2K89A

Solution structure of a novel ubiquitin-binding domain from human plaa (pfuc, gly76-pro77 cis isomer)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipase A-2-activating protein
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k89A00
3PSPA 3PSTA 2K8CB 3L3FX 2K89A 2K8BB 2K8AA
chains in the Genus database with same CATH superfamily
1XSLA 5AI4A 2Q0ZX 3HKZF 3WK4A 4EEKA 4O5CA 4KLMA 4G3IA 5L1LA 3B9JA 4DSKA 2AXTU 4ZH4A 2VA8A 5ALHA 4DL4A 5H2FU 4F4XA 5DGAA 2ZIVA 4E0DA 4ECUA 4WJ3B 2DPIA 1MC8A 2HBJA 5DBCA 5ALSA 2K4HA 1Z4OA 3RJHA 3N7RC 4P0QA 5GTIU 2ZG6A 4I2JA 1X9WA 1SL2A 1KN5A 1ZRMA 2YB1A 8ICCA 2EZZA 9ICBA 4ICAA 4MEYA 1ZQOA 4M9GA 2H3FA 4IC9A 2M0NA 5IIOA 4CF5A 4QWAA 9ICJA 3PW0A 3RJEA 2VIXA 3N28A 1IG6A 1TKDA 4R66A 2ASDA 3M9MB 3OTQA 2FDRA 1ZQSA 5KAIU 3GDXA 3C29A 4LVSA 1QH9A 4RT2A 4RNMA 4PL1A 4UBCA 3FC4A 3RJGA 5D46A 8ICRA 3UQ2A 1JI7A 4O3RA 4C4SA 4C0ZA 3E58A 5J2JA 3GV5B 5E79U 4QZHA 1SWVA 2W3SA 1SZHA 3HJEA 1QLNA 4IQVA 1UT8A 3PO4A 3OSPA 2KMDA 4IR1A 2XI9A 3G6YA 9ICGA 1NK5A 3M6KA 3HPOA 4Y2RA 4LZDA 4NM1A 5ALXA 4DQRA 4YVZA 2K4IA 1T3QA 2KOBA 7ICRA 3H40A 1JROA 2XY7A 3KFUF 4Y2XA 3IN5A 3V6KA 2E8NA 5CEHA 4O0IA 1N5XA 3NRWA 5JTIA 1L3UA 4QZIA 4EELA 4UBBA 1DK2A 2M9NA 4R8UB 4DOAA 1QSLA 3IHQB 5CP2A 2PXIA 2W9CA 4HYKA 4NJ8A 2R8IA 2W9BB 2BPCA 7ICVA 1ZD5A 5ALQA 1KW4A 3Q8LA 2B6GA 4B9SA 4FZMA 3U26A 3KTQA 4RQ2A 2W9AA 2NRTA 5KT7A 1BPYA 2FLPA 3GQCA 2JRZA 5AI5A 3AU6A 5CB1A 1IXRA 4Y2YA 8ICIA 2P35A 1JIHA 1PVPA 1ZXIA 3H8MA 3V7LA 4M04A 5KFZA 1EXNA 5EOZA 4I29A 4QWCA 4M9NA 5L1IA 2B0CA 2HMXA 2I1QA 3M1YA 3LWMA 2IOFK 2E8PA 1QQ7A 4A8EA 2LI6A 2HHWA 5KFUA 2BCUA 1FFVA 3LWLA 2NRZA 2YN4A 1ECWA 3G6XA 2KZ3A 1COKA 1SKWA 1Q3VA 3M8SA 3BS5B 3ZDEA 4YR2A 3CYMA 3RJKA 3NVWA 4J9OA 5J2EA 2KN7A 3QU5A 2V4QA 1BPEA 2ZJ5A 2IBKA 7ICIA 1PK1B 4J9RA 1L3SA 2YX8A 1TAUA 3N7PD 3F2DA 2KICA 4F92B 1NKEA 1ZQQA 2E8OA 4K4IA 3RTVA 3MR2A 2A3VA 3Q8KA 4IRCA 5ALUA 4PGXA 4XA5A 5AK3A 5KT4A 4QZGA 1YT3A 1N63A 3GU3A 1S10A 2WF6A 5EE0A 1ZQFA 1JN3A 3E2EA 4J9QA 4EBDA 2R8GA 4KLJA 4Z6CA 1VDVA 3EWAA 1BGXT 1KTQA 8ICYA 5J0PA 4RU9A 2KZMA 4GFJA 2FMSA 3KHLA 4JWNA 2NYVA 4Z6DA 7ICOA 5ALEA 2W43A 1V38A 1NI3A 5IILA 2W9MA 3SENA 3BS5A 2F1HA 4QIWF 3D2SA 3RR8A 3AEVA 5J0SA 2HVIA 2K4PA 5J0TA 1LKYA 2BGWA 4EBEA 1MN8A 2GWSA 1K1QA 4YR3A 5KG3A 5JUMA 2AHOB 2B21A 4NLCA 1Y88A 5ALRA 3RB3A 1L3TA 3GV7B 3QXGA 1NK0A 2ATLA 1NZBA 3ED5A 2BQ3A 4YN4A 3NUQA 3UQ0A 3EYZA 2NRWA 4OD0A 4I28A 3OJSA 5J2CA 1RYSA 4M9LA 3DDHA 3QE9Y 3BS7A 5J0OA 4NLNA 1C7YA 8ICWA 1D9DA 2F77X 4O3OA 2PKEA 3ZDBA 4CGZA 3DV9A 5AKIA 4UB4A 3OHAA 2JV3A 4C4RA 3N4MB 3BQ2A 5HR7A 5DB9A 2QKQA 4BWMA 4IL6U 4KLOA 4I2IA 2AGQA 3PO5A 2DGZA 1U45A 1YZ6A 9ICKA 7ICKA 9ICNA 4BJQA 5J0YA 3BQ1A 3SEIA 1L7MA 4ACOA 3TI0A 1F5SA 1NK4A 2FLLA 2HOFA 4F5PA 4ECQA 3KHGA 4Q8FA 3EW9A 2JZBB 3RAXA 5J2FA 2J6UA 3IG5A 4OJ6A 4Y2SA 4GXJA 9ICEA 1MQ3A 4MFFA 2OWOA 3TANA 3MFIA 2JH1A 1S77D 1T94A 1PK3A 5A0LA 3FYHA 5BOMA 2N1RA 5BPCA 3SZ2A 3C21A 8ICPA 3SAFA 4ECVA 1ZD3A 2F2AB 5AI6A 9ICWA 4UB5A 1ZQVA 3GIJA 4EENA 4EZ6A 1VJ5A 4EZ9A 2ZIUB 4DL5A 4F4KA 2XY6A 4KLSA 4C8KA 3ISDA 3RBDA 5F9LA 1OW5A 1XC9A 1QSYA 3C5GA 9ICPA 5J0WA 4DFDA 3IDWA 2EDUA 4CNQA 1RDFA 3RAQA 3TAPA 1TK0A 2KG5A 4C8MA 4PHEA 4UQGA 1X6JA 5KT2A 5ALTA 3WKDA 4QZEA 2JEIA 3M8RA 2RHFA 2PI4A 4DQQA 3GIIA 1SKRA 1TVAA 2HOQA 2WF9A 5D49A 2OYYA 3QYPA 3N97B 5B66U 8ICLA 7ICGA 2HI0A 2IA6A 1SB3C 3NTUA 5ALJA 2BQUA 5ALYA 4RQ8A 2XC9A 3TADA 2DFLA 2MUTA 4QWDA 2PFOA 3A0HU 1SXEA 4PZNA 5AM2A 2LYBA 4BXOB 1A77A 2E5SA 2ASLA 3PR4A 4O3SA 4DS5A 2IMWP 1SV4A 2BR0A 9ICSA 3EZ5A 3V72A 3L3FX 5AKZA 1NK9A 4KLLA 5J8YA 2G08A 4J9PA 3PW2A 1BNPA 4Y2UA 1DOQA 8ICAA 2FMQA 3UPQA 1NJWA 4DL3A 1X40A 2MSNA 2DQNB 4M6WB 4F4YA 4DO9A 4PJ0U 2OM6A 2KIWA 4RPZA 2KHQA 4RQ4A 2DWQA 2ZXIA 2I6XA 3AL0B 3LVVA 5ALWA 5AKEA 2WTFA 2ZIWA 4C80A 2ZTCA 5DG8A 4BWJA 2FE9A 4UB6U 3GIMA 2W7PA 2RQ5A 4EYIB 9ICVA 2LKYA 2I5HA 3MGVA 4ED7A 2ZIVB 5KFPA 4C8LA 2UVUA 1IM4A 5ALVA 5AM3A 1ZQNA 5KFJA 2AH5A 2OXOA 2F1JA 1SIJA 2K8CB 5KG6A 3NVVA 5EWGA 5J0RA 3MR6A 2JGAA 1RYUA 2BDUA 4P0QB 3K1RB 4F4ZA 3C23A 3H0MB 4P4OA 5AKLA 5AK4A 3D6JA 4UAWA 3IV6A 5L1KA 3MBYA 5CA7A 2F44A 4M6WA 3BZCA 5B5EU 1O08A 2F3NA 5AIAA 5J29A 3UMCA 2KVSA 4PZOA 2W54A 4F5NA 