6X A;  4Y17 A;  1D5V A;  3HHH A;  4KDP A;  2CYY A;  1Z6T A;  4WCG A;  2KJC A;  4ENJ A;  4A12 A;  1J0R A;  4UVA A;  2VN2 A;  2GQQ A;  3LAJ A;  1F5T A;  1YQA A;  3U2R A;  1EH7 A;  4G6Q A;  4G7O F;  2PLY A;  4N9H A;  2XAS A;  4UHT A;  3WTS C;  4BQA A;  2STT A;  1ZYR F;  3WTT C;  3FXU A;  3NRV A;  2K7L A;  1FOK A;  1XGM A;  3K69 A;  4ZH4 F;  3DFG A;  3SQN A;  2W24 A;  4L9V A;  5LLQ A;  3WTZ A;  1HBX G;  3NEU A;  2R3S A;  4UUV A;  1EH6 A;  4YII A;  2Y0M A;  3KZZ A;  5L3G A;  3HOT A;  3QRF F;  5K5R A;  3AAF A;  2C6Y A;  4AVP A;  3R0J A;  4I02 A;  2KIU A;  2OBP A;  3V7R A;  2XAG A;  3WE2 A;  2L4A A;  3HTS B;  2HEO A;  3V7S A;  3F6O A;  2E1C A;  2XAF A;  2HKX A;  3K0L A;  1ZHF A;  2LDU A;  2K02 A;  2HDC A;  2EK5 A;  1B9N A;  1IN6 A;  2RQP A;  3FHZ A;  1BC8 C;  4YFX F;  4NQW A;  1O3Q A;  1MKM A;  5FFX A;  4HF2 A;  2MH9 A;  5ILV A;  4HW0 A;  3WTV C;  4HLY A;  3LAP A;  2HWV A;  1HXD A;  2KKO A;  3RTR A;  1ZG1 A;  1GXQ A;  1W5T A;  3KLO A;  1LNW A;  3VFZ A;  2NNN A;  3M9A A;  4M71 A;  1S6L A;  4KMU X;  1K78 A;  4FX4 A;  1YLF A;  1FSE A;  1TW3 A;  3V7C A;  3KP2 A;  2VC1 A;  2VXZ A;  1OYY A;  1BIA A;  4CDG A;  2ZJ2 A;  1O57 A;  2F5E A;  3KE2 A;  3GWZ A;  5DUK A;  4OMZ A;  2JSC A;  1ON1 A;  4OOI A;  1OR7 A;  2X4H A;  5HOO A;  2HYF A;  5ICG A;  2MH2 A;  1T39 A;  6PAX A;  3GX4 X;  1DUX C;  1YS6 A;  2O3F A;  2BE5 F;  2VT3 A;  1WKM A;  3ECH A;  2QQB A;  3VOD A;  1YW7 A;  4LG0 A;  1Z6R A;  4MNU A;  1IUY A;  2P7C B;  3P9C A;  4HF0 A;  3IL2 A;  3WTU C;  4CHU A;  5BS6 A;  2ZBK A;  4QLC U;  2LKP A;  1FX7 A;  3HRM A;  4S04 A;  4LLN A;  4IVN A;  1IRG A;  3HHG A;  4OIO F;  1K78 B;  3C3W A;  4WXD A;  1HW5 A;  3OOP A;  3WTY C;  4M73 A;  3CUQ B;  4MQ9 F;  3T8R A;  3DF8 A;  1TLH B;  3IWZ A;  4KFC A;  2V1D A;  5LBQ A;  4GXO A;  3JAM Z;  2MA3 A;  2XRN A;  1XGO A;  3OV8 A;  4GCV A;  1ZG3 A;  4P96 A;  3SFZ A;  2A6H F;  4KUM A;  2PG4 A;  2H27 A;  2Y48 A;  4KN4 X;  3DPT A;  2RC4 A;  4UVB A;  4HQE A;  2MC3 A;  