2K8CB

Solution structure of plaa family ubiquitin binding domain (pfuc) trans isomer in complex with ubiquitin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k8cB00
3L3FX 3PSTA 3PSPA 2K89A 2K8CB 2K8BB 2K8AA
chains in the Genus database with same CATH superfamily
5TISU 5KFOA 8ICCA 1PVPA 4O3PA 4ACOA 1L7MA 3RAXA 2F76X 1TE2A 2P6RA 2WHEA 5L1MA 5ALQA 3TARA 4I2IA 5KFJA 4KMOB 2YMPA 4O5CA 2P35A 4IS7A 5DB8A 3UXNA 1X6JA 2G5HB 2PFOA 1MQ3A 5BPCA 3C1ZA 2KTQA 4FE3A 4GFJA 3ZDEA 3ZDCA 4RU9A 2XGPA 3PX6A 3D6JA 1TK8A 2FMQA 5HMMA 1NI3A 2EAOA 2E3TA 2HVIA 2V9WA 4UB4A 3SAGA 2E8PA 3UXOA 3MFHA 5KFAA 1X9MA 3MGVA 3JPQA 2B0CA 1ZQDA 5AI6A 2QB1A 5AM1A 3NS1A 3Q8RB 1SV4A 2J6UA 9ICIA 3H0LB 4Z6FA 4ED0A 1JXEA 1ZQLA 5J2GA 4RNOA 3KHRA 4LVSA 5KT5A 4QWCA 4ECQA 1CRXA 1Q8KA 4FZLA 3ZDAA 4PHPA 3RB3A 5J0WA 2A1AA 3RF9A 8ICZA 4Y2UA 1CEZA 4B9LA 4USAA 4U7CA 1N5XA 1RDFA 5CJ7A 4QIWF 1ZQHA 4IL6U 2ZG6A 3HT3A 3UQ2A 1NK6A 4F8RA 2P6UA 3ISBA 2V4RA 2W04A 1KEJA 3RJIA 4JV0A 4RUCA 3N4MB 2AGOA 2PI4A 3GV8B 3ZDDA 2MU2A 2GWSA 4DSEA 2KE7A 1UT5A 5KG3A 1L8OA 1PZNA 1SIJA 1ZQTA 1NZBA 4C8NA 1UCVA 1Z19A 3KKAC 4YMOA 1V38A 3K1RB 5KG6A 2XY5A 5DLFA 3SV3A 7ICFA 4UASA 4M47A 1QCKA 1NK4A 1N62A 3PMNA 1XO1A 2P66A 2HHVA 4GXIA 1JIHA 3IRUA 1D8YA 3BZKA 2FLNA 4PPXA 5D46A 2I1QA 3M7DA 5ALHA 1UHUA 2GLEA 2OEHA 3WKBA 1UA1A 5DBAA 5J2DA 2DF4B 3BQ1A 4QWDA 1C20A 2R8JA 4UB1A 1BPEA 4BJQA 5TZVA 3KHLA 5AIBA 5HNKA 4PZOA 1WG8A 1S0MA 2NV3A 4KLFA 2XY7A 2NO4A 1KSPA 4Z6EA 3TFSA 5CWRA 4EEKA 7ICEA 4PGXA 4O5EA 4LJXA 3V6JA 4P4OA 4TQSA 4K4IA 1A0PA 2A1JA 4DOBA 2W7PA 3C5FA 3HRDD 3TFRA 2ASDA 1WYGA 1ZQAA 3D2SA 3GIIA 5EE9A 4EYHB 2RDIA 4CE6A 2BPFA 3SAFA 4MFFA 4F3OA 2LYBA 1L6NA 2XCAA 3EYZA 4DF4A 4DFKA 4KLIA 3H4DA 1T7PA 2E1EA 3OHBA 2LMRA 4J9RA 2A3VA 1LVHA 2ASLA 5K4LA 2W9CB 2K4EA 3VC8A 2LPEA 4YFKA 3C2KA 4US9A 1XO0A 3Q8MA 3RJJA 4DFMA 4J9LA 3IG8A 2HSZA 1ZXIA 