1ZQAA 1JXLA 3RRHA 5D4BA 1S0MA 5IINA 4MFAA 1K5OA 2Y0SC 3QX7A 4YCXA 3ZDAA 1ZQWA 5KFYA 1DRGA 5DQIA 4Q44A 3UXOA 1A0PA 1QQ6A 3ONNA 4KMUA 1HUOA 3HX0A 4O3PA 3C5FA 4FZNA 4ECZA 4ECTA 4PHAA 3M7DA 2HHVA 3C28A 2Z7JA 3AQFA 4M47A 3K75D 2P6UA 2HHTA 2E1EA 3PV8A 3RJJA 3G6VA 4QW9A 2E1FA 4KN4A 5DLGA 4RUAA 3KHRA 1XO1A 4JWMA 1X42A 4YR0A 1KKXA 1L8OA 1FFUA 4GIBA 1ZD2P 5KG2A 3L5KA 1XWLA 1ZQPA 1KRPA 2ES6A 4DQSA 2W9CB 2Y1JA 2RLTA 4F3OA 4PPXA 4AYBF 4DSEA 1S9FA 2XVTA 1T8EA 4JV1A 4Q8EA 4K4HA 5F9NA 2O6KA 4QZDA 1AROP 4O9MA 3TACB 1J2NA 3KD3A 4IRKA 1TE2A 1KEJA 2KP7A 4YG2A 1U47A 3C1YA 4CF4A 2FI1A 4DOCA 4M0AA 4M2YA 1KSPA 2LHTA 3JPRA 3PSIA 4OJOA 3H8WA 1JMSA 3NVYA 4FZLA 4OO1J 2ZTDA 3A0BU 1SKSA 4ED8A 1BVSA 4YMNA 5KFQA 3PSPA 1X6IA 3NASA 3T5LA 2Y9TA 1JXEA 3F2BA 4MHVA 4B9UA 2HHSA 1WYGA 2OHFA 5ALFA 4Q45A 1ZETA 4CDGA 1L7NA 4CCHA 2NO5A 2JEJA 4F50A 4QW8A 3ZDDA 1IV8A 5DGBA 4J9LA 3H0RB 3MR5A 8ICVA 4F2SA 4US9A 4PGYA 4JB3A 4DFJA 2JR5A 2AU0A 4I2GA 3UMBA 1QSSA 4NY8A 4ED1A 4I2CA 4BUGA 2W8LA 5IIKA 4C7ZA 5KAFU 5CHGA 3WU2U 2XCAA 1JX4A 3AU2A 4RQ3A 5AI0A 3QNMA 1BPBA 1CRXA 2ESEA 1N62A 3C2MA 9ICIA 8ICFA 3RH4A 8ICMA 2WB1F 1XS9D 5AM1A 3QU7A 3WK9A 4EYHB 2MAXA 1TV9A 2QARA 5G5HA 3H4BA 1ZQYA 1B22A 3KHHA 1NK7A 2IOFA 1O03A 4IR9A 4NWIA 5J2GA 4LZGA 5GTHU 1ZQ1C 4TUSA 2BKEA 2LBOA 3KKAC 1LKYB 4NM2A 3FDSA 1ZQIA 2DKZA 1ZQCA 2HCFA 4KTQA 1ZQMA 3I1YA 5AKJA 4GLXA 1S0VA 2KEYA 3B0XA 4O5EA 1ZQUA 4FE3A 3TQ1A 3ISBA 8ICOA 4C8OA 2ZUDA 3PR5B 1ZQBA 1S0OA 3MGIA 3NVZA 8ICTA 2ZIXA 2KKPA 3MDAA 1ZD4A 4UATA 1PUZA 1WG8A 4OCZA 1BPXA 1LVHA 1D8BA 2PMZF 1SV0A 4F5RA 2YTUA 3FM9A 3AMZA 1D8YA 2HSZA 4NLBA 4KLUA 3C1ZA 1SWWA 4P4PA 4JV2A 1WWVA 2KJ8A 9ICOA 4CRXA 8ICGA 3PW5A 2KSOA 4UB8U 1ZQLA 3VC8A 1NK8A 4DQPA 5G5GA 8ICUA 5ALOA 5ALMA 2WHEA 5ALDA 4DLGA 2JEGA 3UXPA 5KFXA 4JUZA 1S0NA 5KFVA 4ED6A 5KFKA 1B4FA 8ICZA 7ICLA 3HP6A 4TURA 2GOLA 2DPJA 4U6PA 3T5JA 5DLFA 4GC7A 2A1AA 2FMPA 2BPFA 4DSJA 1F0MA 4PHPA 3PW4A 2IHNA 4QZFA 4NL9A 4PHDA 2G09A 4IRDA 1M6YA 5HHHA 3RBEA 4X5VA 3NS1A 4O3MA 7ICFA 1RG6A 3ZD9A 5KFHA 7ICQA 5F3XB 5FP0A 1ZQRA 1JUDA 3JPQA 3Q8QB 2ZTEA 3WKEA 2V9WA 2W04A 4UARA 4FS2A 5HHIA 1UA0A 4ECYA 4OJLA 3UMGA 3C2KA 4B9NA 4F8RA 4C8NA 4Z6FA 3UXNA 2UVRA 5DB8A 3EPGA 1HJPA 2P6RA 3SV4A 1IIPA 1TK8A 2WF5A 4RQNA 2K8BB 3M6ZA 2NRXA 3Q8SB 4RZRA 7ICEA 5KFMA 1RQNA 3ALRA 1Z1VA 3OSNA 1KDHA 1YZ7A 4USAA 2H3VA 3SI8A 3ETRA 2VA3A 3ZDCA 4O3QA 2KJ9A 1Q3UA 3SMVA 1DGJA 4HAIA 4RPYA 4ED2A 1ZQZA 3MABA 2CXYA 2R8HA 2KVCA 1WCLA 2H3QA 1U4BA 1NKBA 1N5WA 5J2DA 3PMLA 5CJ7A 2MUTB 2GH1A 1HEKA 5KNIA 1WCNA 5EWEA 3S6JA 2BQRA 4KN7A 3GV8B 5IIIA 5JRTA 2KFNA 4KLIA 7ICTA 3EUB2 3ISCA 3TFSA 1XSPA 2OEHA 2YB4A 3BZKA 4I2EA 2KHVA 4IS7A 5J0UA 1U49A 1NZPA 4QIWC 1LV5A 1RXVA 3BQTA 2XICA 5DQGA 2H3IA 3JPOA 1RM6C 5K4LA 7ICNA 2F8KA 1TAMA 2ZXHA 3OJUA 3JPSA 4EBCA 2FPMA 3ETLA 3HWTA 3IM1A 1S97A 4DCCA 1X9SA 2D3DA 1J2MA 1UCVA 3QEAZ 7ICHA 5J2HA 4RNNA 4DLEA 2VANA 5L9XA 5AIBA 7ICPA 4YQWA 1ZQJA 2BCVA 4IQTA 1UA1A 4F4WA 3T5HA 3T5KA 8ICXA 2ZIWB 4B9LA 2WF8A 1UHUA 1MQ2A 2XGPA 3KOOA 5C5JA 2RRDA 4C7YA 1NK6A 9ICXA 4QNLA 3ICXA 5DDMA 5HP4A 4I2BA 2H3ZA 4Y2TA 2W11A 2Y0SF 4DSLA 3MR3A 5KFAA 2W03A 1N56A 5HNKA 3TAQA 3HILA 2D6FC 5KT5A 2QB0A 2WAQC 4YP3A 1S8OA 3MFHA 3TKAA 4UB1A 3L4PA 1KLNA 4FFDA 1NJXA 3RRGA 2G07A 4DL2A 4UW9A 1KL9A 3EPIA 2G5IB 4J9SA 4F5QA 5AKKA 4TQSA 4DFPA 3THVA 1MA7A 3MC1A 1L7PA 3NGDA 4RQ7A 4QWBA 4B6JA 3Q8MA 3QUTA 2FPLA 2KV2A 3QUBA 3GILA 4EX6A 2R8JA 3FAHA 3QU2A 5L1MA 4M9HA 3BDPA 7ICMA 4CF3A 3PZPA 2JEFA 3OGUA 2VA2A 4FBTA 1ZQKA 1HUZA 3LYSA 4B9TA 1SZPA 4MF8A 5KFLA 2KTQA 5KT6A 2EZYA 4RPXA 2R8KA 3E0FA 2WF7A 9ICUA 3KKAA 1ZQEA 4RQ6A 4GXKA 3BQ0A 3RJFA 2BHNA 5KT3A 2H5XA 2BCQA 1A76A 1T7PA 5ALPA 4YXMA 5J0QA 1RXWA 3PW7A 4XUSA 1Z3EB 3WK6A 4RT3A 3PX6A 8ICEA 5KFRA 5DBBA 2A19A 1S5LU 2MU2A 5KFEA 8ICKA 4F2RA 4QZBA 1MSWD 1C20A 1N48A 2NO4A 3RB4A 4F91B 2HBMA 3C2LA 1P7DA 4TUPA 8ICJA 9ICHA 3WKBA 1BPZA 2AJQA 4KLGA 2E3TA 2BPGA 1ZQTA 4FO6A 2KJ5A 4M9JA 5KG5A 4DFKA 2D8CA 4NXZA 1XNSA 4YD1A 1SL1A 1Q8KA 4I2DA 5ALIA 3RFAA 3ORYA 1Z00A 4UAZA 5EWFA 3QEBZ 4P2HA 3H4DA 3B0YA 4LJXA 3WKAA 4BX9C 2NRVA 1TFRA 7ICSA 4ED3A 3TARA 2EAMA 5KG7A 5J2BA 4NLZA 2A1JA 3V7JA 1D9FA 3QUCA 4UAYA 4KLDA 2W7OA 1ZYQA 4JMUA 1UQVA 