1R1U A;  4A0X A;  4U0V A;  5CYV A;  5JHU A;  3TGN A;  5JI6 A;  3E5Q A;  2FMY A;  1Z9C A;  3V4G A;  2FBI A;  3FMR A;  4RGU A;  3V8J A;  3RKY A;  1EH8 A;  2ZME B;  4M9Z A;  5IT9 Z;  2L4M A;  4K2E A;  3BJ6 A;  2ISZ A;  3CJN A;  3DP7 A;  1GVJ A;  5KK1 A;  3RJP A;  3I64 A;  3HSR A;  2M8E A;  2A07 F;  2QYO A;  2UXX A;  5LEJ A;  1FBS A;  2WV0 A;  2EV6 A;  4XLP F;  1CF7 A;  2DTR A;  3W6J B;  1FT9 A;  2X0L A;  1O3R A;  2PMH A;  2QEN A;  5BQT A;  3N97 A;  4MEY F;  2IA2 A;  2CFX A;  1I1S A;  2FE3 A;  2DBB A;  2RNJ A;  2CW0 F;  4WX9 A;  4ESB A;  2IJL A;  5TRD A;  2VOO A;  3SXY A;  2L3D A;  3T0Y A;  3LA3 A;  1ON2 A;  1WI9 A;  2BV6 A;  1XGN A;  2Q0O A;  2J5P A;  3ZP5 A;  1FZP B;  1SD5 A;  5HDK A;  3T1B A;  1SD7 A;  3K1P A;  1F9N A;  4EM1 A;  5D6F A;  1U5T C;  5D5W B;  1IZ1 A;  3GO5 A;  3K1M A;  3HSF A;  4RS8 A;  3L00 A;  4ENM A;  4I09 A;  2E7W A;  2UXN A;  1BBY A;  2L02 A;  1BN5 A;  2L01 A;  5BOX A;  4LD5 A;  4OMY A;  2PN6 A;  1W7P D;  3BOQ A;  5HLH A;  3L9F A;  1XN7 A;  1D8J A;  1DP7 P;  3KFW X;  2V9V A;  3R6S A;  3G73 A;  3RIR A;  3P9K A;  1IRF A;  3L7W A;  1G6N A;  3S2W A;  5ED4 A;  2O8X A;  1STZ A;  3KEO A;  3Q9S A;  3NQO A;  5J8C A;  1BIB A;  4HBL A;  4ZYG A;  1KA8 A;  4EJO A;  2YX7 A;  2HYG D;  4A0Z A;  2ESN A;  1XB4 A;  2CSO A;  3J7A O;  4G6D A;  4WWC A;  2HTJ A;  4WF2 A;  4LGW A;  3SHF A;  3ML6 A;  1Z05 A;  4L9J A;  4MEX F;  5EEH A;  3HRS A;  4ZYD A;  2NNY A;  4RAZ A;  1T0F A;  1HQC A;  3EUH A;  1TBX A;  5DEQ A;  4MGR A;  1FYK A;  4CYD A;  2NYX A;  1H0M A;  2A6E F;  2YX4 A;  2TDX A;  3EET A;  4AWX B;  2BYV E;  1IN4 A;  3QP6 A;  1LB2 A;  2RVC A;  1QZY A;  3QU3 A;  1FYL A;  1IN8 A;  2W57 A;  3KEQ A;  2WWY A;  4U0W A;  1X3U A;  3KET A;  1C0W A;  4HF1 A;  4BHB A;  1TQI A;  1KQ8 A;  1LQ1 A;  2RGV A;  2A3S A;  1P4A A;  5AIP A;  5J8F A;  1GXP A;  2VBX A;  4F7Z A;  3KP3 A;  4PGG A;  2O03 A;  5DD8 A;  1TQP A;  3WTX C;  1YO5 C;  4I7H A;  1B4A A;  1QPM A;  3C7J A;  1W7P A;  4AIH A;  1G3T A;  