1ZD4A 5DKWA 2VA2A 2NRWA 3QZ8A 4YP3A 5AI4A 3MBYA 3EPIA 4NM2A 1BVSA 4ECSA 5AKLA 3SMVA 1S9FA 1GO3F 1RXVA 5KFYA 3MR3A 4NLZA 8ICFA 3QU4A 1EXNA 3BJYA 3H8WA 3MDAA 3M9OB 1S8OA 4AYBC 3QNMA 1JMSA 4ELUA 4KN7A 1L3VA 1KFDA 4B9NA 3HKZF 2ZJAA 2M9NA 1SWWA 2HBKA 4UW9A 3SI8A 3QU7A 1ZQZA 5AIAA 1RPLA 3MR6A 1QQ5A 4QW9A 4Q44A 1BGXT 4EX6A 1ZRNA 5T14A 3TAPA 3M8RA 3HW8A 3SENA 5J2HA 1NKBA 4RNNA 4R66A 4XUSA 2WB1C 2CXYA 3OJUA 2BCVA 2K4PA 4M9JA 4OO1J 5F3XB 4F2SA 4C8LA 4C80A 2UVWA 4DFDA 3F2BA 3THVA 3KD3A 1ZD3A 3ORYA 1X9SA 3QUTA 1Z00B 2ZTDA 2RLTA 3H0RB 1UT8A 2LHTA 3LVWA 5DBCA 2D8CA 5IIJA 1SL1A 1QSSA 2HDOA 3WKEA 4ECVA 1MA7A 3AQEA 8ICXA 2HOQA 2W9MA 3CP8A 1H38A 2EQYA 2FDRA 2G09A 3TQ1A 3HWTA 1FFVA 2KVSA 5IINA 2ZTEA 3HJEA 2NRZA 3EPGA 4U6PA 9ICTA 2JGAA 5AKGA 3KHGA 4YXJA 4QZIA 4RUAA 4J03A 3IP4B 4I27A 1QQ6A 1O03A 2IOFA 4EBCA 4ZOHC 4MHVA 3R9KA 3OTQA 2GO7A 3GDXA 3M6KA 3PO5A 5KT3A 3I1YA 2EAMA 2KV2A 3ISDA 3TI0A 1NJYA 4DS4A 1OXJA 1J97A 1NK8A 1RZTA 4C4SA 3T79A 4F4KA 1S10A 3BS7A 4I28A 3H7IA 5KFLA 2W43A 4BUGA 1S0OA 2PMZF 5KFPA 4JMUA 1ZQEA 2ZJ5A 4RQ3A 4FBTA 4MEYA 1ED1A 2GH1A 3KHHA 5J0OA 3H4BA 3CRXA 4ECWA 1ECWA 1ZQUA 5KG4A 4C4RA 2LBOA 1ZQYA 3QYPA 2Y9TA 1T4GA 5HMLA 1WWUA 4YXMA 3UPQA 1BPYA 1ZRMA 2ISOA 1ZQJA 3IM1A 2WF6A 2MA1A 5DDMA 1T3QA 4F4WA 4KLUA 4OJ6A 3FYHA 4ECUA 4GXJA 4NLKA 9ICJA 1L3UA 5ALRA 5EWFA 2W9CA 9ICLA 5J2JA 3N28A 5FP0A 2KP7A 4EENA 4R8UB 2H3ZA 3C2MA 5KT6A 1MQ2A 2MSNA 3QUQA 4G9BA 7ICTA 2V4QA 4EBDA 2KG5A 5EE1A 2H3FA 2FPLA 4ED1A 2E8NA 5AKIA 3NVZA 2BQ3A 4OCZA 4UB8U 2MUTA 2K4HA 2DL0A 4OJOA 2BGWA 3NVWA 2F1IA 4KLHA 4NL9C 3WKCA 1NJXA 1RYRA 8ICWA 3LK9A 3RJHA 1TVAA 4F2RA 4GC6A 1Z4NA 2AGPA 1N56A 1SKSA 2JR5A 5H2FU 1QSLA 3OPXA 2ZIVA 3WK7A 3KZIU 4PJ0U 9ICGA 3QU9A 4F71A 2NRVA 4GXKA 2W9AA 4RQNA 2W11A 1TK0A 1KN5A 1DK2A 4YVZA 4YD1A 2FLPA 2BZFA 5ALMA 2KJ5A 4F92B 1U48A 5AM2A 4M9GA 5J2EA 9ICOA 1KQQA 4KLTA 