2K89A

Solution structure of a novel ubiquitin-binding domain from human plaa (pfuc, gly76-pro77 cis isomer)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Phospholipase A-2-activating protein
total genus 13
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k89A00
2K89A 2K8AA 3L3FX 3PSTA 2K8CB 2K8BB 3PSPA
chains in the Genus database with same CATH superfamily
1S76D 9ICAA 2KKVA 2V4RA 1SL1A 4DQIA 2MUTA 2D6FC 4CF3A 4MFFA 3UQ0A 8ICRA 1SV4A 5DB8A 4OJOA 1N48A 1TK8A 3GQCA 2DKXA 2EAMA 1ZQAA 1L7OA 3LVVA 5ALYA 3VC8A 4QZFA 4YXMA 2HHUA 5J0OA 4I2CA 5FP0A 4DQRA 2WF8A 4I2JA 4MF8A 1KTQA 2Q0ZX 3C5GA 4DL7A 2C2EA 1KBUA 1NZBA 4PZNA 3KHGA 5AI4A 4KLEA 2Y0SC 5AI6A 2YN4A 5CJ7A 1NK6A 4TQRA 2XY5A 4ELVA 4PGQA 2H3FA 4BGDA 5G5GA 7ICJA 2E1FA 2QKQA 1QSYA 4BJQA 3RB0A 3H40A 4ED1A 3N4MB 2J6UA 4I2EA 2W54A 9ICSA 3RB6A 2PFNA 5BOMA 2YMQA 2NRZA 2HSZA 3UMCA 3FAHA 2W8KA 4DF4A 2XIDA 5KFZA 2ZIVA 1B43A 1RQLA 2WFAA 4J9RA 4FBTA 5L9XA 2NRVA 1NKEA 3ZD8A 3MC1A 2DWQA 3PO4A 4I2IA 1ZD4A 2Q4TA 4OD0A 1ZQMA 1Z00B 5ALVA 3SV3A 4J9NA 4RQ4A 2KE7A 2LMRA 1K5OA 4KLLA 5ALGA 4QZIA 5AKZA 4YP3A 2ISOA 4QIWF 1S10A 4YFKA 3E2EA 7ICHA 2GLEA 3LWLA 4DSIA 2WAQF 3KKAA 3PSFA 2R8KA 3EZ5A 4Y2YA 2NV3A 3HKZF 3IP4B 1TAUA 4E0DA 4KLUA 2ZIVB 5IIMA 2JEIA 3BQ7A 4R8UB 4JUZA 1XS9D 1WUDA 2E8PA 3C28A 5DQHA 4F71A 1ZQIA 1NK4A 3WKEA 7ICFA 3KFUF 4QIWC 2IBKA 2HBLA 1D8BA 2KJ5A 3TKAA 4I2GA 4P4OA 3PZPA 5KG5A 3EUB2 4TUPA 2C2DA 4P2HA 5IINA 3V6KA 4NLBA 4NY8A 5IIJA 1H38A 3QYPA 1J2NA 5KFWA 1XSPA 3L5KA 5BOLA 1RXWA 3A0HU 2H5XA 3TAQA 1ZQJA 4JMUA 4LZDA 2ZG6A 5KFTA 9ICKA 8ICXA 1PK1A 5CA7A 4ECXA 5AKIA 4DS4A 5J2AA 1M6YA 5AM3A 3H0MB 4UAUA 3LK9A 5KT7A 3GV7B 1X40A 3NGDA 4J9PA 2M0NA 4F5PA 4EBDA 4C8KA 1KEJA 2BPCA 1L6NA 2W04A 2KMDA 5AI8A 5AM1A 3ZDCA 4RQ3A 5KAIU 4ELTA 1X66A 3GFKB 2DFLA 5KT5A 3TFSA 3J81j 1X9MA 2NRXA 4IQUA 4XQ8A 2KFNA 4IQVA 1T7PA 3QUCA 2LYAA 1QLNA 4Y2JA 1FO4A 1UPHA 5AK6A 1LV5A 4KLGA 1PK1B 1K1SA 4B9TA 9ICVA 4CE6A 1X42A 4JWMA 2LPEA 3C2KA 2DPIA 3ICXA 1SKWA 4YQWA 2H3VA 2HVIA 4ECVA 1Q46A 4NLNA 3T5LA 4A8EA 9ICQA 4G9BA 2WHEA 2OH2A 1JRPA 1ZQQA 4PZOA 3HKZC 1NNLA 3D2QA 3IN5A 1WG8A 1URJA 1Q3VA 5J0QA 4YR3A 4HYKA 5KFCA 4PHEA 3NS1A 4Z6CA 4O5KA 1YT3A 2LI6A 7ICOA 2A1AA 3H8JA 3PY8A 1UQVA 2RQ5A 2C22A 5DBAA 5CRXA 4ICAA 3PSIA 4BDPA 4BUGA 1U9LA 5C0YA 1LB2B 5AKEA 1SL0A 4O5EA 2KJ8A 4PJ0U 2YTUA 5KFLA 1ZD2P 3M7DA 5H2FU 3PV8A 3V6JA 3KHRA 2HI0A 3D2SA 1JXLA 4B6JA 2ASLA 5AKHA 7ICVA 4FFDA 5IIIA 4QZ9A 2YY6A 3UQ2A 5KNIA 3C2MA 4NL9A 2G0AA 3PNCA 2W3RA 4DCCA 3UMBA 5L1MA 2XC9A 2PFOA 2DBYA 4KLIA 3MR5A 4MF2A 4DOAA 3GZFA 1KL9A 4RUCA 5J2CA 4TUSA 1X6IA 3PW7A 4IR9A 4F4YA 1IM4A 2AQ0A 1YZ6A 5ALUA 7ICTA 2FLPA 5E79U 5B5EU 8ICSA 4J9MA 1KFSA 5KFVA 3PMNA 2RHFA 5D49A 1B22A 3JPOA 1HJPA 1DRGA 8ICIA 2JV3A 4KX5A 3V72A 5J2FA 2E8MA 5DQIA 5TZVA 2PI5A 4BWMA 2KKPA 2KHQA 2YMLA 5KT6A 3T3FA 2WF6A 2XI9A 3QU2A 2PKEA 1ZQHA 1SL2A 3WU2U 2J6TA 5HR7A 5J0TA 3SENA 3C21A 4B9MA 3DV9A 1S77D 2JEJA 5DDYA 3SV4A 3RTVA 1RDFA 3JPNA 2OCEA 2HHVA 5J0YA 4Y2UA 3K4GA 1A77A 4R65A 1RYRA 1RG6A 4ECYA 2JZBA 2ES6A 2WTFA 1CEZA 1SWWA 3PW0A 8ICQA 2KK0A 4ZH4A 3C5FA 1T94A 9ICEA 3UXNA 1N60A 1ZQBA 4FS1A 5EE1A 4RPZA 4F5RA 2PFQA 1PVRA 3Q8SB 4RQ6A 5KFGA 3NVYA 4Y2PA 4DFDA 1MA7A 2E1EA 5JU5A 4UB3A 4YMMA 2RP5A 3MFHA 1NJWA 2F1JA 1CI4A 4M0AA 5J2BA 4QZAA 5AKGA 4FZLA 1KLNA 3WK8A 1KFTA 4BX9C 2WB1F 3M6ZA 4QWBA 4FE3A 4P4MA 2KEYA 3SR6A 3Q8QB 2UVVA 4PHDA 5DG7A 2KOBA 1U45A 4QWDA 4YR2A 3PX4A 2EAPA 4EYIB 3TQ1A 2H3IA 3HPOA 4DQPA 4DQQA 5ALHA 3AU6A 4KLTA 3PW4A 4GC6A 4P0QA 2QLTA 7ICLA 1UCVA 1ZQYA 1V85A 3LVWA 4XA5A 4RQ0A 5KG3A 2A19A 1ZETA 3WK6A 2M9NA 2K4EA 1L5UA 4C8LA 2AGPA 4F92B 1N5XA 1TFRA 1ZQUA 2P6UA 8ICMA 4ECRA 9ICGA 4UQGA 3E0FA 2K89A 4Q8EA 5KFYA 3B9JA 4P0PB 1FFVA 3HRDD 3SAGA 1NK5A 3RH6A 1P7DA 3D6JA 2FMQA 2XO7A 2FDRA 2ZIXA 8ICWA 4JV1A 3E58A 3NVZA 5EE9A 5DGAA 1UA0A 1XSNA 2XCPA 2H3QA 1KFDA 1TE2A 4DSKA 4CNQA 4C4SA 1UA1A 5AM0A 4UASA 3OJUA 1KN5A 1Y88A 3TFRA 4U7CA 3DDHA 2HOIA 1NI3A 8ICBA 3H0RB 2EDUA 5TISU 1HEKA 1SV0A 2RLTA 2B6GA 4ECWA 2FPMA 1L8LA 9ICPA 2QB0A 1FEZA 3QUQA 5J2IA 1DK2A 2BHNA 2Z7JA 2KZMA 1S97A 4ECQA 3M1YA 3THVA 1ZYQA 5ALRA 3MR6A 3JPSA 4PGYA 4NM1A 4YVZA 5KT3A 2G06A 4UAZA 4RPYA 2ATLA 1OXJA 3A0BU 