3F53A 4Y2QA 1FIQA 3SAGA 1PVQA 5HMLA 5J2AA 4DQIA 2KK0A 4PGQA 3TFRA 2KNJA 5DB6A 2BZFA 1QCKA 4YMOA 1H38A 2FPKA 8ICBA 2MRLA 2NV3A 5CRXA 2YMQA 4RQ0A 3QU4A 4RQMA 4DL7A 1X66A 3PNCA 4EX7A 9ICQA 5KFFA 2LYAA 4NV0A 3F2CA 4OJPA 5J2KA 2Y9UA 9ICAA 5AI8A 2KD1A 5J0XA 3PMNA 1L5UA 5HR6A 2QLTA 4RUCA 4DF4A 3AUOA 5DG7A 2QARB 7ICUA 2PFPA 1OUQA 2HDOA 4JV0A 2IOHA 4UAVA 4MEXA 1VLBA 3HRDD 2HOIA 1SGGA 5AHXA 2W8KA 3TADC 1KFTA 2PI5A 2Y1IA 2BDPA 4UB3A 2CPRA 5DQHA 5KFDA 4DFMA 2YY6A 3LVWA 3HKZC 2AGOA 5ALNA 1PZNA 4J9MA 2ZIXB 4KLTA 3AN1A 5KFTA 4K4GA 4RNOA 1QQ5A 1NJZA 2OCEA 1ZQDA 2XCPA 4Y2PA 5J8YC 2RDIA 4NLKA 3PX4A 5HMMA 3LK9A 2HHXA 3QZ8A 1CUKA 2KSOB 4RQ5A 3WK5A 5TZVA 1RPLA 1ZOLA 1J97A 2XGQA 1N2XA 4QZ8A 2RP5A 4B9VA 2MA1A 2VKQA 4GC6A 1KBUA 1Z1BA 5IIMA 5KTQA 2DL0A 5AK6A 1GO3F 5ALGA 4ED0A 2EQYA 4KLHA 4UASA 3F5AA 4DS4A 2JXJA 4IQWA 3WK8A 2K60A 3M9NB 2ZJ8A 1Z19A 9ICTA 1QTMA 4QZCA 5KFBA 1COOA 4AYBC 5ALLA 3MGHA 4R63A 5KL8B 4XRHA 2HBLA 2HHUA 3H7IA 9ICCA 3N7SC 2K89A 4R8UA 3GZFA 1D8LA 3PSTA 5KFSA 2PFNA 3RH6A 1V97A 2K4EA 2KIVA 2LMRA 3H8SA 2W3RA 2W9BA 2KZZA 2XIDA 4J03A 2EAPA 1S76D 2BCSA 2GLEA 1Z4NA 3KZXA 5AKXA 5ALKA 2DKXA 2F1IA 8ICSA 2K8AA 1RQLA 4AP9A 3AQEA 2ALZA 3PX0A 1KFSA 3VCBA 4ELTA 1DXSA 2DUYA 4KX5A 5AKGA 4DF8A 1K1SA 4KITB 1U9LA 3JPNA 1DK3A 2AQ4A 2DF4B 3SQIA 2IHMA 1BNOA 5IIJA 2ISPA 1NOMA 4F71A 4F5OA 1ZQHA 2JH7A 2KFZA 1DGSA 4I2FA 2J6TA 3OHBA 3PY8A 1X9XA 3D2QA 2AGPA 2ZUBA 1PK1A 4Q43A 4I2AA 2C2DA 2OH2A 2HVHA 2DBYA 3JPTA 3K1ZA 1OXJA 5L1JA 3SR6A 2C28A 4MFCA 2WB1C 2AQ0A 4F72A 2JHDA 2HHQA 5KG1A 3SAHA 1FO4A 3D2NA 2P66A 1SXDA 9ICFA 3RH5A 1ZQXA 5KFCA 1WWUA 3Q8PB 3SV3A 2PFQA 2I9GA 5KFIA 5KL1B 4EEYA 3ZI4A 4G9BA 3GFKB 3F5EA 5T14A 4B9MA 1RZTA 3V6HA 1L6NA 5J2IA 2HBKA 3PSFA 1ED1A 2WAQF 4PH5A 5DG9A 4DWIA 4U7CA 2ODGA 3MDCA 1NJYA 3QU9A 1SL0A 4NLGA 1N60A 1AQ6A 3ZD8A 4P0PB 2J6SA 5JU5A 5DKWA 1XU4A 1B43A 4RQ1A 4QJFB 1N61A 1X9MA 3KZIU 4JK1A 2PMZC 2F8LA 5AK5A 4KLEA 9ICLA 3HW8A 4YD2A 2R18A 9ICRA 4DSFA 1UPHA 3WK7A 1F44A 2YQEA 4DL6A 1RYRA 1CI4A 4GXIA 2XO7A 4KLFA 2C2EA 2QB0B 2RDJA 1ZRNA 4ELVA 5C0YA 5AM4A 3I28A 1JALA 2G0AA 3GIKA 4Z6EA 5AKYA 4YMMA 5BOLA 3HT3A 4R65A 3RF9A 2W55A 1XO0A 1NNLA 3RB0A 1L7OA 3RJIA 4O3NA 2LPEA 5AICA 4ECSA 3KBBA 4ECWA 2ISOA 1A6SA 3CW2C 1L3VA 1ZJMA 3T79A 4P0PA 4MF2A 2L5YA 5DBAA 1WUDA 7ICJA 4TQRA 3M9OB 5CR0A 1LB2B 5KFWA 4P4MA 2XY5A 4UAUA 4QZ9A 4US8A 1X2IA 5AI9A 1L8LA 2E8MA 3J81j 4DSIA 2JZBA 1Q46A 3Q8RB 3UM9A 2LM1A 4Y2VA 2G06A 3JPPA 3O0FA 2EAOA 3CP8A 4FBUA 2VJ5A 3I76A 4I2HA 1B0XA 2EH9A 5ALZA 5TISU 1FEZA 2BCRA 2CRXA 3OPXA 1V9PA 4BDPA 5EE1A 2YMPA 2G5HB 3BJYA 4BGDA 5DDYA 4J9NA 4I27A 3H8JA 2ZIUA 1UT5A 4ECRA 5AM0A 4PL2A 1JRPA 1T3NA 3CRXA 3LDAA 1XSNA 2V4RA 1NKCA 4R64A 2KE7A 3NRZA 2HW3A 8ICQA 3IG8A 5EE9A 3SD7A 1SV0C 2QB1A 3AM9A 4QZAA 4YXJA 1BPDA 2YMLA 3RR7A 5KFGA 4XQ8A 4KX3A 1PVRA 4DEZA 5DB7A 1TAQA 4C4TA 3IRUA 3DEEA 1ZJNA 3V6JA 4CE6A 4KLQA 4J9KA 2LYHA 1KFDA 4IQUA 2LM4A 4OJ5A 1ZQGA 2UVWA 2GO7A 5CWRA 5EE3A 1CEZA 2CN1A 3V7KA 4O5KA 1T4GA 4Y2JA 1Z00B 3T3FA 5KG4A 9ICMA 2WFAA 2JMGA 2ASJA 4NL9C 2F76X 4ZOHC 2C22A 2FLNA 8ICHA 4F93B 1URJA 3CNHA 2VJ4A 4ELUA 2KKVA 4QWEA 3WKCA 5KG0A 2Q4TA 4FS1A 4BXOA 5KFNA 3R9KA 3BQ7A 2A1JB 3RB6A 2C2RA 4TUQA 4YFKA 2EANA 3QUQA 3IP4B 2ZJAA 4DOBA 3K4GA 3PVXA 2EZXA 5AKHA 2ZUCA 5KFOA 1U48A 1TK5A 3QZ7A 2YMMA 8ICNA 3SYZA 2FJ6A 2UVVA 3H0LB 1V85A 1KQQA 4KMOB 4ECXA 4UB2A 5AM5A 1HIWA
chains in the Genus database with same CATH topology
2KOBA 4PL2A 2A3VA 2PMZC 2F8LA 4QIWC 3CRXA 2XICA 5HR7A 4NWIA 2DF4B 2H3IA 3KFUF 1ZQ1C 3HKZF 1TAMA 3IG8A 2ZXHA 3LYSA 2LBOA 2R18A 2W04A 2DGZA 3IN5A 4JMUA 1UPHA 2W7OA 3F53A 1F44A 1YT3A 3NRWA 3E0FA 3GU3A 2LHTA 4OJLA 3SAGA 3PSIA 4OJOA 2JH7A 4BJQA 1PVQA 4ACOA 4FZLA 4KX3A 2ZIVA 2KEYA 2LYBA 4OO1J 2KNJA 4FE3A 1PVRA 2HOFA 4WJ3B 2E5SA 3D2QA 2RP5A 3DEEA 2HBJA 2MA1A 2MRLA 2VKQA 1KBUA 5C0YA 4GFJA 2K4HA 1Z1BA 2G0AA 2NV3A 2ZIWB 3IG5A 4OJ6A 1IIPA 2ZIXA 3PSPA 4OJ5A 2OH2A 3N7RC 1GO3F 4P0QA 4FZMA 2Y0SC 2KKPA 2ZG6A 2K8BB 3L3FX 5CRXA 3M6ZA 2G08A 2JH1A 3F2BA 1DRGA 3K1ZA 3RF9A 3F5AA 1A0PA 1T94A 2YB1A 2RRDA 1D8BA 3ONNA 4CDGA 1Z19A 2PMZF 1PVPA 3ALRA 1XO0A 2CN1A 4QIWF 2LYAA 4NV0A 4ICAA 4OJPA 3ICXA 4QNLA 4NLBA 2DQNB 2WB1C 5A0LA 3F2CA 2JHDA 