2PKEA 4ED2A 4KLGA 4DSKA 2WF8A 2JXJA 4IQUA 3G6VA 3BQ7A 5ALUA 4YN4A 4Y2XA 1SKWA 2W3RA 5D49A 2F8LA 3QEBZ 1PK1B 1KW4A 5AM4A 4BWJA 3J81j 4ECTA 4FFDA 4F72A 2DBYA 7ICHA 1YT3A 3PW4A 1KFSA 1SXEA 5G5GA 5KFUA 4M6WB 2ZUBA 8ICGA 2WAQC 4F4YA 5ALEA 2KSOA 2ZXIA 3QU2A 2GOLA 2XIDA 4ICAA 1AROP 2HHXA 1URJA 3AUOA 2G0AA 1ZQOA 2K4IA 3KFUF 2FLLA 2ATLA 2J6TA 2K89A 2DPJA 3PX4A 5KFMA 8ICOA 4B6JA 4NM1A 1WCLA 4DEZA 4KLDA 2G08A 4P0QB 5E79U 1O08A 4AYBF 3ZDBA 8ICQA 2ZIWA 4C8MA 4DQQA 3LWMA 3GIJA 1K1SA 4R63A 4QZFA 1ZQFA 2UVUA 3MGHA 2YY6A 2H3VA 7ICRA 4I2CA 1B0XA 4F4XA 1XC9A 2YB1A 3K4GA 4TUSA 3PY8A 4M9LA 4QZEA 2FI1A 4F5PA 2A19A 4TUPA 4IQVA 4EZ6A 4DO9A 8ICAA 4CF5A 1A76A 9ICNA 5AICA 5CA7A 4UB2A 2DFLA 2WF9A 3D2NA 2FMPA 4EYIB 3GIMA 1QTMA 4PL2A 4ECRA 3KKAA 1DRGA 2Y9UA 3PSIA 3ONNA 4EEYA 4RPZA 1JRPA 8ICPA 7ICKA 4O3RA 2N1RA 1ZQVA 2HMXA 5AKZA 5GTIU 3UQ0A 4QZGA 4KITB 4F5RA 3UXPA 2HHTA 3M1YA 1MN8A 4DLEA 1IM4A 4QW8A 1RQNA 1ZOLA 5HP4A 5KTQA 4PZNA 3RRGA 2KD1A 5KFNA 4RPYA 9ICCA 3GV7B 2LI6A 3QZ7A 2ISPA 4KLQA 2Q4TA 1PUZA 5J0XA 1Z1BA 2HHUA 5DLGA 5ALOA 4DLGA 5KNIA 3LWLA 1YZ7A 4UAZA 4K4HA 5KFXA 2EAPA 2BCUA 3UMCA 5EE0A 2QLTA 3VCBA 2ZIXA 1JI7A 4ELVA 4XRHA 9ICEA 3TANA 2KHQA 3GU3A 3H8JA 4P0PB 2DGZA 2JH7A 4RT2A 3RH5A 5KFQA 2L5YA 1X9XA 1NJWA 2HBLA 5KG2A 4F50A 1KRPA 2IOFK 1B22A 9ICQA 5KFDA 1S77D 2XC9A 2C22A 4YQWA 2F44A 2H3IA 2W9BA 2Y0SF 4UBCA 3WK4A 3AMZA 4RQ0A 3H40A 3QX7A 2D3DA 2BPGA 3KBBA 2KZMA 2KHVA 3NUQA 2YX8A 5JTIA 5HHIA 3RFAA 2FE9A 3Q8QB 2E1FA 3FC4A 4UB6U 4LZGA 2ZXHA 5C5JA 3SQIA 3RTVA 5CB1A 4DFPA 3KOOA 1NK7A 3MR2A 2KMDA 3F5AA 1U4BA 1JUDA 2C28A 4QZDA 3SD7A 1HJPA 3UMBA 8ICYA 1F44A 3FM9A 5B66U 5KFTA 1XSNA 3WK8A 4K4GA 2LYAA 2B21A 3B0YA 4DL7A 1Q3VA 4KTQA 3TKAA 4DSJA 1T94A 3EWAA 1S0VA 2RHFA 4J9OA 1TV9A 2W54A 4DCCA 1U45A 2IMWP 2RDJA 1VDVA 3I28A 4J9PA 1Q46A 3PMLA 3AL0B 1IIPA 4DL5A 4EX7A 5KFGA 4KLLA 1LV5A 