2ZUDA 1B4FA 3QEAZ 2W9AA 2ISPA 1ED1A 2JXJA 5J8YC 4KLFA 4QNLA 4Z6DA 3TADA 3PMLA 4MFAA 5G5HA 3FYHA 3CNHA 2DKZA 3ISBA 5EWGA 5ALDA 3H0LB 4PH5A 5D4BA 4OCZA 2R8IA 1ZRMA 5DB6A 5L1JA 4DL6A 3C23A 4Y2XA 2B0CA 3V7LA 5JUMA 7ICNA 9ICNA 2VIXA 2HHTA 1S8OA 5DKWA 2XGQA 1SV0C 2ZIWB 3L3FX 3SZ2A 5CR0A 4KLJA 4IRKA 2XGPA 3KZXA 1MC8A 5KFXA 4NL9C 2ZIXB 2OHFA 2FLLA 2F77X 3Q8MA 5CP2A 2LHTA 8ICFA 4JWNA 9ICUA 1ZQWA 4KLDA 5KFSA 2ZXHA 4F91B 8ICNA 3QUBA 4O3OA 4DFJA 3F2BA 5J2KA 4RQMA 5J0WA 2F1IA 2LKYA 4DL2A 2BDUA 5KFHA 9ICOA 1SKRA 5IILA 4YR0A 1QQ6A 5F9LA 3IDWA 3IG5A 1ZRNA 1KDHA 5KL1B 3NASA 3HWTA 3RRHA 5DG9A 1X9XA 1L7MA 2YB1A 3O0FA 2UVRA 3AMZA 4ZOHC 3MDAA 4UB6U 1NK7A 4AYBC 1KSPA 5DQGA 1QSSA 1C20A 1TKDA 3N28A 3V6HA 2UVUA 1RZTA 2BCVA 1NZPA 2QARA 1QQ5A 5KG7A 2F8LA 1WYGA 3JPRA 5KFUA 3QU4A 2PI4A 4O3SA 5AK3A 4R8UA 4B9VA 1ZQTA 3GIMA 3TANA 2KN7A 2PMZF 4RNNA 5AI9A 1SZHA 4DL4A 4KITB 4R66A 4IC9A 4YCXA 4UB2A 5AIBA 4FBUA 5AM4A 1BGXT 3KHLA 3KD3A 4B9UA 3M8RA 7ICIA 2HHQA 4GC7A 4RT2A 1KQQA 5AKJA 2R18A 4I27A 5KFQA 4RQ2A 1Z1VA 3T5JA 1U47A 1JROA 1O03A 1S0MA 5KFBA 4J9QA 2XVTA 4JV0A 1L7PA 9ICMA 2NYVA 1O08A 2F44A 1LKYA 1QSLA 3OJSA 5GTIU 4TURA 2ZTEA 1U4BA 1N63A 4KLQA 4OJLA 4Q43A 2W8LA 1TAMA 4ED6A 4M6WB 7ICGA 2WAQC 4F4XA 8ICZA 2ASDA 1N5WA 3PR4A 5KFAA 1ZJMA 7ICKA 4ECSA 3OGUA 1TAQA 2CPRA 3V7JA 4F4WA 1K1QA 4O3QA 3QZ7A 4Y2VA 1N62A 2EANA 3G6VA 1F0MA 2W9BB 4BWJA 8ICAA 2BKEA 3RB3A 1N56A 3L4PA 4Y2RA 5CHGA 3RJGA 4MEXA 4I2AA 5ALLA 4OJPA 1D8YA 1UT8A 3ALRA 4C80A 1ZQOA 2WF9A 5DBBA 3RR7A 1BPXA 2KSOB 2GOLA 3CW2C 3JPPA 4UAVA 5DBCA 2OXOA 1XSLA 8ICLA 1N2XA 2Y1JA 4DSFA 1FFUA 3N7PD 4QZ8A 3RB4A 1BVSA 2KP7A 2V9WA 2L5YA 1D9DA 3IG8A 4NLKA 2BPFA 1FIQA 2HW3A 1WWUA 1HUOA 4RZRA 3BQTA 3RH5A 1D9FA 4IQTA 2HBMA 1ZQVA 3HX0A 5AM5A 5KFPA 2VA8A 1S0OA 1T3QA 4YG2A 4UB1A 2ZJ8A 2K4IA 3OTQA 5KG2A 5ALFA 4EX7A 4F5QA 4KMUA 3RH4A 3CYMA 1L7NA 1BPZA 4O9MA 2NO5A 1RPLA 2HDOA 1C7YA 4DOCA 4KTQA 5CWRA 3AU2A 2BCRA 2W11A 2G08A 2KG5A 3G6YA 9ICHA 3OSPA 3H4BA 1ZQKA 4KLSA 1KKXA 1Z4OA 3MGVA 2MU2A 5HHIA 1Q8KA 1PZNA 2F3NA 3PX0A 5J2HA 4J9SA 4Y2SA 3K75D 5HHHA 4IS7A 4Q45A 2OM6A 2JRZA 5J2GA 4C8NA 3EW9A 2W7OA 2ZIUA 3C1ZA 1L3TA 4USAA 1IG6A 5ALNA 4UB8U 4YD2A 8ICGA 3ZDAA 4I2FA 4WJ3B 8ICJA 4MEYA 2FMPA 4NLCA 5DB7A 4B9LA 8ICHA 2HMXA 1BPEA 2EZXA 2B21A 1IV8A 1AQ6A 3DEEA 1RXVA 5ALKA 3GIIA 3RJHA 2QARB 3C2LA 3RJEA 2OYYA 3BS5B 5ALMA 1Z1BA 4FZMA 4DFMA 1Z19A 1PVPA 3MBYA 4I28A 3F2DA 1MN8A 1ZD3A 4ED7A 3QEBZ 9ICLA 2ZIUB 2KTQA 2W55A 2W03A 9ICIA 3C1YA 2V4QA 4US9A 4DWIA 5KG6A 4CRXA 2AQ4A 4NJ8A 2IOHA 4B9NA 2JHDA 3HILA 1A76A 2NO4A 4EELA 2CRXA 4NWIA 3D2NA 2E8OA 2BQRA 2HOQA 4F5OA 3RAXA 3M9NB 5AHXA 5L1IA 1YZ7A 4OJ5A 3CRXA 2NRTA 4ECZA 9ICXA 5CEHA 4UATA 4QWAA 1QH9A 3LYSA 1ZQNA 4EX6A 2AGQA 2ZJAA 4BXOB 5B66U 4O3RA 2O6KA 3ONNA 3IM1A 4CDGA 5ALPA 3ED5A 4GFJA 1COOA 4KN7A 4QW8A 4UAWA 3RBEA 4F3OA 3GIJA 2VA3A 1AROP 5KFJA 9ICCA 1JN3A 2KHVA 2FPKA 2BZFA 3WK7A 3OSNA 5ALWA 3NVWA 2G07A 4ED3A 2ZJ5A 1SXEA 2A3VA 1SB3C 4P0PA 1TK0A 7ICQA 2KJ9A 3FDSA 4DL3A 2I9GA 4I29A 2DUYA 4DO9A 2E8NA 4UARA 4ECUA 4YXJA 4R63A 2JMGA 2HBKA 2XY6A 7ICRA 1NK8A 5AKKA 1OW5A 3LDAA 3MR3A 2CXYA 9ICTA 4PGXA 4QZEA 2YMPA 3FM9A 4CF4A 1COKA 3JPTA 5DDMA 1RYSA 1D8LA 3HJEA 1QTMA 2GO7A 1WCLA 4C8OA 4J9OA 1Z00A 4FS2A 3NRWA 4US8A 3LWMA 1BPBA 5J2DA 2MRLA 1A0PA 1B0XA 2KD1A 1HUZA 4B9SA 8ICTA 5AM2A 1J2MA 3M8SA 2JEFA 3QU9A 3H7IA 2IA6A 1JALA 2BPGA 4O3MA 3BQ0A 3PO5A 4M9NA 4UW9A 2HOFA 2PFPA 3OHAA 3SQIA 2ZIWA 2KICA 3HT3A 7ICMA 3R9KA 1ZXIA 2W9CB 1QQ7A 3SYZA 1IIPA 1ZJNA 3SMVA 4F5NA 2W9BA 4EYHB 8ICEA 1MQ3A 2FJ6A 2F76X 3QX7A 4F93B 4OO1J 4I2DA 1ZQFA 3PX6A 4RQ5A 2AU0A 4M9GA 3N7RC 2PMZC 4DSEA 2HCFA 4QWEA 2FLNA 4BXOA 2W43A 3Q8PB 3ZDEA 1V9PA 2MSNA 3GDXA 1XO0A 1V38A 9ICRA 4GXJA 4EZ6A 3B0YA 2OWOA 2VJ4A 4HAIA 4EBCA 2LYBA 2LM4A 3UXPA 2HHWA 2IHNA 3MR2A 4RUAA 3OHBA 2KV2A 2W7PA 4C7YA 3F2CA 3IRUA 3Q8RB 2DQNB 4ED0A 2DL0A 2IHMA 4F4KA 3NUQA 1LKYB 3I28A 1U48A 3G6XA 3BDPA 4DOBA 3WK4A 3WKCA 2RDIA 3HW8A 2VJ5A 2Y0SF 4DLGA 3GV8B 4RNMA 4JV2A 5KAFU 3TI0A 2HBJA 1NOMA 4I2HA 3GILA 3TARA 2ODGA 3QXGA 1F5SA 5EE3A 4KN4A 4F2RA 3ETRA 4YMOA 1NJXA 1UHUA 3UM9A 2K4HA 3RFAA 4C0ZA 1RQNA 3BS5A 3UMGA 2NRWA 1ZQZA 2AHOB 1CRXA 4DF8A 2K8CB 3PR5B 4IRCA 5ALTA 