5EEG A;  3RYP A;  1S7A A;  3E3V A;  4H0E A;  5BPI A;  2EV0 A;  2FNP A;  5IT3 A;  1ZAO A;  2O0Y A;  2V1X A;  2XAJ A;  2H6C A;  1P4X A;  4G8X A;  5FGM A;  3N4M A;  3COA C;  4I0A A;  1IXC A;  3E6M A;  3J81 K;  5JFR A;  2VOP A;  1DDN A;  4KIF A;  4UVC A;  3M8E A;  4KIG A;  1IN7 A;  3REO A;  2KRF A;  2ZKZ A;  2XAQ A;  4L5J A;  1KQ9 A;  3TQN A;  3ROU A;  2E1N A;  3F72 A;  1SFU A;  3TKY A;  2QQA A;  3TDU C;  3WG9 A;  3GXO A;  4GGG A;  3RDI A;  3VEP A;  3IWF A;  3RI4 A;  2RN7 A;  1W7P B;  1XCB A;  1R7J A;  5LEK A;  3I5U A;  1U8R A;  3JTH A;  3WE3 A;  2PI0 A;  2WTE A;  3GFM A;  4G9Y A;  1UST A;  3QU6 A;  1P2F A;  1W4M A;  2HTS A;  4R79 A;  2XIG A;  2K4B A;  4Q4Z F;  4PCQ A;  2ESH A;  5E8G A;  4Y15 A;  5D4S A;  4MTE A;  2CO5 A;  1K6O A;  3F23 A;  4EJT A;  2VBW A;  1J59 A;  4XRF A;  3GLX A;  4Q48 A;  5HLI A;  1BC7 C;  2QWW A;  5A2Q Z;  4EJV A;  4JK1 X;  1JE8 A;  1UHW A;  1QQI A;  4GO1 A;  3J80 Z;  3HTU A;  1UFM A;  2FBH A;  1DPR A;  2COM A;  4BAY A;  1FY7 A;  3WTW C;  2M5W A;  4KIB A;  4L0Y B;  5AON A;  1F4K A;  1OYI A;  1D8K A;  3ABU A;  4PDK A;  1UHM A;  1BI0 A;  4R8H A;  1MJA A;  2OA4 A;  2XRO A;  1HKS A;  1RUO A;  1YTY A;  2UZK A;  3WGI A;  5LHI A;  3Q5F A;  3JAM K;  3BY6 A;  1O7L A;  3R4K A;  4G94 A;  1B59 A;  2XV4 S;  1KGS A;  2IA1 A;  1R1V A;  5CVJ A;  1PUE E;  3F21 A;  4AIJ A;  3E6D A;  3WOD F;  3G3Z A;  3HSE A;  2DLL A;  3P9I A;  2HQN A;  1JHH A;  2R7D A;  3GF2 A;  3BJA A;  1TW2 A;  1EV7 A;  2GWR A;  4LJZ F;  3H92 A;  5D5V B;  3F8F A;  4ZZD A;  2ZFW A;  3I54 A;  1BM9 A;  4BXU A;  5FD6 A;  3ZN0 A;  2MD5 A;  3ZMT A;  4BHC A;  1TNT A;  3KP7 A;  4ON0 A;  1ODD A;  5FFZ A;  5CVI A;  2VE8 A;  5DYM A;  3F8N A;  1ZLJ A;  1FP2 A;  4Y13 A;  3BPX A;  3WU0 A;  2MLG A;  4OIQ F;  2OU2 A;  4Z2Y A;  1LDJ A;  1YFH A;  2JPB A;  5K5O A;  5CJ9 A;  1O7F A;  1ZLK A;  1MJB A;  4FX0 A;  2OQG A;  1T6S A;  4CXF A;  2LSO A;  2M30 A;  2PFB A;  3FM5 A;  1J7K A;  3E5U A;  3K1N A;  4I98 B;  2F5C A;  1UCR A;  