2N1RA 2H3FA 2H3ZA 2KJ8A 2H3VA 3H0RB 4FZNA 4IC9A 3SAHA 4AYBC 1A6SA 3D2NA 2Y0SF 4CRXA 2OM6A 3SAFA 2M0NA 2KIWA 3M7DA 3T79A 2KD1A 2F2AB 5KL8B 4P0PA 2JMGA 5HR6A 2KJ9A 2HBLA 3C28A 2F76X 2VIXA 2W03A 1Q3UA 2Z7JA 3SMVA 1WUDA 3AQFA 4NLCA 2D6FC 1URJA 2WAQC 2KHQA 2VJ4A 4BUGA 2ZIUB 3VC8A 3N7SC 5KL1B 2HBMA 2HMXA 2KKVA 2K89A 2ZXIA 1P7DA 3AL0B 2Q4TA 1OUQA 4A8EA 3GZFA 3C29A 3LVVA 2E1EA 1NZBA 3PSTA 2KVCA 3F5EA 2E1FA 5T14A 4PL1A 2G07A 2H3QA 2K4EA 3NUQA 1L6NA 1ECWA 2HBKA 2ZIWA 2XIDA 3PSFA 3PZPA 1ED1A 2WAQF 3IP4B 2KJ5A 1CRXA 1Q3VA 2HOIA 2G06A 2G5IB 4C0ZA 2GH1A 4U7CA 2W7PA 3SQIA 3O0FA 3KZXA 1HEKA 1SZHA 2GOLA 3CP8A 3CYMA 3D2SA 4U6PA 2VJ5A 2LKYA 1XNSA 1MA7A 3MGVA 2ZIVB 2CPRA 2XI9A 2K8AA 3LVWA 3RFAA 4P0PB 2WB1F 2KV2A 2F77X 2CRXA 2OXOA 2YX8A 2K8CB 3AQEA 2G09A 4O3MA 3N7PD 2RHFA 3OPXA 3HKZC 4AYBF 4CGZA 3H0LB 4QJFB 3F2DA 2JGAA 4KMOB 3VCBA 2ZIXB 2G5HB 2KICA 3M6KA 2XVTA 2BDUA 4P0QB 2YB4A 4KX5A 4BX9C 2ZIUA 1HIWA 2KHVA 2HOQA 2K4IA 3H0MB 2OYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSP A;  3PST A;  2K8C B;  3L3F X;  2K89 A;  2K8B B;  2K8A A; 
#chains in the Genus database with same CATH topology
 1XSL A;  5AI4 A;  2Q0Z X;  3HKZ F;  3WK4 A;  4EEK A;  4O5C A;  4KLM A;  4G3I A;  5L1L A;  3B9J A;  4DSK A;  2AXT U;  4ZH4 A;  2VA8 A;  5ALH A;  4DL4 A;  5H2F U;  4F4X A;  5DGA A;  2ZIV A;  4E0D A;  4ECU A;  4WJ3 B;  2DPI A;  1MC8 A;  2HBJ A;  5DBC A;  5ALS A;  2K4H A;  1Z4O A;  3RJH A;  3N7R C;  4P0Q A;  5GTI U;  2ZG6 A;  4I2J A;  1X9W A;  1SL2 A;  1KN5 A;  1ZRM A;  2YB1 A;  8ICC A;  2EZZ A;  9ICB A;  4ICA A;  4MEY A;  1ZQO A;  4M9G A;  2H3F A;  4IC9 A;  2M0N A;  5IIO A;  4CF5 A;  4QWA A;  9ICJ A;  3PW0 A;  3RJE A;  2VIX A;  3N28 A;  1IG6 A;  1TKD A;  4R66 A;  2ASD A;  3M9M B;  3OTQ A;  2FDR A;  1ZQS A;  5KAI U;  3GDX A;  3C29 A;  4LVS A;  1QH9 A;  4RT2 A;  4RNM A;  4PL1 A;  4UBC A;  3FC4 A;  3RJG A;  5D46 A;  8ICR A;  3UQ2 A;  1JI7 A;  4O3R A;  4C4S A;  4C0Z A;  3E58 A;  5J2J A;  3GV5 B;  5E79 U;  4QZH A;  1SWV A;  2W3S A;  1SZH A;  3HJE A;  1QLN A;  4IQV A;  1UT8 A;  3PO4 A;  3OSP A;  2KMD A;  4IR1 A;  2XI9 A;  3G6Y A;  9ICG A;  1NK5 A;  3M6K A;  3HPO A;  4Y2R A;  4LZD A;  4NM1 A;  5ALX A;  4DQR A;  4YVZ A;  2K4I A;  1T3Q A;  2KOB A;  7ICR A;  3H40 A;  1JRO A;  2XY7 A;  3KFU F;  4Y2X A;  3IN5 A;  3V6K A;  2E8N A;  5CEH A;  4O0I A;  1N5X A;  3NRW A;  5JTI A;  1L3U A;  4QZI A;  4EEL A;  4UBB A;  1DK2 A;  2M9N A;  4R8U B;  4DOA A;  1QSL A;  3IHQ B;  5CP2 A;  2PXI A;  2W9C A;  4HYK A;  4NJ8 A;  2R8I A;  2W9B B;  2BPC A;  7ICV A;  1ZD5 A;  5ALQ A;  1KW4 A;  3Q8L A;  2B6G A;  4B9S A;  4FZM A;  3U26 A;  3KTQ A;  4RQ2 A;  2W9A A;  2NRT A;  5KT7 A;  1BPY A;  2FLP A;  3GQC A;  2JRZ A;  5AI5 A;  3AU6 A;  5CB1 A;  1IXR A;  4Y2Y A;  8ICI A;  2P35 A;  1JIH A;  1PVP A;  1ZXI A;  3H8M A;  3V7L A;  4M04 A;  5KFZ A;  1EXN A;  5EOZ A;  4I29 A;  4QWC A;  4M9N A;  5L1I A;  2B0C A;  2HMX A;  2I1Q A;  3M1Y A;  3LWM A;  2IOF K;  2E8P A;  1QQ7 A;  4A8E A;  2LI6 A;  2HHW A;  5KFU A;  2BCU A;  1FFV A;  3LWL A;  2NRZ A;  2YN4 A;  1ECW A;  3G6X A;  2KZ3 A;  1COK A;  1SKW A;  1Q3V A;  3M8S A;  3BS5 B;  3ZDE A;  4YR2 A;  3CYM A;  3RJK A;  3NVW A;  4J9O A;  5J2E A;  2KN7 A;  3QU5 A;  2V4Q A;  1BPE A;  2ZJ5 A;  2IBK A;  7ICI A;  1PK1 B;  4J9R A;  1L3S A;  2YX8 A;  1TAU A;  3N7P D;  3F2D A;  2KIC A;  4F92 B;  1NKE A;  1ZQQ A;  2E8O A;  4K4I A;  3RTV A;  3MR2 A;  2A3V A;  3Q8K A;  4IRC A;  5ALU A;  4PGX A;  4XA5 A;  5AK3 A;  5KT4 A;  4QZG A;  1YT3 A;  1N63 A;  3GU3 A;  1S10 A;  2WF6 A;  5EE0 A;  1ZQF A;  1JN3 A;  3E2E A;  4J9Q A;  4EBD A;  2R8G A;  4KLJ A;  4Z6C A;  1VDV A;  3EWA A;  1BGX T;  1KTQ A;  8ICY A;  5J0P A;  4RU9 A;  2KZM A;  4GFJ A;  2FMS A;  3KHL A;  4JWN A;  2NYV A;  4Z6D A;  7ICO A;  5ALE A;  2W43 A;  1V38 A;  1NI3 A;  5IIL A;  2W9M A;  3SEN A;  3BS5 A;  2F1H A;  4QIW F;  3D2S A;  3RR8 A;  3AEV A;  5J0S A;  2HVI A;  2K4P A;  5J0T A;  1LKY A;  2BGW A;  4EBE A;  1MN8 A;  2GWS A;  1K1Q A;  4YR3 A;  5KG3 A;  5JUM A;  2AHO B;  2B21 A;  4NLC A;  1Y88 A;  5ALR A;  3RB3 A;  1L3T A;  3GV7 B;  3QXG A;  1NK0 A;  2ATL A;  1NZB A;  3ED5 A;  2BQ3 A;  