1XNSA 1X9WA 2JH1A 4IL6U 5J2EA 2F2AB 5EWFA 2Y1IA 3K1RB 2FI1A 4F4ZA 2K8AA 2YMMA 3VCBA 3T5HA 5C5JA 4QZBA 2R8JA 3M6KA 5KFOA 3IHQB 2BGWA 5AI0A 2R8GA 4OJ6A 5DGBA 3U26A 1JMSA 4F2SA 3AEVA 4MHVA 4ELUA 8ICUA 3PSPA 1TV9A 1EXNA 1KW4A 8ICOA 5HP4A 1N61A 1ZQLA 4PPXA 1ZQGA 1NJYA 2ZUCA 5KFFA 5D46A 3GV5B 3F5AA 5KG1A 3KTQA 4F72A 3N97B 8ICPA 3KZIU 3Q8KA 2I6XA 5KT2A 4IRDA 7ICPA 5ALXA 3QZ8A 4DSLA 4Z6EA 3SD7A 2G5IB 5J0UA 1ZD5A 3B0XA 5T14A 2JZBB 2EAOA 4C7ZA 5DB9A 5K4LA 3S6JA 2IMWP 2ESEA 3AM9A 2BQUA 4K4IA 2FMSA 5AKYA 2IOFK 4EENA 2R8HA 7ICSA 1WCNA 1NKBA 2AH5A 4KLOA 3RR8A 2MUTB 2GH1A 3H8SA 5ALJA 8ICCA 2C28A 4RQNA 3TADC 3BZCA 4AYBF 1SKSA 4TUQA 4RU9A 2ZXIA 4YN4A 3RJIA 3F53A 2JEGA 5AKXA 1S5LU 4YD1A 1ZQDA 1ZQPA 2UVWA 1Q3UA 3QU7A 1VJ5A 4DFKA 4R64A 4KX3A 3K1ZA 4G3IA 2KIWA 2XCAA 4ED8A 4KLHA 1ZOLA 5HMMA 5L1KA 2XY7A 4M9JA 4M04A 5HR6A 3WKAA 4XRHA 1MQ2A 1DGSA 2P35A 2FPLA 3MGIA 3EWAA 4KLMA 2QB1A 2HHSA 4CF5A 3MABA 2W3SA 3AL0B 1A6SA 1SIJA 1ZQSA 1BNPA 4LZGA 4DEZA 1ZQXA 2AJQA 2DGZA 3QNMA 4DLEA 5DLGA 4DFPA 4PL1A 5AK4A 5CB1A 1V97A 1PUZA 1SGGA 3BQ2A 3RJKA 3Q8LA 2XICA 1UT5A 2ZUBA 3SEIA 2KZ3A 3H4DA 5DLFA 2I5HA 4DS5A 4M6WA 2J6SA 2ALZA 4EEYA 4F50A 1PVQA 4X5VA 1KRPA 1RM6C 5EE0A 2WF5A 5ALZA 2AGOA 5KFMA 5F3XB 4ED2A 1ZQRA 2A1JB 4NXZA 4LVSA 2EZZA 4O5CA 3PW2A 2JR5A 2ZTCA 2DPJA 4YMNA 3T5KA 2E5SA 2LM1A 4J9KA 3RF9A 1X9SA 2KVSA 9ICFA 3AQFA 3HP6A 5AKLA 4Q8FA 5KTQA 2RDJA 1SWVA 2LYHA 7ICUA 1T3NA 3QU5A 1XO1A 1S0NA 1NK9A 2VA2A 1OUQA 3EPIA 2LBOA 1T4GA 4O3NA 4M9LA 5EOZA 2EZYA 4RQ1A 1BNOA 1HIWA 5A0LA 1TK5A 2A1JA 4QZDA 2F8KA 2IOFA 4JB3A 4M47A 5HMLA 4QZGA 4RT3A 2I1QA 5ALSA 4ECTA 3BQ1A 1Z4NA 1DOQA 2BR0A 3QUTA 3ZI4A 2KSOA 3T79A 5J0SA 1ZQ1C 3RJFA 3UXOA 1T8EA 2MAXA 4O3PA 1PK3A 1BPYA 4NV0A 1L8OA 2YQEA 3MGHA 2Y9TA 3F5EA 3FC4A 4GXKA 2G09A 4JK1A 2YB4A 3NRZA 4U6PA 2EQYA 4UB5A 4O0IA 1DXSA 3EPGA 5HNKA 4M9HA 1J97A 5J0XA 4IR1A 2K60A 1X2IA 2KFZA 4K4HA 3CP8A 3SAFA 5GTHU 1F44A 1SZPA 3BJYA 5KT4A 4AP9A 4Z6FA 3KBBA 2G5HB 4TQSA 2JGAA 8ICVA 3ISDA 3I1YA 4C8MA 4CCHA 3WK9A 4DQSA 3ZDDA 3KHHA 5J29A 4F8RA 1XU4A 3ZD9A 4KMOB 5KG4A 1DK3A 1L3SA 2HVHA 3PVXA 2VKQA 3V7KA 3OPXA 2ZTDA 5AIAA 5AK5A 1S9FA 2JH7A 3KOOA 5DG8A 1U49A 3RRGA 5JTIA 2W9CA 4Y2QA 4M2YA 5ALOA 3H8MA 9ICWA 2BCSA 2BDPA 2GWSA 5IIOA 1DGJA 8ICKA 1S0VA 4CGZA 4C4RA 2WF7A 2BCQA 1L3UA 1X6JA 4QZCA 2OEHA 4QWCA 4RPXA 2F1HA 2E3TA 5ALIA 2DF4B 4PL2A 5ALQA 2BCUA 4LJXA 3I76A 4DSJA 4QJFB 1CUKA 2W9MA 2C2RA 3EYZA 1ZQEA 3SAHA 5KFIA 4PHPA 2HHXA 1TVAA 1IXRA 3GU3A 2WB1C 5L1LA 1NJZA 2D8CA 2BQ3A 4ACOA 3KKAC 7ICEA 4J9LA 2ASJA 4UBCA 3WKDA 3NTUA 1XWLA 2QB0B 3MFIA 1WWVA 4C4TA 9ICJA 8ICYA 3TACB 3WK5A 2KVCA 2D3DA 1LVHA 5KFRA 3AUOA 4K4GA 1BPDA 4J03A 4NLGA 3UPQA 1XC9A 2H3ZA 3ISCA 3NVVA 1JUDA 2P6RA 5J2JA 2KZZA 5AICA 1GO3F 5J0PA 1L3VA 3TAPA 2K4PA 3N7SC 5BPCA 4NLZA 1VLBA 1RYUA 2PXIA 3PSTA 5KFKA 2N1RA 4EEKA 3WKBA 2FE9A 3MDCA 3PW5A 3ZDBA 2YX8A 2VANA 2AXTU 3BZKA 5J8YA 1SXDA 1NKCA 4EZ9A 5IIKA 5JRTA 4RQ7A 5KFEA 3ETLA 4RNOA 3SI8A 3ORYA 1ZQCA 3JPQA 4NM2A 4GXIA 2CN1A 5KFDA 3RJJA 4UAYA 5AI5A 4I2BA 1MSWD 4FO6A 4EBEA 5ALEA 9ICBA 4PHAA 4RQ8A 4DL5A 2EH9A 3AQEA 4Q44A 3BS7A 1QCKA 5KFNA 2MA1A 4GLXA 4XUSA 4P0QB 3M9OB 3GIKA 4P4PA 1Z3EB 1JX4A 3AN1A 3M9MB 2P66A 1JXEA 1VDVA 4MFCA 4GIBA 5EWEA 5KG0A 3H8WA 4UB4A 1ECWA 5KL8B 1JIHA 1JI7A 2KIVA 1NK0A 4IQWA 2KNJA 4Y2TA 3IV6A 3QE9Y 2Y9UA 4QZHA 4QW9A 2RRDA 5F9NA 4FZNA 3RBDA 3C29A 4UBBA 2K8BB 3RAQA 5J0RA
chains in the Genus database with same CATH topology
3RF9A 2F8LA 3LYSA 2HOFA 2KKVA 2KOBA 2ZXIA 3AQFA 2LYAA 2G06A 3ONNA 2D6FC 2OM6A 2RHFA 3F53A 3SQIA 2ZIWA 2KICA 2H3IA 2H3ZA 4QIWF 4OJPA 4CDGA 1CRXA 3ALRA 1DRGA 2K8CB 1UPHA 4OJOA 2PMZF 2ZIUA 4GFJA 2W7OA 4KMOB 1Q3UA 2WAQF 4KX5A 1GO3F 1SZHA 3PSFA 2VKQA 1IIPA 1XNSA 2NV3A 3OPXA 3HKZF 2JH1A 3ICXA 3IP4B 3LVVA 2GOLA 3N7SC 4IC9A 4P0QA 3SMVA 4KX3A 1OUQA 2KKPA 2ZIVB 2F2AB 2KHQA 2LBOA 3VC8A 2H3VA 2OXOA 3K1ZA 3PSTA 3LVWA 2N1RA 2KHVA 2KIWA 4WJ3B 2XI9A 1ED1A 1WUDA 2F76X 2JH7A 2G07A 4NLCA 4QNLA 4A8EA 3C28A 5HR6A 2K8AA 2OH2A 2HMXA 3VCBA 5HR7A 1HIWA 2R18A 3N7PD 3M6KA 5A0LA 2K4EA 2A3VA 4P0PA 4OO1J 2YX8A 3HKZC 3DEEA 2KJ9A 3KFUF 4QIWC 3H0LB 3D2QA 3IN5A 4OJ6A 2HBLA 3N7RC 4CGZA 1D8BA 2KJ5A 2PMZC 3IG8A 1URJA 3AL0B 2OYYA 1Q3VA 