2DW4 A;  2FNA A;  1FYM A;  4Q5S F;  1SD6 A;  1MD0 A;  3R61 A;  5D6E A;  2QZ8 A;  3E97 A;  4A2U A;  4B8X A;  1T2K A;  1G3W A;  3CUO A;  4HA8 A;  5LHH A;  1FBU A;  2DPD A;  1S3J A;  2EB7 A;  2IW5 A;  5ICE A;  2XHK A;  2GA1 A;  2HOE A;  1CGP A;  2OQR A;  3JW4 A;  2EFN A;  2EJR A;  5DCF A;  2CGP A;  5CVU A;  1LVA A;  1HST A;  2NS0 A;  1YW9 A;  4OIR F;  4P55 A;  4JQF A;  5HS7 A;  1MZB A;  1S8N A;  4M9X A;  1V4R A;  4MTD A;  3D5L A;  3JSP A;  3BPV A;  3F22 A;  1S29 A;  4WXH A;  2ZME A;  4O6J A;  4U88 A;  1R23 A;  4D0P A;  4YFN F;  2G7H A;  1G4D A;  4LB6 B;  5H6Q A;  2WC2 A;  3MQ0 A;  1QZZ A;  2YR2 A;  2ZXJ A;  2VBZ A;  1HKQ A;  1JGS A;  3GFJ A;  2VOD A;  5HVQ C;  1QBJ A;  5ILU A;  1P92 A;  4XLN F;  4RB1 A;  2BGC A;  1U2W A;  1BJA A;  1J75 A;  3ZN1 A;  4YIF A;  3CUQ A;  3GVA A;  5LRR A;  1MGT A;  2EFP A;  3BRO A;  1AWC A;  1REP C;  2HS5 A;  3FX3 A;  5AIQ A;  2EFQ A;  2ETH A;  2LF8 A;  2D1H A;  2XVC A;  4AIK A;  5DV5 A;  1YS7 A;  4I0B A;  1SMT A;  3IHU A;  3HIF A;  1ONV A;  3O3K A;  3RYR A;  5D5X B;  2OZU A;  1R5G A;  2D1V A;  1XSV A;  4ENN A;  4ZZL A;  2W85 A;  2DO7 A;  3M1E A;  3R60 A;  4HV6 A;  2VT2 A;  2YPR A;  3HRU A;  5CVR A;  1H9G A;  3ZMS A;  3EYI A;  2K86 A;  1RZ4 A;  4ESF A;  2P7V B;  4HYE A;  3GFL A;  1MJ9 A;  4IHT A;  2Q8K A;  3LQR A;  4N0B A;  3BJO A;  3H3U A;  1VTN C;  4A5N A;  2V1U A;  1PDN C;  2IP2 A;  1ZH5 A;  1A04 A;  4S05 A;  4HX7 A;  3IRR A;  4A5M A;  4L18 B;  3V8K A;  4I2O A;  4G7Z F;  4EJU A;  2GXB A;  1IAW A;  3TO9 A;  1RIO H;  3MAJ A;  1V3F A;  1I5Z A;  4EGZ A;  3ZMZ A;  5D4R A;  2F5F A;  4YFK F;  3PFI A;  2DK5 A;  5DUI A;  5BMZ A;  3EQL F;  1XDS A;  3ELK A;  1E2X A;  4DNC A;  4EVI A;  1IXR C;  4L0Z B;  4HDV A;  1ZN2 A;  1JXS A;  1MDM B;  2J5O A;  5D8L B;  2FA5 A;  1K79 A;  2VC0 A;  4N9I A;  3ECO A;  3W6K B;  2ADU A;  1GHC A;  5L3F A;  3R0A A;  2DI3 A;  3KZY A;  1PP8 F;  4LK0 F;  2P4W A;  5K5Q A;  1ULY A;  3P7N A;  4NB5 A;  2PEX A;  1WRJ A;  1IW7 F;  1R1T