4YN4 A;  3NUQ A;  3UQ0 A;  3EYZ A;  2NRW A;  4OD0 A;  4I28 A;  3OJS A;  5J2C A;  1RYS A;  4M9L A;  3DDH A;  3QE9 Y;  3BS7 A;  5J0O A;  4NLN A;  1C7Y A;  8ICW A;  1D9D A;  2F77 X;  4O3O A;  2PKE A;  3ZDB A;  4CGZ A;  3DV9 A;  5AKI A;  4UB4 A;  3OHA A;  2JV3 A;  4C4R A;  3N4M B;  3BQ2 A;  5HR7 A;  5DB9 A;  2QKQ A;  4BWM A;  4IL6 U;  4KLO A;  4I2I A;  2AGQ A;  3PO5 A;  2DGZ A;  1U45 A;  1YZ6 A;  9ICK A;  7ICK A;  9ICN A;  4BJQ A;  5J0Y A;  3BQ1 A;  3SEI A;  1L7M A;  4ACO A;  3TI0 A;  1F5S A;  1NK4 A;  2FLL A;  2HOF A;  4F5P A;  4ECQ A;  3KHG A;  4Q8F A;  3EW9 A;  2JZB B;  3RAX A;  5J2F A;  2J6U A;  3IG5 A;  4OJ6 A;  4Y2S A;  4GXJ A;  9ICE A;  1MQ3 A;  4MFF A;  2OWO A;  3TAN A;  3MFI A;  2JH1 A;  1S77 D;  1T94 A;  1PK3 A;  5A0L A;  3FYH A;  5BOM A;  2N1R A;  5BPC A;  3SZ2 A;  3C21 A;  8ICP A;  3SAF A;  4ECV A;  1ZD3 A;  2F2A B;  5AI6 A;  9ICW A;  4UB5 A;  1ZQV A;  3GIJ A;  4EEN A;  4EZ6 A;  1VJ5 A;  4EZ9 A;  2ZIU B;  4DL5 A;  4F4K A;  2XY6 A;  4KLS A;  4C8K A;  3ISD A;  3RBD A;  5F9L A;  1OW5 A;  1XC9 A;  1QSY A;  3C5G A;  9ICP A;  5J0W A;  4DFD A;  3IDW A;  2EDU A;  4CNQ A;  1RDF A;  3RAQ A;  3TAP A;  1TK0 A;  2KG5 A;  4C8M A;  4PHE A;  4UQG A;  1X6J A;  5KT2 A;  5ALT A;  3WKD A;  4QZE A;  2JEI A;  3M8R A;  2RHF A;  2PI4 A;  4DQQ A;  3GII A;  1SKR A;  1TVA A;  2HOQ A;  2WF9 A;  5D49 A;  2OYY A;  3QYP A;  3N97 B;  5B66 U;  8ICL A;  7ICG A;  2HI0 A;  2IA6 A;  1SB3 C;  3NTU A;  5ALJ A;  2BQU A;  5ALY A;  4RQ8 A;  2XC9 A;  3TAD A;  2DFL A;  2MUT A;  4QWD A;  2PFO A;  3A0H U;  1SXE A;  4PZN A;  5AM2 A;  2LYB A;  4BXO B;  1A77 A;  2E5S A;  2ASL A;  3PR4 A;  4O3S A;  4DS5 A;  2IMW P;  1SV4 A;  2BR0 A;  9ICS A;  3EZ5 A;  3V72 A;  3L3F X;  5AKZ A;  1NK9 A;  4KLL A;  5J8Y A;  2G08 A;  4J9P A;  3PW2 A;  1BNP A;  4Y2U A;  1DOQ A;  8ICA A;  2FMQ A;  3UPQ A;  1NJW A;  4DL3 A;  1X40 A;  2MSN A;  2DQN B;  4M6W B;  4F4Y A;  4DO9 A;  4PJ0 U;  2OM6 A;  2KIW A;  4RPZ A;  2KHQ A;  4RQ4 A;  2DWQ A;  2ZXI A;  2I6X A;  3AL0 B;  3LVV A;  5ALW A;  5AKE A;  2WTF A;  2ZIW A;  4C80 A;  2ZTC A;  5DG8 A;  4BWJ A;  2FE9 A;  4UB6 U;  3GIM A;  2W7P A;  2RQ5 A;  4EYI B;  9ICV A;  2LKY A;  2I5H A;  3MGV A;  4ED7 A;  2ZIV B;  5KFP A;  4C8L A;  2UVU A;  1IM4 A;  5ALV A;  5AM3 A;  1ZQN A;  5KFJ A;  2AH5 A;  2OXO A;  2F1J A;  1SIJ A;  2K8C B;  5KG6 A;  3NVV A;  5EWG A;  5J0R A;  3MR6 A;  2JGA A;  1RYU A;  2BDU A;  4P0Q B;  3K1R B;  4F4Z A;  3C23 A;  3H0M B;  4P4O A;  5AKL A;  5AK4 A;  3D6J A;  4UAW A;  3IV6 A;  5L1K A;  3MBY A;  5CA7 A;  2F44 A;  4M6W A;  3BZC A;  5B5E U;  1O08 A;  2F3N A;  5AIA A;  5J29 A;  3UMC A;  2KVS A;  4PZO A;  2W54 A;  4F5N A;  1ZQA A;  1JXL A;  3RRH A;  5D4B A;  1S0M A;  5IIN A;  4MFA A;  1K5O A;  2Y0S C;  3QX7 A;  4YCX A;  3ZDA A;  1ZQW A;  5KFY A;  1DRG A;  5DQI A;  4Q44 A;  3UXO A;  1A0P A;  1QQ6 A;  3ONN A;  4KMU A;  1HUO A;  3HX0 A;  4O3P A;  3C5F A;  4FZN A;  4ECZ A;  4ECT A;  4PHA A;  3M7D A;  2HHV A;  3C28 A;  2Z7J A;  3AQF A;  4M47 A;  3K75 D;  2P6U A;  2HHT A;  2E1E A;  3PV8 A;  3RJJ A;  3G6V A;  4QW9 A;  2E1F A;  4KN4 A;  5DLG A;  4RUA A;  3KHR A;  1XO1 A;  4JWM A;  1X42 A;  4YR0 A;  1KKX A;  1L8O A;  1FFU A;  4GIB A;  1ZD2 P;  5KG2 A;  3L5K A;  1XWL A;  1ZQP A;  1KRP A;  2ES6 A;  4DQS A;  2W9C B;  2Y1J A;  2RLT A;  4F3O A;  4PPX A;  4AYB F;  4DSE A;  1S9F A;  2XVT A;  1T8E A;  4JV1 A;  4Q8E A;  4K4H A;  5F9N A;  2O6K A;  4QZD A;  1ARO P;  4O9M A;  3TAC B;  1J2N A;  3KD3 A;  4IRK A;  1TE2 A;  1KEJ A;  2KP7 A;  4YG2 A;  1U47 A;  3C1Y A;  4CF4 A;  2FI1 A;  4DOC A;  4M0A A;  4M2Y A;  1KSP A;  2LHT A;  3JPR A;  3PSI A;  4OJO A;  3H8W A;  1JMS A;  3NVY A;  4FZL A;  4OO1 J;  2ZTD A;  3A0B U;  1SKS A;  4ED8 A;  1BVS A;  4YMN A;  5KFQ A;  3PSP A;  1X6I A;  3NAS A;  3T5L A;  2Y9T A;  1JXE A;  3F2B A;  4MHV A;  4B9U A;  2HHS A;  1WYG A;  2OHF A;  5ALF A;  4Q45 A;  1ZET A;  4CDG A;  1L7N A;  4CCH A;  2NO5 A;  2JEJ A;  4F50 A;  4QW8 A;  3ZDD A;  1IV8 A;  5DGB A;  4J9L A;  3H0R B;  3MR5 A;  8ICV A;  4F2S A;  4US9 A;  4PGY A;  4JB3 A;  4DFJ A;  2JR5 A;  2AU0 A;  4I2G A;  3UMB A;  1QSS A;  4NY8 A;  4ED1 A;  4I2C