1KBUA 1NZBA 1A6SA 3PZPA 2JMGA 1Z1BA 3PSPA 2HBKA 4FZMA 2Y0SC 3E0FA 1YT3A 1Z19A 1PVPA 2K89A 1XO0A 2XVTA 4NLBA 2VIXA 3F2DA 2H3FA 2DF4B 4P0PB 4PL2A 2E1FA 2DGZA 5CRXA 2CN1A 4ICAA 4PL1A 2ZIWB 3L3FX 2HBMA 2VJ4A 3PSIA 3T79A 4BUGA 3F5AA 3SAGA 5C0YA 1ZQ1C 4BJQA 1T94A 2LYBA 4QJFB 2ZIUB 1P7DA 3KZXA 2KJ8A 2ZIXB 2XICA 4NV0A 2KV2A 2ZIXA 2F77X 2W7PA 1PVRA 2LHTA 2W03A 3F2CA 3SAHA 3F5EA 3M7DA 4JMUA 2ZG6A 2DQNB 2ZXHA 2G5IB 2G09A 2K4IA 3AQEA 1MA7A 5T14A 2YB4A 2H3QA 4OJLA 3F2BA 4CRXA 2XIDA 4U6PA 2LKYA 3CYMA 1TAMA 2MA1A 2BDUA 3GU3A 2E1EA 3D2SA 3NUQA 2WB1C 4P0QB 2JHDA 2ZIVA 2RP5A 2WAQC 3H0MB 4C0ZA 4U7CA 4ACOA 2CRXA 3NRWA 2HOIA 3IG5A 4NWIA 5KL1B 3D2NA 1PVQA 3H0RB 2VJ5A 2M0NA 2Y0SF 2HOQA 1HEKA 2G08A 4FZLA 2MRLA 1A0PA 1ECWA 2KD1A 3O0FA 2YB1A 2Q4TA 2HBJA 5KL8B 1L6NA 2G0AA 2W04A 4BX9C 2CPRA 3CP8A 2GH1A 4OJ5A 2WB1F 3SAFA 4AYBC 3M6ZA 1F44A 3CRXA 2KNJA 2RRDA 3GZFA 2Z7JA 4FZNA 4FE3A 3MGVA 2G5HB 4O3MA 3C29A 2E5SA 2JGAA 2K4HA 2K8BB 3RFAA 2KEYA 4AYBF 2KVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K89 A;  2K8A A;  3L3F X;  3PST A;  2K8C B;  2K8B B;  3PSP A; 
#chains in the Genus database with same CATH topology
 1S76 D;  9ICA A;  2KKV A;  2V4R A;  1SL1 A;  4DQI A;  2MUT A;  2D6F C;  4CF3 A;  4MFF A;  3UQ0 A;  8ICR A;  1SV4 A;  5DB8 A;  4OJO A;  1N48 A;  1TK8 A;  3GQC A;  2DKX A;  2EAM A;  1ZQA A;  1L7O A;  3LVV A;  5ALY A;  3VC8 A;  4QZF A;  4YXM A;  2HHU A;  5J0O A;  4I2C A;  5FP0 A;  4DQR A;  2WF8 A;  4I2J A;  4MF8 A;  1KTQ A;  2Q0Z X;  3C5G A;  4DL7 A;  2C2E A;  1KBU A;  1NZB A;  4PZN A;  3KHG A;  5AI4 A;  4KLE A;  2Y0S C;  5AI6 A;  2YN4 A;  5CJ7 A;  1NK6 A;  4TQR A;  2XY5 A;  4ELV A;  4PGQ A;  2H3F A;  4BGD A;  5G5G A;  7ICJ A;  2E1F A;  2QKQ A;  1QSY A;  4BJQ A;  3RB0 A;  3H40 A;  4ED1 A;  3N4M B;  2J6U A;  4I2E A;  2W54 A;  9ICS A;  3RB6 A;  2PFN A;  5BOM A;  2YMQ A;  2NRZ A;  2HSZ A;  3UMC A;  3FAH A;  2W8K A;  4DF4 A;  2XID A;  5KFZ A;  2ZIV A;  1B43 A;  1RQL A;  2WFA A;  4J9R A;  4FBT A;  5L9X A;  2NRV A;  1NKE A;  3ZD8 A;  3MC1 A;  2DWQ A;  3PO4 A;  4I2I A;  1ZD4 A;  2Q4T A;  4OD0 A;  1ZQM A;  1Z00 B;  5ALV A;  3SV3 A;  4J9N A;  4RQ4 A;  2KE7 A;  2LMR A;  1K5O A;  4KLL A;  5ALG A;  4QZI A;  5AKZ A;  4YP3 A;  2ISO A;  4QIW F;  1S10 A;  4YFK A;  3E2E A;  7ICH A;  2GLE A;  3LWL A;  4DSI A;  2WAQ F;  3KKA A;  3PSF A;  2R8K A;  3EZ5 A;  4Y2Y A;  2NV3 A;  3HKZ F;  3IP4 B;  1TAU A;  4E0D A;  4KLU A;  2ZIV B;  5IIM A;  2JEI A;  3BQ7 A;  4R8U B;  4JUZ A;  1XS9 D;  1WUD A;  2E8P A;  3C28 A;  5DQH A;  4F71 A;  1ZQI A;  1NK4 A;  3WKE A;  7ICF A;  3KFU F;  4QIW C;  2IBK A;  2HBL A;  1D8B A;  2KJ5 A;  3TKA A;  4I2G A;  4P4O A;  3PZP A;  5KG5 A;  3EUB 2;  4TUP A;  2C2D A;  4P2H A;  5IIN A;  3V6K A;  4NLB A;  4NY8 A;  5IIJ A;  1H38 A;  3QYP A;  1J2N A;  5KFW A;  1XSP A;  3L5K A;  5BOL A;  1RXW A;  3A0H U;  2H5X A;  3TAQ A;  1ZQJ A;  4JMU A;  4LZD A;  2ZG6 A;  5KFT A;  9ICK A;  8ICX A;  1PK1 A;  5CA7 A;  4ECX A;  5AKI A;  4DS4 A;  5J2A A;  1M6Y A;  5AM3 A;  3H0M B;  4UAU A;  3LK9 A;  5KT7 A;  3GV7 B;  1X40 A;  3NGD A;  4J9P A;  2M0N A;  4F5P A;  4EBD A;  4C8K A;  1KEJ A;  2BPC A;  1L6N A;  2W04 A;  2KMD A;  5AI8 A;  5AM1 A;  3ZDC A;  4RQ3 A;  5KAI U;  4ELT A;  1X66 A;  3GFK B;  2DFL A;  5KT5 A;  3TFS A;  3J81 j;  1X9M A;  2NRX A;  4IQU A;  4XQ8 A;  2KFN A;  4IQV A;  1T7P A;  3QUC A;  2LYA A;  1QLN A;  4Y2J A;  1FO4 A;  1UPH A;  5AK6 A;  1LV5 A;  4KLG A;  1PK1 B;  1K1S A;  4B9T A;  9ICV A;  4CE6 A;  1X42 A;  4JWM A;  2LPE A;  3C2K A;  2DPI A;  3ICX A;  1SKW A;  4YQW A;  2H3V A;  2HVI A;  4ECV A;  1Q46 A;  4NLN A;  3T5L A;  4A8E A;  9ICQ A;  4G9B A;  2WHE A;  2OH2 A;  1JRP A;  1ZQQ A;  4PZO A;  3HKZ C;  1NNL A;  3D2Q A;  3IN5 A;  1WG8 A;  1URJ A;  1Q3V A;  5J0Q A;  4YR3 A;  4HYK A;  5KFC A;  4PHE A;  3NS1 A;  4Z6C A;  4O5K A;  1YT3 A;  2LI6 A;  7ICO A;  2A1A A;  3H8J A;  3PY8 A;  1UQV A;  2RQ5 A;  2C22 A;  5DBA A;  5CRX A;  4ICA A;  3PSI A;  4BDP A;  4BUG A;  1U9L A;  5C0Y A;  1LB2 B;  5AKE A;  1SL0 A;  4O5E A;  2KJ8 A;  4PJ0 U;  2YTU A;  5KFL A;  1ZD2 P;  3M7D A;  5H2F U;  3PV8 A;  3V6J A;  3KHR A;  2HI0 A;  3D2S A;  1JXL A;  