2BQRA 4M04A 2ZJ8A 2K8AA 5ALPA 3Q8SB 3V7KA 5AM0A 2F2AB 2BQUA 5KG0A 2LM1A 3AU6A 5DQHA 3TADC 5BOMA 4KMUA 2KIVA 4O3QA 3WK9A 3RBDA 1QLNA 8ICKA 5KL1B 4KLJA 1ZYQA 2AXTU 1ZQRA 2PFNA 2IHNA 1TAQA 2RQ5A 5EOZA 4DSFA 3TACB 3WKAA 3EW9A 2EDUA 4EELA 1NK9A 5AI5A 1K5OA 2BPCA 4QZ9A 5KFFA 5J2FA 5KFVA 2JEJA 9ICFA 3H8SA 2UVRA 1SL2A 2PMZC 5CHGA 1VJ5A 3NGDA 2K8BB 2DQNB 4YD2A 4PHDA 8ICSA 4YR2A 3L3FX 5ALNA 4DOAA 4XA5A 2EZYA 1F5SA 5A0LA 3H0MB 4YCXA 4I2GA 2HCFA 4KLSA 3PO4A 3MR5A 3E0FA 9ICVA 1QSYA 4FZMA 3T5JA 5D4BA 4M2YA 3IG5A 4PGYA 1RQLA 2DKZA 5J2IA 5ALKA 1PK3A 1DGJA 4O5KA 4QJFB 4Y2RA 1DXSA 3MDCA 3V6HA 1Z1VA 3IV6A 3A0HU 3GFKB 3G6YA 1BPBA 2C2RA 4I29A 3ZD9A 7ICOA 2HHWA 7ICUA 3NVVA 1XS9D 3BS5A 4FZNA 2B6GA 5KT4A 3I76A 2MUTB 1J2NA 2PXIA 3M9NB 3G6XA 5J0QA 3TAQA 2BDPA 2H5XA 3M8SA 4F91B 1XSPA 4QNLA 3SV4A 4B9VA 2MAXA 2Y0SC 2KOBA 2ZIWB 1X2IA 1N5WA 4F93B 3PV8A 1RYSA 1L7PA 2BHNA 4RQ7A 1T3NA 3JPSA 5JRTA 3JPNA 5DG7A 4MF8A 4CF4A 5DB7A 4R64A 5DQIA 8ICMA 1ZQXA 2KKVA 3FAHA 5J29A 4B9SA 4PGQA 2WB1F 3HKZC 5JUMA 4MFCA 1SZHA 4DWIA 4FS1A 2PFPA 4TQRA 4C0ZA 2PI5A 1ZQSA 5IIOA 1NK5A 2XI9A 5DBBA 2AJQA 3N7PD 4QZBA 4BDPA 2KN7A 1FIQA 1LB2B 3K1ZA 4B9MA 5DDYA 4NL9A 3RJGA 5J0TA 1N48A 2EZZA 2ZIUB 3AN1A 2ZIUA 8ICBA 3RJKA 4FBUA 1NK0A 5DGBA 4ECXA 5J8YA 2HOFA 2J6SA 4IRCA 4NXZA 4RQ5A 4GLXA 2HVHA 2DUYA 4M6WA 3DDHA 1S0NA 1MC8A 2JEGA 5KFKA 4ED3A 4KX3A 4RQ4A 2G06A 1L7NA 1XU4A 4YMNA 3QE9Y 2VIXA 3GZFA 3Q8PB 1SKRA 9ICXA 1QH9A 2EH9A 3PZPA 1ZQQA 4UQGA 4TUQA 2WTFA 5KFZA 3RH6A 4JV2A 9ICUA 4PHEA 4UAYA 3JPOA 4B9TA 3RH4A 2DWQA 5DB9A 3RJFA 2DKXA 4F5NA 2ESEA 3T5KA 3RRHA 2QKQA 4Y2TA 2YQEA 2KK0A 2YTUA 1ZQGA 4KN4A 4OJPA 2F8KA 3LYSA 1Y88A 2MRLA 4JUZA 1MSWD 5L1KA 1RM6C 1KL9A 4GIBA 2XGQA 2BCRA 4IC9A 5ALVA 3IDWA 4DOCA 4DQRA 4Q8FA 5KT7A 4OD0A 4F5QA 1IG6A 1SB3C 2KVCA 2YN4A 4O3SA 5L1JA 2UVVA 1B43A 1ZQPA 5AKYA 4BXOA 3DV9A 1CI4A 5J8YC 3C21A 9ICMA 5HHHA 5AI9A 3RAQA 5J0SA 4DL3A 3V6KA 2R8KA 1P7DA 5KAIU 1UA0A 1WWVA 4CRXA 2EANA 5KFSA 4QWEA 5KFCA 3QUBA 1RG6A 1L8LA 1AQ6A 2CRXA 3KTQA 8ICEA 1X66A 5KFBA 1ZETA 1V9PA 4DL4A 4B9UA 5AK6A 5G5HA 3NVYA 2IHMA 2W3SA 9ICHA 1N60A 4UB3A 3S6JA 1ZQIA 2W03A 1FO4A 2E8MA 1QQ7A 3C23A 3B9JA 4KX5A 4QWAA 4DQSA 4DQIA 2W8LA 3SEIA 3C29A 4ED7A 4I2BA 4I2DA 2ALZA 5AKXA 2KSOB 4Y2SA 1LKYA 1X42A 3T5HA 2YMQA 3NRWA 1KLNA 5AM3A 4R8UA 5J0UA 2FMSA 1UPHA 5ALFA 4RT3A 4QZHA 4GC7A 1NJZA 5AHXA 4P2HA 2KICA 2LKYA 1K1QA 1BPZA 1N63A 3FDSA 4BX9C 4I2HA 3QXGA 5ALZA 2XY6A 1KDHA 2QB0A 2JEFA 8ICJA 2YB4A 4Y2PA 3F2CA 2K60A 5IIIA 2IOHA 1ZD2P 3UMGA 4UAWA 4E0DA 4M9HA 3CYMA 1WUDA 4Q43A 2JRZA 2AQ0A 4Q45A 4C8KA 2NRTA 1NNLA 2AH5A 1BNPA 3BDPA 1SGGA 1N61A 2QARA 3NTUA 4PHAA 2G07A 4CCHA 2ZIVB 1BPXA 1D8BA 1SWVA 3E2EA 3O0FA 1F0MA 4UAVA 3PW5A 4NLNA 2W7OA 2YMMA 1PVQA 1BNOA 2HI0A 2HOIA 3CNHA 2FPKA 2Q0ZX 2JHDA 4J9KA 3JPRA 1JXLA 4RQ1A 5AKHA 1FEZA 4AP9A 2AQ4A 5HR7A 4O3NA 2I9GA 2H3QA 4I2AA 4ECZA 9ICBA 2WF5A 1COOA 1CUKA 4IQTA 1KTQA 3PW7A 4DFJA 7ICMA 2ASJA 3BZCA 5KFWA 5BOLA 5CRXA 2CPRA 3L5KA 2WF7A 8ICVA 2WAQF 2W9BB 2FJ6A 4RQ2A 4EZ9A 3RB0A 1ZQBA 4Y2JA 1XNSA 2HHSA 1JN3A 1L5UA 4FS2A 5L1IA 4UARA 4EBEA 3ICXA 4CNQA 3UM9A 1RXWA 1X40A 4OJLA 1ZQNA 2BKEA 4P4PA 7ICQA 3ALRA 2C2DA 4JK1A 4ECYA 4I2JA 4NLGA 5ALSA 7ICSA 1X9WA 4ED8A 2QB0B 4J9MA 2BCSA 3F2DA 1Z00A 2KKPA 5DG9A 3HP6A 4DSIA 1N2XA 5EWEA 1SV0C 3HX0A 3MABA 1DOQA 2NYVA 4F4ZA 7ICGA 1A6SA 5ALYA 4ELTA 4IR1A 3PSPA 4TURA 4O3MA 1L7OA 3C28A 2F3NA 5ALJA 2IBKA 4KLMA 3N7RC 4UATA 1TK5A 4LZDA 7ICLA 2YMLA 4DL6A 3PR4A 4QWBA 2KZZA 2K8CB 3T5LA 2VA8A 3H8MA 4JV1A 3QUCA 5ALGA 2ES6A 5J2CA 5KG7A 3BQ2A 3OHAA 4JWNA 5DQGA 2F1JA 2JZBB 5AKKA 2Z7JA 3ZI4A 2LM4A 2O6KA 7ICPA 3V7JA 4Y2VA 4J9SA 1L3SA 1RYUA 2G5IB 4A8EA 3AQFA 5DG8A 4BGDA 3Q8KA 4CDGA 1IV8A 1UQVA 2NO5A 3HILA 1Q3UA 3ZD8A 3N97B 2W55A 2JMGA 5ALIA 