A;  4BUG A;  2W8L A;  5IIK A;  4C7Z A;  5KAF U;  5CHG A;  3WU2 U;  2XCA A;  1JX4 A;  3AU2 A;  4RQ3 A;  5AI0 A;  3QNM A;  1BPB A;  1CRX A;  2ESE A;  1N62 A;  3C2M A;  9ICI A;  8ICF A;  3RH4 A;  8ICM A;  2WB1 F;  1XS9 D;  5AM1 A;  3QU7 A;  3WK9 A;  4EYH B;  2MAX A;  1TV9 A;  2QAR A;  5G5H A;  3H4B A;  1ZQY A;  1B22 A;  3KHH A;  1NK7 A;  2IOF A;  1O03 A;  4IR9 A;  4NWI A;  5J2G A;  4LZG A;  5GTH U;  1ZQ1 C;  4TUS A;  2BKE A;  2LBO A;  3KKA C;  1LKY B;  4NM2 A;  3FDS A;  1ZQI A;  2DKZ A;  1ZQC A;  2HCF A;  4KTQ A;  1ZQM A;  3I1Y A;  5AKJ A;  4GLX A;  1S0V A;  2KEY A;  3B0X A;  4O5E A;  1ZQU A;  4FE3 A;  3TQ1 A;  3ISB A;  8ICO A;  4C8O A;  2ZUD A;  3PR5 B;  1ZQB A;  1S0O A;  3MGI A;  3NVZ A;  8ICT A;  2ZIX A;  2KKP A;  3MDA A;  1ZD4 A;  4UAT A;  1PUZ A;  1WG8 A;  4OCZ A;  1BPX A;  1LVH A;  1D8B A;  2PMZ F;  1SV0 A;  4F5R A;  2YTU A;  3FM9 A;  3AMZ A;  1D8Y A;  2HSZ A;  4NLB A;  4KLU A;  3C1Z A;  1SWW A;  4P4P A;  4JV2 A;  1WWV A;  2KJ8 A;  9ICO A;  4CRX A;  8ICG A;  3PW5 A;  2KSO A;  4UB8 U;  1ZQL A;  3VC8 A;  1NK8 A;  4DQP A;  5G5G A;  8ICU A;  5ALO A;  5ALM A;  2WHE A;  5ALD A;  4DLG A;  2JEG A;  3UXP A;  5KFX A;  4JUZ A;  1S0N A;  5KFV A;  4ED6 A;  5KFK A;  1B4F A;  8ICZ A;  7ICL A;  3HP6 A;  4TUR A;  2GOL A;  2DPJ A;  4U6P A;  3T5J A;  5DLF A;  4GC7 A;  2A1A A;  2FMP A;  2BPF A;  4DSJ A;  1F0M A;  4PHP A;  3PW4 A;  2IHN A;  4QZF A;  4NL9 A;  4PHD A;  2G09 A;  4IRD A;  1M6Y A;  5HHH A;  3RBE A;  4X5V A;  3NS1 A;  4O3M A;  7ICF A;  1RG6 A;  3ZD9 A;  5KFH A;  7ICQ A;  5F3X B;  5FP0 A;  1ZQR A;  1JUD A;  3JPQ A;  3Q8Q B;  2ZTE A;  3WKE A;  2V9W A;  2W04 A;  4UAR A;  4FS2 A;  5HHI A;  1UA0 A;  4ECY A;  4OJL A;  3UMG A;  3C2K A;  4B9N A;  4F8R A;  4C8N A;  4Z6F A;  3UXN A;  2UVR A;  5DB8 A;  3EPG A;  1HJP A;  2P6R A;  3SV4 A;  1IIP A;  1TK8 A;  2WF5 A;  4RQN A;  2K8B B;  3M6Z A;  2NRX A;  3Q8S B;  4RZR A;  7ICE A;  5KFM A;  1RQN A;  3ALR A;  1Z1V A;  3OSN A;  1KDH A;  1YZ7 A;  4USA A;  2H3V A;  3SI8 A;  3ETR A;  2VA3 A;  3ZDC A;  4O3Q A;  2KJ9 A;  1Q3U A;  3SMV A;  1DGJ A;  4HAI A;  4RPY A;  4ED2 A;  1ZQZ A;  3MAB A;  2CXY A;  2R8H A;  2KVC A;  1WCL A;  2H3Q A;  1U4B A;  1NKB A;  1N5W A;  5J2D A;  3PML A;  5CJ7 A;  2MUT B;  2GH1 A;  1HEK A;  5KNI A;  1WCN A;  5EWE A;  3S6J A;  2BQR A;  4KN7 A;  3GV8 B;  5III A;  5JRT A;  2KFN A;  4KLI A;  7ICT A;  3EUB 2;  3ISC A;  3TFS A;  1XSP A;  2OEH A;  2YB4 A;  3BZK A;  4I2E A;  2KHV A;  4IS7 A;  5J0U A;  1U49 A;  1NZP A;  4QIW C;  1LV5 A;  1RXV A;  3BQT A;  2XIC A;  5DQG A;  2H3I A;  3JPO A;  1RM6 C;  5K4L A;  7ICN A;  2F8K A;  1TAM A;  2ZXH A;  3OJU A;  3JPS A;  4EBC A;  2FPM A;  3ETL A;  3HWT A;  3IM1 A;  1S97 A;  4DCC A;  1X9S A;  2D3D A;  1J2M A;  1UCV A;  3QEA Z;  7ICH A;  5J2H A;  4RNN A;  4DLE A;  2VAN A;  5L9X A;  5AIB A;  7ICP A;  4YQW A;  1ZQJ A;  2BCV A;  4IQT A;  1UA1 A;  4F4W A;  3T5H A;  3T5K A;  8ICX A;  2ZIW B;  4B9L A;  2WF8 A;  1UHU A;  1MQ2 A;  2XGP A;  3KOO A;  5C5J A;  2RRD A;  4C7Y A;  1NK6 A;  9ICX A;  4QNL A;  3ICX A;  5DDM A;  5HP4 A;  4I2B A;  2H3Z A;  4Y2T A;  2W11 A;  2Y0S F;  4DSL A;  3MR3 A;  5KFA A;  2W03 A;  1N56 A;  5HNK A;  3TAQ A;  3HIL A;  2D6F C;  5KT5 A;  2QB0 A;  2WAQ C;  4YP3 A;  1S8O A;  3MFH A;  3TKA A;  4UB1 A;  3L4P A;  1KLN A;  4FFD A;  1NJX A;  3RRG A;  2G07 A;  4DL2 A;  4UW9 A;  1KL9 A;  3EPI A;  2G5I B;  4J9S A;  4F5Q A;  5AKK A;  4TQS A;  4DFP A;  3THV A;  1MA7 A;  3MC1 A;  1L7P A;  3NGD A;  4RQ7 A;  4QWB A;  4B6J A;  3Q8M A;  3QUT A;  2FPL A;  2KV2 A;  3QUB A;  3GIL A;  4EX6 A;  2R8J A;  3FAH A;  3QU2 A;  5L1M A;  4M9H A;  3BDP A;  7ICM A;  4CF3 A;  3PZP A;  2JEF A;  3OGU A;  2VA2 A;  4FBT A;  1ZQK A;  1HUZ A;  3LYS A;  4B9T A;  1SZP A;  4MF8 A;  5KFL A;  2KTQ A;  5KT6 A;  2EZY A;  4RPX A;  2R8K A;  3E0F A;  2WF7 A;  9ICU A;  3KKA A;  1ZQE A;  4RQ6 A;  4GXK A;  3BQ0 A;  3RJF A;  2BHN A;  5KT3 A;  2H5X A;  2BCQ A;  1A76 A;  1T7P A;  5ALP A;  4YXM A;  5J0Q A;  1RXW A;  3PW7 A;  4XUS A;  1Z3E B;  3WK6 A;  4RT3 A;  3PX6 A;  8ICE A;  5KFR A;  5DBB A;  2A19 A;  1S5L U;  2MU2 A;  5KFE A;  8ICK A;  4F2R A;  4QZB A;  