4B6J A;  2ASL A;  5AKH A;  7ICV A;  4FFD A;  5III A;  4QZ9 A;  2YY6 A;  3UQ2 A;  5KNI A;  3C2M A;  4NL9 A;  2G0A A;  3PNC A;  2W3R A;  4DCC A;  3UMB A;  5L1M A;  2XC9 A;  2PFO A;  2DBY A;  4KLI A;  3MR5 A;  4MF2 A;  4DOA A;  3GZF A;  1KL9 A;  4RUC A;  5J2C A;  4TUS A;  1X6I A;  3PW7 A;  4IR9 A;  4F4Y A;  1IM4 A;  2AQ0 A;  1YZ6 A;  5ALU A;  7ICT A;  2FLP A;  5E79 U;  5B5E U;  8ICS A;  4J9M A;  1KFS A;  5KFV A;  3PMN A;  2RHF A;  5D49 A;  1B22 A;  3JPO A;  1HJP A;  1DRG A;  8ICI A;  2JV3 A;  4KX5 A;  3V72 A;  5J2F A;  2E8M A;  5DQI A;  5TZV A;  2PI5 A;  4BWM A;  2KKP A;  2KHQ A;  2YML A;  5KT6 A;  3T3F A;  2WF6 A;  2XI9 A;  3QU2 A;  2PKE A;  1ZQH A;  1SL2 A;  3WU2 U;  2J6T A;  5HR7 A;  5J0T A;  3SEN A;  3C21 A;  4B9M A;  3DV9 A;  1S77 D;  2JEJ A;  5DDY A;  3SV4 A;  3RTV A;  1RDF A;  3JPN A;  2OCE A;  2HHV A;  5J0Y A;  4Y2U A;  3K4G A;  1A77 A;  4R65 A;  1RYR A;  1RG6 A;  4ECY A;  2JZB A;  2ES6 A;  2WTF A;  1CEZ A;  1SWW A;  3PW0 A;  8ICQ A;  2KK0 A;  4ZH4 A;  3C5F A;  1T94 A;  9ICE A;  3UXN A;  1N60 A;  1ZQB A;  4FS1 A;  5EE1 A;  4RPZ A;  4F5R A;  2PFQ A;  1PVR A;  3Q8S B;  4RQ6 A;  5KFG A;  3NVY A;  4Y2P A;  4DFD A;  1MA7 A;  2E1E A;  5JU5 A;  4UB3 A;  4YMM A;  2RP5 A;  3MFH A;  1NJW A;  2F1J A;  1CI4 A;  4M0A A;  5J2B A;  4QZA A;  5AKG A;  4FZL A;  1KLN A;  3WK8 A;  1KFT A;  4BX9 C;  2WB1 F;  3M6Z A;  4QWB A;  4FE3 A;  4P4M A;  2KEY A;  3SR6 A;  3Q8Q B;  2UVV A;  4PHD A;  5DG7 A;  2KOB A;  1U45 A;  4QWD A;  4YR2 A;  3PX4 A;  2EAP A;  4EYI B;  3TQ1 A;  2H3I A;  3HPO A;  4DQP A;  4DQQ A;  5ALH A;  3AU6 A;  4KLT A;  3PW4 A;  4GC6 A;  4P0Q A;  2QLT A;  7ICL A;  1UCV A;  1ZQY A;  1V85 A;  3LVW A;  4XA5 A;  4RQ0 A;  5KG3 A;  2A19 A;  1ZET A;  3WK6 A;  2M9N A;  2K4E A;  1L5U A;  4C8L A;  2AGP A;  4F92 B;  1N5X A;  1TFR A;  1ZQU A;  2P6U A;  8ICM A;  4ECR A;  9ICG A;  4UQG A;  3E0F A;  2K89 A;  4Q8E A;  5KFY A;  3B9J A;  4P0P B;  1FFV A;  3HRD D;  3SAG A;  1NK5 A;  3RH6 A;  1P7D A;  3D6J A;  2FMQ A;  2XO7 A;  2FDR A;  2ZIX A;  8ICW A;  4JV1 A;  3E58 A;  3NVZ A;  5EE9 A;  5DGA A;  1UA0 A;  1XSN A;  2XCP A;  2H3Q A;  1KFD A;  1TE2 A;  4DSK A;  4CNQ A;  4C4S A;  1UA1 A;  5AM0 A;  4UAS A;  3OJU A;  1KN5 A;  1Y88 A;  3TFR A;  4U7C A;  3DDH A;  2HOI A;  1NI3 A;  8ICB A;  3H0R B;  2EDU A;  5TIS U;  1HEK A;  1SV0 A;  2RLT A;  2B6G A;  4ECW A;  2FPM A;  1L8L A;  9ICP A;  2QB0 A;  1FEZ A;  3QUQ A;  5J2I A;  1DK2 A;  2BHN A;  2Z7J A;  2KZM A;  1S97 A;  4ECQ A;  3M1Y A;  3THV A;  1ZYQ A;  5ALR A;  3MR6 A;  3JPS A;  4PGY A;  4NM1 A;  4YVZ A;  5KT3 A;  2G06 A;  4UAZ A;  4RPY A;  2ATL A;  1OXJ A;  3A0B U;  2ZUD A;  1B4F A;  3QEA Z;  2W9A A;  2ISP A;  1ED1 A;  2JXJ A;  5J8Y C;  4KLF A;  4QNL A;  4Z6D A;  3TAD A;  3PML A;  4MFA A;  5G5H A;  3FYH A;  3CNH A;  2DKZ A;  3ISB A;  5EWG A;  5ALD A;  3H0L B;  4PH5 A;  5D4B A;  4OCZ A;  2R8I A;  1ZRM A;  5DB6 A;  5L1J A;  4DL6 A;  3C23 A;  4Y2X A;  2B0C A;  3V7L A;  5JUM A;  7ICN A;  9ICN A;  2VIX A;  2HHT A;  1S8O A;  5DKW A;  2XGQ A;  1SV0 C;  2ZIW B;  3L3F X;  3SZ2 A;  5CR0 A;  4KLJ A;  4IRK A;  2XGP A;  3KZX A;  1MC8 A;  5KFX A;  4NL9 C;  2ZIX B;  2OHF A;  2FLL A;  2F77 X;  3Q8M A;  5CP2 A;  2LHT A;  8ICF A;  4JWN A;  9ICU A;  1ZQW A;  4KLD A;  5KFS A;  2ZXH A;  4F91 B;  8ICN A;  3QUB A;  4O3O A;  4DFJ A;  3F2B A;  5J2K A;  4RQM A;  5J0W A;  2F1I A;  2LKY A;  4DL2 A;  2BDU A;  5KFH A;  9ICO A;  1SKR A;  5IIL A;  4YR0 A;  1QQ6 A;  5F9L A;  3IDW A;  3IG5 A;  1ZRN A;  1KDH A;  5KL1 B;  3NAS A;  3HWT A;  3RRH A;  5DG9 A;  1X9X A;  1L7M A;  2YB1 A;  3O0F A;  2UVR A;  3AMZ A;  4ZOH C;  3MDA A;  4UB6 U;  1NK7 A;  4AYB C;  1KSP A;  5DQG A;  1QSS A;  1C20 A;  1TKD A;  3N28 A;  3V6H A;  2UVU A;  1RZT A;  2BCV A;  1NZP A;  2QAR A;  1QQ5 A;  5KG7 A;  2F8L A;  1WYG A;  3JPR A;  5KFU A;  3QU4 A;  2PI4 A;  4O3S A;  5AK3 A;  4R8U A;  4B9V A;  1ZQT A;  3GIM A;  3TAN A;  2KN7 A;  2PMZ F;  4RNN A;  5AI9 A;  1SZH A;  4DL4 A;  4KIT B;  4R66 A;  4IC9 A;  4YCX A;  4UB2 A;  5AIB A;  4FBU A;  5AM4 A;  1BGX T;  3KHL A;  3KD3 A;  4B9U A;  3M8R A;  7ICI A;  2HHQ A;  4GC7 A;  4RT2 A;  1KQQ A;  5AKJ A;  2R18 A;  4I27 A;  5KFQ A;  4RQ2 A;  1Z1V A;  3T5J A;  1U47 A;  1JRO A;  1O03 A;  1S0M A;  5KFB A;  4J9Q A;  2XVT A;  4JV0 A;  1L7P A;  9ICM A;  2NYV A;  1O08 A;  2F44 A;  1LKY A;  1QSL A;  3OJS A;  5GTI U;  4TUR A;  2ZTE A;  1U4B A;  1N63 A;  4KLQ A;  4OJL A;  4Q43 A;  2W8L A;  1TAM A;  4ED6 A;  4M6W B;  7ICG A;  2WAQ C;  4F4X A;  8ICZ A;  2ASD A;  1N5W A;  3PR4 A;  5KFA A;  1ZJM A;  7ICK A;  4ECS A;  3OGU A;  1TAQ A;  2CPR A;  3V7J A;  4F4W A;  1K1Q A;  4O3Q A;  3QZ7 A;  4Y2V A;  1N62 A;  2EAN A;  3G6V A;  1F0M A;  2W9B B;  4BWJ A;  8ICA A;  2BKE A;  3RB3 A;  1N56 A;  3L4P A;  4Y2R A;  5CHG A;  3RJG A;  4MEX A;  4I2A A;  5ALL A;  4OJP A;  1D8Y A;  1UT8 A;  3ALR A;  4C80 A;  1ZQO A;  2WF9 A;  5DBB A;  3RR7 A;  1BPX A;  2KSO B;  2GOL A;  3CW2 C;  3JPP A;  4UAV A;  5DBC A;  2OXO A;  1XSL A;  8ICL A;  1N2X A;  2Y1J A;  4DSF A;  1FFU A;  3N7P D;  4QZ8 A;  3RB4 A;  1BVS A;  2KP7 A;  2V9W A;  2L5Y A;  1D9D A;  3IG8 A;  4NLK A;  2BPF A;  1FIQ A;  2HW3 A;  1WWU A;  1HUO A;  4RZR A;  3BQT A;  3RH5 A;  1D9F A;  4IQT A;  2HBM A;  1ZQV A;  3HX0 A;  5AM5 A;  5KFP A;  2VA8 A;  1S0O A;  1T3Q A;  4YG2 A;  4UB1 A;  2ZJ8 A;  2K4I A;  3OTQ A;  5KG2 A;  5ALF A;  4EX7 A;  4F5Q A;  4KMU A;  3RH4 A;  3CYM A;  1L7N A;  1BPZ A;  4O9M A;  2NO5 A;  1RPL A;  2HDO A;  1C7Y A;  4DOC A;  4KTQ A;  5CWR A;  3AU2 A;  2BCR A;  2W11 A;  2G08 A;  2KG5 A;  3G6Y A;  9ICH A;  3OSP A;  3H4B A;  1ZQK A;  4KLS A;  1KKX A;  1Z4O A;  3MGV A;  2MU2 A;  5HHI A;  1Q8K A;  1PZN A;  2F3N A;  3PX0 A;  5J2H A;  4J9S A;  4Y2S A;  3K75 D;  5HHH A;  4IS7 A;  4Q45 A;  2OM6 A;  2JRZ A;  5J2G A;  4C8N A;  3EW9 A;  2W7O A;  2ZIU A;  3C1Z A;  1L3T A;  4USA A;  1IG6 A;  5ALN A;  4UB8 U;  4YD2 A;  8ICG A;  3ZDA A;  4I2F A;  4WJ3 B;  8ICJ A;  4MEY A;  2FMP A;  4NLC A;  5DB7 A;  4B9L A;  8ICH A;  2HMX A;  1BPE A;  2EZX A;  2B21 A;  1IV8 A;  1AQ6 A;  3DEE A;  1RXV A;  5ALK A;  3GII A;  3RJH A;  2QAR B;  3C2L A;  3RJE A;  2OYY A;  3BS5 B;  5ALM A;  1Z1B A;  4FZM A;  4DFM A;  1Z19 A;  1PVP A;  3MBY A;  4I28 A;  3F2D A;  1MN8 A;  1ZD3 A;  4ED7 A;  3QEB Z;  9ICL A;  2ZIU B;  2KTQ A;  2W55 A;  2W03 A;  9ICI A;  3C1Y A;  2V4Q A;  4US9 A;  4DWI A;  5KG6 A;  4CRX A;  2AQ4 A;  4NJ8 A;  2IOH A;  4B9N A;  2JHD A;  3HIL A;  1A76 A;  2NO4 A;  4EEL A;  2CRX A;  4NWI A;  3D2N A;  2E8O A;  2BQR A;  2HOQ A;  4F5O A;  3RAX A;  3M9N B;  5AHX A;  5L1I A;  1YZ7 A;  4OJ5 A;  3CRX A;  2NRT A;  4ECZ A;  9ICX A;  5CEH A;  4UAT A;  4QWA A;  1QH9 A;  3LYS A;  1ZQN A;  4EX6 A;  2AGQ A;  2ZJA A;  4BXO B;  5B66 U;  4O3R A;  2O6K A;  3ONN A;  3IM1 A;  4CDG A;  5ALP A;  3ED5 A;  4GFJ A;  1COO A;  4KN7 A;  4QW8 A;  4UAW A;  3RBE A;  4F3O A;  3GIJ A;  2VA3 A;  1ARO P;  5KFJ A;  9ICC A;  1JN3 A;  2KHV A;  2FPK A;  2BZF A;  3WK7 A;  3OSN A;  5ALW A;  3NVW A;  2G07 A;  4ED3 A;  2ZJ5 A;  1SXE A;  2A3V A;  1SB3 C;  4P0P A;  1TK0 A;  7ICQ A;  2KJ9 A;  3FDS A;  4DL3 A;  2I9G A;  4I29 A;  2DUY A;  4DO9 A;  2E8N A;  4UAR A;  4ECU A;  4YXJ A;  4R63 A;  2JMG A;  2HBK A;  2XY6 A;  7ICR A;  1NK8 A;  5AKK A;  1OW5 A;  3LDA A;  3MR3 A;  2CXY A;  9ICT A;  4PGX A;  4QZE A;  2YMP A;  3FM9 A;  4CF4 A;  1COK A;  3JPT A;  5DDM A;  1RYS A;  1D8L A;  3HJE A;  1QTM A;  2GO7 A;  1WCL A;  4C8O A;  4J9O A;  1Z00 A;  4FS2 A;  3NRW A;  4US8 A;  3LWM A;  1BPB A;  5J2D A;  2MRL A;  1A0P A;  1B0X A;  2KD1 A;  1HUZ A;  4B9S A;  8ICT A;  5AM2 A;  1J2M A;  3M8S A;  2JEF A;  3QU9 A;  3H7I A;  2IA6 A;  1JAL A;  2BPG A;  4O3M A;  3BQ0 A;  3PO5 A;  4M9N A;  4UW9 A;  2HOF A;  2PFP A;  3OHA A;  3SQI A;  2ZIW A;  2KIC A;  3HT3 A;  7ICM A;  3R9K A;  1ZXI A;  2W9C B;  1QQ7 A;  3SYZ A;  1IIP A;  1ZJN A;  3SMV A;  4F5N A;  2W9B A;  4EYH B;  8ICE A;  1MQ3 A;  2FJ6 A;  2F76 X;  3QX7 A;  4F93 B;  4OO1 J;  4I2D A;  1ZQF A;  3PX6 A;  4RQ5 A;  2AU0 A;  4M9G A;  3N7R C;  2PMZ C;  4DSE A;  2HCF A;  4QWE A;  2FLN A;  4BXO A;  2W43 A;  3Q8P B;  3ZDE A;  1V9P A;  2MSN A;  3GDX A;  1XO0 A;  1V38 A;  9ICR A;  4GXJ A;  4EZ6 A;  3B0Y A;  2OWO A;  2VJ4 A;  4HAI A;  4EBC A;  2LYB A;  2LM4 A;  3UXP A;  2HHW A;  2IHN A;  3MR2 A;  4RUA A;  3OHB A;  