A;  2XUB A;  4IHS A;  1XCV A;  2FEZ A;  3IC7 A;  5ICC A;  3TO6 A;  1CF7 B;  2FSW A;  4IRG A;  2O61 A;  2V79 A;  1U5T A;  5HS9 A;  3F3X A;  4OIP F;  5JVT A;  2D45 A;  1R00 A;  4PGH A;  1QO0 D;  4LG0 B;  2QQ9 A;  2PQ8 A;  1I1G A;  5FLX Z;  2IT0 A;  1E17 A;  3Q9V A;  1OYW A;  2G9W A;  1TQM A;  3VOE A;  3I4P A;  2Q2E A;  2V6C A;  2A61 A;  3ZMD A;  3GFI A;  3RKW A;  4ETS A;  5LRS A;  1ZRC A;  3ZPL A;  3LWF A;  2Z9O A;  3CDH A;  2H6B A;  1IXS B;  4DQ2 A;  5CVV A;  2M45 A;  5E20 A;  2PMU A;  5H20 A;  1MDM A;  1HW1 A;  3JSO A;  3F6V A;  1XMK A;  1R22 A;  2QLZ A;  2VON A;  3E5X A;  3ZMV A;  4I01 A;  3T5X A;  1ZRD A;  5F1R A;  1L0O C;  5LGN A;  2DT5 A;  3DEU A;  2FOK A;  3F8B A;  1B6A A;  3B73 A;  4NHJ A;  3IRQ A;  2FF4 A;  2DU9 A;  4UV8 A;  2HQR A;  3SZT A;  1ZAR A;  4M72 A;  2FU4 A;  1U78 A;  4WXC A;  1T98 A;  4U0Y A;  2B0L A;  2KIF A;  2M87 A;  3L2C A;  2GIV A;  2QBY A;  2Z33 A;  1FSH A;  4KA4 A;  3ERE D;  4YG2 F;  3CTA A;  1DPU A;  4EQQ A;  5E17 F;  2GXG A;  1HW2 A;  4BYY A;  5L3B A;  2PBI A;  4MHG A;  3WGG A;  1FLI A;  2VBY A;  4QWQ A;  3FXQ A;  1FWZ A;  4LMY A;  1KU2 A;  5E1Z B;  5FB2 A;  5LHG A;  3I58 A;  1R5H A;  1KU7 A;  4HAM A;  3ISP A;  2RDP A;  4IXA A;  4RGX A;  4A6E A;  1SFE A;  5E1W A;  4CO8 A;  3EYY A;  3EDP A;  4LFU A;  2DFI A;  4PZJ A;  3HYI A;  1XD7 A;  3FZV A;  3TO7 A;  2ACJ A;  1H9T A;  3LA2 A;  5LGT A;  2FML A;  4UNO A;  3VB2 A;  2JRT A;  1LEA A;  2PJP A;  1U6G A;  3FXR A;  2HGC A;  1O3S A;  3KP5 A;  2Z3Y A;  3LST A;  2FQ3 A;  1R58 A;  3CO7 C;  3RPU A;  1G3S A;  3F8C A;  3I71 A;  1KYZ A;  2XGX A;  3M8F A;  4KIC A;  2EV5 A;  2LNB A;  3WU1 B;  2LF7 A;  5L3D A;  2IRF G;  4TV7 A;  2EWN A;  2P5K A;  2O6G E;  4LLL A;  4KT5 C;  1G3Y A;  4JBA A;  2CQK A;  1U5T B;  1Z91 A;  1SAX A;  4HZF A;  4EM0 B;  1QNT A;  3CO6 C;  1LDK B;  4LLG F;  4BNC A;  2DQR A;  2HZT A;  2EFW A;  2ELH A;  1WSU A;  1KU9 A;  4G7H F;  1ZRE A;  4RB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...