1MSW D;  1C20 A;  1N48 A;  2NO4 A;  3RB4 A;  4F91 B;  2HBM A;  3C2L A;  1P7D A;  4TUP A;  8ICJ A;  9ICH A;  3WKB A;  1BPZ A;  2AJQ A;  4KLG A;  2E3T A;  2BPG A;  1ZQT A;  4FO6 A;  2KJ5 A;  4M9J A;  5KG5 A;  4DFK A;  2D8C A;  4NXZ A;  1XNS A;  4YD1 A;  1SL1 A;  1Q8K A;  4I2D A;  5ALI A;  3RFA A;  3ORY A;  1Z00 A;  4UAZ A;  5EWF A;  3QEB Z;  4P2H A;  3H4D A;  3B0Y A;  4LJX A;  3WKA A;  4BX9 C;  2NRV A;  1TFR A;  7ICS A;  4ED3 A;  3TAR A;  2EAM A;  5KG7 A;  5J2B A;  4NLZ A;  2A1J A;  3V7J A;  1D9F A;  3QUC A;  4UAY A;  4KLD A;  2W7O A;  1ZYQ A;  4JMU A;  1UQV A;  3F53 A;  4Y2Q A;  1FIQ A;  3SAG A;  1PVQ A;  5HML A;  5J2A A;  4DQI A;  2KK0 A;  4PGQ A;  3TFR A;  2KNJ A;  5DB6 A;  2BZF A;  1QCK A;  4YMO A;  1H38 A;  2FPK A;  8ICB A;  2MRL A;  2NV3 A;  5CRX A;  2YMQ A;  4RQ0 A;  3QU4 A;  4RQM A;  4DL7 A;  1X66 A;  3PNC A;  4EX7 A;  9ICQ A;  5KFF A;  2LYA A;  4NV0 A;  3F2C A;  4OJP A;  5J2K A;  2Y9U A;  9ICA A;  5AI8 A;  2KD1 A;  5J0X A;  3PMN A;  1L5U A;  5HR6 A;  2QLT A;  4RUC A;  4DF4 A;  3AUO A;  5DG7 A;  2QAR B;  7ICU A;  2PFP A;  1OUQ A;  2HDO A;  4JV0 A;  2IOH A;  4UAV A;  4MEX A;  1VLB A;  3HRD D;  2HOI A;  1SGG A;  5AHX A;  2W8K A;  3TAD C;  1KFT A;  2PI5 A;  2Y1I A;  2BDP A;  4UB3 A;  2CPR A;  5DQH A;  5KFD A;  4DFM A;  2YY6 A;  3LVW A;  3HKZ C;  2AGO A;  5ALN A;  1PZN A;  4J9M A;  2ZIX B;  4KLT A;  3AN1 A;  5KFT A;  4K4G A;  4RNO A;  1QQ5 A;  1NJZ A;  2OCE A;  1ZQD A;  2XCP A;  4Y2P A;  5J8Y C;  2RDI A;  4NLK A;  3PX4 A;  5HMM A;  3LK9 A;  2HHX A;  3QZ8 A;  1CUK A;  2KSO B;  4RQ5 A;  3WK5 A;  5TZV A;  1RPL A;  1ZOL A;  1J97 A;  2XGQ A;  1N2X A;  4QZ8 A;  2RP5 A;  4B9V A;  2MA1 A;  2VKQ A;  4GC6 A;  1KBU A;  1Z1B A;  5IIM A;  5KTQ A;  2DL0 A;  5AK6 A;  1GO3 F;  5ALG A;  4ED0 A;  2EQY A;  4KLH A;  4UAS A;  3F5A A;  4DS4 A;  2JXJ A;  4IQW A;  3WK8 A;  2K60 A;  3M9N B;  2ZJ8 A;  1Z19 A;  9ICT A;  1QTM A;  4QZC A;  5KFB A;  1COO A;  4AYB C;  5ALL A;  3MGH A;  4R63 A;  5KL8 B;  4XRH A;  2HBL A;  2HHU A;  3H7I A;  9ICC A;  3N7S C;  2K89 A;  4R8U A;  3GZF A;  1D8L A;  3PST A;  5KFS A;  2PFN A;  3RH6 A;  1V97 A;  2K4E A;  2KIV A;  2LMR A;  3H8S A;  2W3R A;  2W9B A;  2KZZ A;  2XID A;  4J03 A;  2EAP A;  1S76 D;  2BCS A;  2GLE A;  1Z4N A;  3KZX A;  5AKX A;  5ALK A;  2DKX A;  2F1I A;  8ICS A;  2K8A A;  1RQL A;  4AP9 A;  3AQE A;  2ALZ A;  3PX0 A;  1KFS A;  3VCB A;  4ELT A;  1DXS A;  2DUY A;  4KX5 A;  5AKG A;  4DF8 A;  1K1S A;  4KIT B;  1U9L A;  3JPN A;  1DK3 A;  2AQ4 A;  2DF4 B;  3SQI A;  2IHM A;  1BNO A;  5IIJ A;  2ISP A;  1NOM A;  4F71 A;  4F5O A;  1ZQH A;  2JH7 A;  2KFZ A;  1DGS A;  4I2F A;  2J6T A;  3OHB A;  3PY8 A;  1X9X A;  3D2Q A;  2AGP A;  2ZUB A;  1PK1 A;  4Q43 A;  4I2A A;  2C2D A;  2OH2 A;  2HVH A;  2DBY A;  3JPT A;  3K1Z A;  1OXJ A;  5L1J A;  3SR6 A;  2C28 A;  4MFC A;  2WB1 C;  2AQ0 A;  4F72 A;  2JHD A;  2HHQ A;  5KG1 A;  3SAH A;  1FO4 A;  3D2N A;  2P66 A;  1SXD A;  9ICF A;  3RH5 A;  1ZQX A;  5KFC A;  1WWU A;  3Q8P B;  3SV3 A;  2PFQ A;  2I9G A;  5KFI A;  5KL1 B;  4EEY A;  3ZI4 A;  4G9B A;  3GFK B;  3F5E A;  5T14 A;  4B9M A;  1RZT A;  3V6H A;  1L6N A;  5J2I A;  2HBK A;  3PSF A;  1ED1 A;  2WAQ F;  4PH5 A;  5DG9 A;  4DWI A;  4U7C A;  2ODG A;  3MDC A;  1NJY A;  3QU9 A;  1SL0 A;  4NLG A;  1N60 A;  1AQ6 A;  3ZD8 A;  4P0P B;  2J6S A;  5JU5 A;  5DKW A;  1XU4 A;  1B43 A;  4RQ1 A;  4QJF B;  1N61 A;  1X9M A;  3KZI U;  4JK1 A;  2PMZ C;  2F8L A;  5AK5 A;  4KLE A;  9ICL A;  3HW8 A;  4YD2 A;  2R18 A;  9ICR A;  4DSF A;  1UPH A;  3WK7 A;  1F44 A;  2YQE A;  4DL6 A;  1RYR A;  1CI4 A;  4GXI A;  2XO7 A;  4KLF A;  2C2E A;  2QB0 B;  2RDJ A;  1ZRN A;  4ELV A;  5C0Y A;  5AM4 A;  3I28 A;  1JAL A;  2G0A A;  3GIK A;  4Z6E A;  5AKY A;  4YMM A;  5BOL A;  3HT3 A;  4R65 A;  3RF9 A;  2W55 A;  1XO0 A;  1NNL A;  3RB0 A;  1L7O A;  3RJI A;  4O3N A;  2LPE A;  5AIC A;  4ECS A;  3KBB A;  4ECW A;  2ISO A;  1A6S A;  3CW2 C;  1L3V A;  1ZJM A;  3T79 A;  4P0P A;  4MF2 A;  2L5Y A;  5DBA A;  1WUD A;  7ICJ A;  4TQR A;  3M9O B;  5CR0 A;  1LB2 B;  5KFW A;  4P4M A;  2XY5 A;  4UAU A;  4QZ9 A;  4US8 A;  1X2I A;  5AI9 A;  1L8L A;  2E8M A;  3J81 