2KV2 A;  2W7P A;  4C7Y A;  3F2C A;  3IRU A;  3Q8R B;  2DQN B;  4ED0 A;  2DL0 A;  2IHM A;  4F4K A;  3NUQ A;  1LKY B;  3I28 A;  1U48 A;  3G6X A;  3BDP A;  4DOB A;  3WK4 A;  3WKC A;  2RDI A;  3HW8 A;  2VJ5 A;  2Y0S F;  4DLG A;  3GV8 B;  4RNM A;  4JV2 A;  5KAF U;  3TI0 A;  2HBJ A;  1NOM A;  4I2H A;  3GIL A;  3TAR A;  2ODG A;  3QXG A;  1F5S A;  5EE3 A;  4KN4 A;  4F2R A;  3ETR A;  4YMO A;  1NJX A;  1UHU A;  3UM9 A;  2K4H A;  3RFA A;  4C0Z A;  1RQN A;  3BS5 A;  3UMG A;  2NRW A;  1ZQZ A;  2AHO B;  1CRX A;  4DF8 A;  2K8C B;  3PR5 B;  4IRC A;  5ALT A;  1XNS A;  1X9W A;  2JH1 A;  4IL6 U;  5J2E A;  2F2A B;  5EWF A;  2Y1I A;  3K1R B;  2FI1 A;  4F4Z A;  2K8A A;  2YMM A;  3VCB A;  3T5H A;  5C5J A;  4QZB A;  2R8J A;  3M6K A;  5KFO A;  3IHQ B;  2BGW A;  5AI0 A;  2R8G A;  4OJ6 A;  5DGB A;  3U26 A;  1JMS A;  4F2S A;  3AEV A;  4MHV A;  4ELU A;  8ICU A;  3PSP A;  1TV9 A;  1EXN A;  1KW4 A;  8ICO A;  5HP4 A;  1N61 A;  1ZQL A;  4PPX A;  1ZQG A;  1NJY A;  2ZUC A;  5KFF A;  5D46 A;  3GV5 B;  3F5A A;  5KG1 A;  3KTQ A;  4F72 A;  3N97 B;  8ICP A;  3KZI U;  3Q8K A;  2I6X A;  5KT2 A;  4IRD A;  7ICP A;  5ALX A;  3QZ8 A;  4DSL A;  4Z6E A;  3SD7 A;  2G5I B;  5J0U A;  1ZD5 A;  3B0X A;  5T14 A;  2JZB B;  2EAO A;  4C7Z A;  5DB9 A;  5K4L A;  3S6J A;  2IMW P;  2ESE A;  3AM9 A;  2BQU A;  4K4I A;  2FMS A;  5AKY A;  2IOF K;  4EEN A;  2R8H A;  7ICS A;  1WCN A;  1NKB A;  2AH5 A;  4KLO A;  3RR8 A;  2MUT B;  2GH1 A;  3H8S A;  5ALJ A;  8ICC A;  2C28 A;  4RQN A;  3TAD C;  3BZC A;  4AYB F;  1SKS A;  4TUQ A;  4RU9 A;  2ZXI A;  4YN4 A;  3RJI A;  3F53 A;  2JEG A;  5AKX A;  1S5L U;  4YD1 A;  1ZQD A;  1ZQP A;  2UVW A;  1Q3U A;  3QU7 A;  1VJ5 A;  4DFK A;  4R64 A;  4KX3 A;  3K1Z A;  4G3I A;  2KIW A;  2XCA A;  4ED8 A;  4KLH A;  1ZOL A;  5HMM A;  5L1K A;  2XY7 A;  4M9J A;  4M04 A;  5HR6 A;  3WKA A;  4XRH A;  1MQ2 A;  1DGS A;  2P35 A;  2FPL A;  3MGI A;  3EWA A;  4KLM A;  2QB1 A;  2HHS A;  4CF5 A;  3MAB A;  2W3S A;  3AL0 B;  1A6S A;  1SIJ A;  1ZQS A;  1BNP A;  4LZG A;  4DEZ A;  1ZQX A;  2AJQ A;  2DGZ A;  3QNM A;  4DLE A;  5DLG A;  4DFP A;  4PL1 A;  5AK4 A;  5CB1 A;  1V97 A;  1PUZ A;  1SGG A;  3BQ2 A;  3RJK A;  3Q8L A;  2XIC A;  1UT5 A;  2ZUB A;  3SEI A;  2KZ3 A;  3H4D A;  5DLF A;  2I5H A;  4DS5 A;  4M6W A;  2J6S A;  2ALZ A;  4EEY A;  4F50 A;  1PVQ A;  4X5V A;  1KRP A;  1RM6 C;  5EE0 A;  2WF5 A;  5ALZ A;  2AGO A;  5KFM A;  5F3X B;  4ED2 A;  1ZQR A;  2A1J B;  4NXZ A;  4LVS A;  2EZZ A;  4O5C A;  3PW2 A;  2JR5 A;  2ZTC A;  2DPJ A;  4YMN A;  3T5K A;  2E5S A;  2LM1 A;  4J9K A;  3RF9 A;  1X9S A;  2KVS A;  9ICF A;  3AQF A;  3HP6 A;  5AKL A;  4Q8F A;  5KTQ A;  2RDJ A;  1SWV A;  2LYH A;  7ICU A;  1T3N A;  3QU5 A;  1XO1 A;  1S0N A;  1NK9 A;  2VA2 A;  1OUQ A;  3EPI A;  2LBO A;  1T4G A;  4O3N A;  4M9L A;  5EOZ A;  2EZY A;  4RQ1 A;  1BNO A;  1HIW A;  5A0L A;  1TK5 A;  2A1J A;  4QZD A;  2F8K A;  2IOF A;  4JB3 A;  4M47 A;  5HML A;  4QZG A;  4RT3 A;  2I1Q A;  5ALS A;  4ECT A;  3BQ1 A;  1Z4N A;  1DOQ A;  2BR0 A;  3QUT A;  3ZI4 A;  2KSO A;  3T79 A;  5J0S A;  1ZQ1 C;  3RJF A;  3UXO A;  1T8E A;  2MAX A;  4O3P A;  1PK3 A;  1BPY A;  4NV0 A;  1L8O A;  2YQE A;  3MGH A;  2Y9T A;  3F5E A;  3FC4 A;  4GXK A;  2G09 A;  4JK1 A;  2YB4 A;  3NRZ A;  4U6P A;  2EQY A;  4UB5 A;  4O0I A;  1DXS A;  3EPG A;  5HNK A;  4M9H A;  1J97 A;  5J0X A;  4IR1 A;  2K60 A;  1X2I A;  2KFZ A;  4K4H A;  3CP8 A;  3SAF A;  5GTH U;  1F44 A;  1SZP A;  3BJY A;  5KT4 A;  4AP9 A;  4Z6F A;  3KBB A;  2G5H B;  4TQS A;  2JGA A;  8ICV A;  3ISD A;  3I1Y A;  4C8M A;  4CCH A;  3WK9 A;  4DQS A;  3ZDD A;  3KHH A;  5J29 A;  4F8R A;  1XU4 A;  3ZD9 A;  4KMO B;  5KG4 A;  1DK3 A;  1L3S A;  2HVH A;  3PVX A;  2VKQ A;  3V7K A;  3OPX A;  2ZTD A;  5AIA A;  5AK5 A;  1S9F A;  2JH7 A;  3KOO A;  5DG8 A;  1U49 A;  3RRG A;  5JTI A;  2W9C A;  4Y2Q A;  4M2Y A;  5ALO A;  3H8M A;  9ICW A;  2BCS A;  2BDP A;  2GWS A;  5IIO A;  1DGJ A;  8ICK A;  1S0V A;  4CGZ A;  4C4R A;  2WF7 A;  2BCQ A;  1L3U A;  1X6J A;  4QZC A;  2OEH A;  4QWC A;  4RPX A;  2F1H A;  2E3T A;  5ALI A;  2DF4 B;  4PL2 A;  5ALQ A;  2BCU A;  4LJX A;  3I76 A;  4DSJ A;  4QJF B;  1CUK A;  2W9M A;  2C2R A;  3EYZ A;  1ZQE A;  3SAH A;  5KFI A;  4PHP A;  2HHX A;  1TVA A;  1IXR A;  3GU3 A;  2WB1 C;  5L1L A;  1NJZ A;  2D8C A;  2BQ3 A;  4ACO A;  3KKA C;  7ICE A;  4J9L A;  2ASJ A;  4UBC A;  3WKD A;  3NTU A;  1XWL A;  2QB0 B;  3MFI A;  1WWV A;  4C4T A;  9ICJ A;  8ICY A;  3TAC B;  3WK5 A;  2KVC A;  2D3D A;  1LVH A;  5KFR A;  3AUO A;  4K4G A;  1BPD A;  4J03 A;  4NLG A;  3UPQ A;  1XC9 A;  2H3Z A;  3ISC A;  3NVV A;  1JUD A;  2P6R A;  5J2J A;  2KZZ A;  5AIC A;  1GO3 F;  5J0P A;  1L3V A;  3TAP A;  2K4P A;  3N7S C;  5BPC A;  4NLZ A;  1VLB A;  1RYU A;  2PXI A;  3PST A;  5KFK A;  2N1R A;  4EEK A;  3WKB A;  2FE9 A;  3MDC A;  3PW5 A;  3ZDB A;  2YX8 A;  2VAN A;  2AXT U;  3BZK A;  5J8Y A;  1SXD A;  1NKC A;  4EZ9 A;  5IIK A;  5JRT A;  4RQ7 A;  5KFE A;  3ETL A;  4RNO A;  3SI8 A;  3ORY A;  1ZQC A;  3JPQ A;  4NM2 A;  4GXI A;  2CN1 A;  5KFD A;  3RJJ A;  4UAY A;  5AI5 A;  4I2B A;  1MSW D;  4FO6 A;  4EBE A;  5ALE A;  9ICB A;  4PHA A;  4RQ8 A;  4DL5 A;  2EH9 A;  3AQE A;  4Q44 A;  3BS7 A;  1QCK A;  5KFN A;  2MA1 A;  4GLX A;  4XUS A;  4P0Q B;  3M9O B;  3GIK A;  4P4P A;  1Z3E B;  1JX4 A;  3AN1 A;  3M9M B;  2P66 A;  1JXE A;  1VDV A;  4MFC A;  4GIB A;  5EWE A;  5KG0 A;  3H8W A;  4UB4 A;  1ECW A;  5KL8 B;  1JIH A;  1JI7 A;  2KIV A;  1NK0 A;  4IQW A;  2KNJ A;  4Y2T A;  3IV6 A;  3QE9 Y;  2Y9U A;  4QZH A;  4QW9 A;  2RRD A;  5F9N A;  4FZN A;  3RBD A;  3C29 A;  4UBB A;  2K8B B;  3RAQ A;  5J0R A; 
#chains in the Genus database with same CATH homology
 3RF9 A;  2F8L A;  3LYS A;  2HOF A;  2KKV A;  2KOB A;  2ZXI A;  3AQF A;  2LYA A;  2G06 A;  3ONN A;  2D6F C;  2OM6 A;  2RHF A;  3F53 A;  3SQI A;  2ZIW A;  2KIC A;  2H3I A;  2H3Z A;  4QIW F;  4OJP A;  4CDG A;  1CRX A;  3ALR A;  1DRG A;  2K8C B;  1UPH A;  4OJO A;  2PMZ F;  2ZIU A;  4GFJ A;  2W7O A;  4KMO B;  1Q3U A;  2WAQ F;  4KX5 A;  1GO3 F;  1SZH A;  3PSF A;  2VKQ A;  1IIP A;  1XNS A;  2NV3 A;  3OPX A;  3HKZ F;  2JH1 A;  3ICX A;  3IP4 B;  3LVV A;  2GOL A;  3N7S C;  4IC9 A;  4P0Q A;  3SMV A;  4KX3 A;  1OUQ A;  2KKP A;  2ZIV B;  2F2A B;  2KHQ A;  2LBO A;  3VC8 A;  2H3V A;  2OXO A;  3K1Z A;  3PST A;  3LVW A;  2N1R A;  2KHV A;  2KIW A;  4WJ3 B;  2XI9 A;  1ED1 A;  1WUD A;  2F76 X;  2JH7 A;  2G07 A;  4NLC A;  4QNL A;  4A8E A;  3C28 A;  5HR6 A;  2K8A A;  2OH2 A;  2HMX A;  3VCB A;  5HR7 A;  1HIW A;  2R18 A;  3N7P D;  3M6K A;  5A0L A;  2K4E A;  2A3V A;  4P0P A;  4OO1 J;  2YX8 A;  3HKZ C;  3DEE A;  2KJ9 A;  3KFU F;  4QIW C;  3H0L B;  3D2Q A;  3IN5 A;  4OJ6 A;  2HBL A;  3N7R C;  4CGZ A;  1D8B A;  2KJ5 A;  2PMZ C;  3IG8 A;  1URJ A;  3AL0 B;  2OYY A;  1Q3V A;  1KBU A;  1NZB A;  1A6S A;  3PZP A;  2JMG A;  1Z1B A;  3PSP A;  2HBK A;  4FZM A;  2Y0S C;  3E0F A;  1YT3 A;  1Z19 A;  1PVP A;  2K89 A;  1XO0 A;  2XVT A;  4NLB A;  2VIX A;  3F2D A;  2H3F A;  2DF4 B;  4P0P B;  4PL2 A;  2E1F A;  2DGZ A;  5CRX A;  2CN1 A;  4ICA A;  4PL1 A;  2ZIW B;  3L3F X;  2HBM A;  2VJ4 A;  3PSI A;  3T79 A;  4BUG A;  3F5A A;  3SAG A;  5C0Y A;  1ZQ1 C;  4BJQ A;  1T94 A;  2LYB A;  4QJF B;  2ZIU B;  1P7D A;  3KZX A;  2KJ8 A;  2ZIX B;  2XIC A;  4NV0 A;  2KV2 A;  2ZIX A;  2F77 X;  2W7P A;  1PVR A;  2LHT A;  2W03 A;  3F2C A;  3SAH A;  3F5E A;  3M7D A;  4JMU A;  2ZG6 A;  2DQN B;  2ZXH A;  2G5I B;  2G09 A;  2K4I A;  3AQE A;  1MA7 A;  5T14 A;  2YB4 A;  2H3Q A;  4OJL A;  3F2B A;  4CRX A;  2XID A;  4U6P A;  2LKY A;  3CYM A;  1TAM A;  2MA1 A;  2BDU A;  3GU3 A;  2E1E A;  3D2S A;  3NUQ A;  2WB1 C;  4P0Q B;  2JHD A;  2ZIV A;  2RP5 A;  2WAQ C;  3H0M B;  4C0Z A;  4U7C A;  4ACO A;  2CRX A;  3NRW A;  2HOI A;  3IG5 A;  4NWI A;  5KL1 B;  3D2N A;  1PVQ A;  3H0R B;  2VJ5 A;  2M0N A;  2Y0S F;  2HOQ A;  1HEK A;  2G08 A;  4FZL A;  2MRL A;  1A0P A;  1ECW A;  2KD1 A;  3O0F A;  2YB1 A;  2Q4T A;  2HBJ A;  5KL8 B;  1L6N A;  2G0A A;  2W04 A;  4BX9 C;  2CPR A;  3CP8 A;  2GH1 A;  4OJ5 A;  2WB1 F;  3SAF A;  4AYB C;  3M6Z A;  1F44 A;  3CRX A;  2KNJ A;  2RRD A;  3GZF A;  2Z7J A;  4FZN A;  4FE3 A;  3MGV A;  2G5H B;  4O3M A;  3C29 A;  2E5S A;  2JGA A;  2K4H A;  2K8B B;  3RFA A;  2KEY A;  4AYB F;  2KVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...