j;  4DSI A;  2JZB A;  1Q46 A;  3Q8R B;  3UM9 A;  2LM1 A;  4Y2V A;  2G06 A;  3JPP A;  3O0F A;  2EAO A;  3CP8 A;  4FBU A;  2VJ5 A;  3I76 A;  4I2H A;  1B0X A;  2EH9 A;  5ALZ A;  5TIS U;  1FEZ A;  2BCR A;  2CRX A;  3OPX A;  1V9P A;  4BDP A;  5EE1 A;  2YMP A;  2G5H B;  3BJY A;  4BGD A;  5DDY A;  4J9N A;  4I27 A;  3H8J A;  2ZIU A;  1UT5 A;  4ECR A;  5AM0 A;  4PL2 A;  1JRP A;  1T3N A;  3CRX A;  3LDA A;  1XSN A;  2V4R A;  1NKC A;  4R64 A;  2KE7 A;  3NRZ A;  2HW3 A;  8ICQ A;  3IG8 A;  5EE9 A;  3SD7 A;  1SV0 C;  2QB1 A;  3AM9 A;  4QZA A;  4YXJ A;  1BPD A;  2YML A;  3RR7 A;  5KFG A;  4XQ8 A;  4KX3 A;  1PVR A;  4DEZ A;  5DB7 A;  1TAQ A;  4C4T A;  3IRU A;  3DEE A;  1ZJN A;  3V6J A;  4CE6 A;  4KLQ A;  4J9K A;  2LYH A;  1KFD A;  4IQU A;  2LM4 A;  4OJ5 A;  1ZQG A;  2UVW A;  2GO7 A;  5CWR A;  5EE3 A;  1CEZ A;  2CN1 A;  3V7K A;  4O5K A;  1T4G A;  4Y2J A;  1Z00 B;  3T3F A;  5KG4 A;  9ICM A;  2WFA A;  2JMG A;  2ASJ A;  4NL9 C;  2F76 X;  4ZOH C;  2C22 A;  2FLN A;  8ICH A;  4F93 B;  1URJ A;  3CNH A;  2VJ4 A;  4ELU A;  2KKV A;  4QWE A;  3WKC A;  5KG0 A;  2Q4T A;  4FS1 A;  4BXO A;  5KFN A;  3R9K A;  3BQ7 A;  2A1J B;  3RB6 A;  2C2R A;  4TUQ A;  4YFK A;  2EAN A;  3QUQ A;  3IP4 B;  2ZJA A;  4DOB A;  3K4G A;  3PVX A;  2EZX A;  5AKH A;  2ZUC A;  5KFO A;  1U48 A;  1TK5 A;  3QZ7 A;  2YMM A;  8ICN A;  3SYZ A;  2FJ6 A;  2UVV A;  3H0L B;  1V85 A;  1KQQ A;  4KMO B;  4ECX A;  4UB2 A;  5AM5 A;  1HIW A; 
#chains in the Genus database with same CATH homology
 2KOB A;  4PL2 A;  2A3V A;  2PMZ C;  2F8L A;  4QIW C;  3CRX A;  2XIC A;  5HR7 A;  4NWI A;  2DF4 B;  2H3I A;  3KFU F;  1ZQ1 C;  3HKZ F;  1TAM A;  3IG8 A;  2ZXH A;  3LYS A;  2LBO A;  2R18 A;  2W04 A;  2DGZ A;  3IN5 A;  4JMU A;  1UPH A;  2W7O A;  3F53 A;  1F44 A;  1YT3 A;  3NRW A;  3E0F A;  3GU3 A;  2LHT A;  4OJL A;  3SAG A;  3PSI A;  4OJO A;  2JH7 A;  4BJQ A;  1PVQ A;  4ACO A;  4FZL A;  4KX3 A;  2ZIV A;  2KEY A;  2LYB A;  4OO1 J;  2KNJ A;  4FE3 A;  1PVR A;  2HOF A;  4WJ3 B;  2E5S A;  3D2Q A;  2RP5 A;  3DEE A;  2HBJ A;  2MA1 A;  2MRL A;  2VKQ A;  1KBU A;  5C0Y A;  4GFJ A;  2K4H A;  1Z1B A;  2G0A A;  2NV3 A;  2ZIW B;  3IG5 A;  4OJ6 A;  1IIP A;  2ZIX A;  3PSP A;  4OJ5 A;  2OH2 A;  3N7R C;  1GO3 F;  4P0Q A;  4FZM A;  2Y0S C;  2KKP A;  2ZG6 A;  2K8B B;  3L3F X;  5CRX A;  3M6Z A;  2G08 A;  2JH1 A;  3F2B A;  1DRG A;  3K1Z A;  3RF9 A;  3F5A A;  1A0P A;  1T94 A;  2YB1 A;  2RRD A;  1D8B A;  3ONN A;  4CDG A;  1Z19 A;  2PMZ F;  1PVP A;  3ALR A;  1XO0 A;  2CN1 A;  4QIW F;  2LYA A;  4NV0 A;  4ICA A;  4OJP A;  3ICX A;  4QNL A;  4NLB A;  2DQN B;  2WB1 C;  5A0L A;  3F2C A;  2JHD A;  2N1R A;  2H3F A;  2H3Z A;  2KJ8 A;  2H3V A;  3H0R B;  4FZN A;  4IC9 A;  3SAH A;  4AYB C;  1A6S A;  3D2N A;  2Y0S F;  4CRX A;  2OM6 A;  3SAF A;  2M0N A;  2KIW A;  3M7D A;  3T79 A;  2KD1 A;  2F2A B;  5KL8 B;  4P0P A;  2JMG A;  5HR6 A;  2KJ9 A;  2HBL A;  3C28 A;  2F76 X;  2VIX A;  2W03 A;  1Q3U A;  2Z7J A;  3SMV A;  1WUD A;  3AQF A;  4NLC A;  2D6F C;  1URJ A;  2WAQ C;  2KHQ A;  2VJ4 A;  4BUG A;  2ZIU B;  3VC8 A;  3N7S C;  5KL1 B;  2HBM A;  2HMX A;  2KKV A;  2K89 A;  2ZXI A;  1P7D A;  3AL0 B;  2Q4T A;  1OUQ A;  4A8E A;  3GZF A;  3C29 A;  3LVV A;  2E1E A;  1NZB A;  3PST A;  2KVC A;  3F5E A;  2E1F A;  5T14 A;  4PL1 A;  2G07 A;  2H3Q A;  2K4E A;  3NUQ A;  1L6N A;  1ECW A;  2HBK A;  2ZIW A;  2XID A;  3PSF A;  3PZP A;  1ED1 A;  2WAQ F;  3IP4 B;  2KJ5 A;  1CRX A;  1Q3V A;  2HOI A;  2G06 A;  2G5I B;  4C0Z A;  2GH1 A;  4U7C A;  2W7P A;  3SQI A;  3O0F A;  3KZX A;  1HEK A;  1SZH A;  2GOL A;  3CP8 A;  3CYM A;  3D2S A;  4U6P A;  2VJ5 A;  2LKY A;  1XNS A;  1MA7 A;  3MGV A;  2ZIV B;  2CPR A;  2XI9 A;  2K8A A;  3LVW A;  3RFA A;  4P0P B;  2WB1 F;  2KV2 A;  2F77 X;  2CRX A;  2OXO A;  2YX8 A;  2K8C B;  3AQE A;  2G09 A;  4O3M A;  3N7P D;  2RHF A;  3OPX A;  3HKZ C;  4AYB F;  4CGZ A;  3H0L B;  4QJF B;  3F2D A;  2JGA A;  4KMO B;  3VCB A;  2ZIX B;  2G5H B;  2KIC A;  3M6K A;  2XVT A;  2BDU A;  4P0Q B;  2YB4 A;  4KX5 A;  4BX9 C;  2ZIU A;  1HIW A;  2KHV A;  2HOQ A;  2K4I A;  3H0M B;  2OYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...