4RQMA 2CN1A 4YMMA 1NZPA 3RB4A 2JV3A 4MEXA 5ALLA 3IN5A 2EZXA 4NLBA 1SV0A 1YZ6A 1T8EA 5J2KA 2RP5A 3BQ0A 2KJ9A 5KFHA 4PH5A 1IXRA 3L4PA 3C5GA 1TAMA 4O3OA 3K75D 2XVTA 4NLCA 1D8LA 5EWGA 4RZRA 4J9NA 3RBEA 2AGQA 4MFAA 3BS5B 5ALWA 4KLEA 4Y2QA 4C7ZA 1U49A 4YR0A 3LVVA 2OXOA 3JPTA 4CF3A 1ZD5A 4UAUA 2KEYA 4P0PA 1U47A 8ICTA 5AK5A 1NKCA 4Y2YA 1TFRA 5J2AA 4NWIA 3PW0A 5L1LA 2XO7A 1VLBA 5C0YA 4C8OA 3SAHA 5B5EU 9ICSA 4RPXA 2KFZA 3C1YA 3ISCA 5DB6A 1M6YA 9ICKA 5KAFU 7ICIA 1KFTA 3WKDA 3CW2C 3MGIA 1C7YA 4PL1A 2VA3A 3RR8A 5JU5A 1NKEA 4Z6CA 2E8OA 2I5HA 2OM6A 3B0XA 8ICIA 4ED6A 3SYZA 3M9MB 1BPDA 3GV5B 3OGUA 4DF8A 2AHOB 3BQTA 4QZAA 3DEEA 5KFEA 4HAIA 3TADA 1J2MA 2JZBA 1D9FA 4RNMA 1U9LA 5AI0A 4MF2A 1V97A 3PR5B 2VJ5A 2JH1A 4IRKA 4RQ6A 4M9NA 3PSTA 4Z6DA 5F9NA 2AU0A 5AI8A 2KZ3A 1S76D 3AU2A 3SR6A 3F5EA 3N7SC 2R8IA 4HYKA 3OSPA 3GILA 5AKJA 1DK3A 5J2BA 3ETLA 3WU2U 1SZPA 2NRXA 4IQWA 4NY8A 2BDUA 1DGSA 5ALXA 1ZQCA 4QZCA 3QU5A 3RR7A 5KG1A 2I6XA 4O0IA 1ZQMA 9ICAA 1ZJMA 4JB3A 4C7YA 3QEAZ 2C2EA 1XSLA 2FPMA 2QARB 5IIKA 4X5VA 2HW3A 2KIWA 4US8A 1HUOA 3F53A 2Y1IA 4RQ8A 3T3FA 1HIWA 4YR3A 5F9LA 4DS5A 5CP2A 1COKA 4FO6A 2ZIXB 3JPPA 1HEKA 1ZQKA 4IR9A 3MC1A 1OW5A 3GQCA 4YG2A 4O9MA 2XICA 2E5SA 1S97A 4IRDA 8ICLA 5IILA 4P0QA 3OSNA 4XQ8A 3RB6A 2D6FC 4M0AA 3GIKA 4NV0A 2F1HA 4OJ5A 1ZJNA 1SL0A 5KG5A 5AK4A 8ICHA 9ICRA 1Z4OA 2PFQA 1PK1A 1XWLA 2XCPA 4DL2A 3PVXA 2W8KA 3EZ5A 2R8GA 3WK5A 4UBBA 4BWMA 2ODGA 1D9DA 2ZTCA 4JWMA 2R18A 1KBUA 1ZQWA 3PSFA 4J9QA 4R65A 8ICUA 1NOMA 4UB5A 1S5LU 2HHQA 2HBJA 5AM5A 2ZUCA 2IA6A 1SXDA 5J0YA 2Y1JA 1V85A 4WJ3B 5KL8B 2R8HA 7ICNA 3RJEA 5ALTA 3NASA 3PX0A 4QZ8A 2OHFA 1JALA 3D2QA 4F5OA 1Z3EB 3ED5A 9ICPA 5KT2A 2JEIA 1JROA 2A1JB 4I2EA 8ICRA 9ICWA 5ALDA 1TKDA 2DPIA 1FFUA 2VJ4A 5EE3A 3AEVA 1L3TA 4I2FA 4NJ8A 5DGAA 5AKEA 1KKXA 4ZH4A 3AM9A 2KFNA 5HR6A 2OH2A 4P4MA 3V72A 2KJ8A 5CR0A 7ICJA 1WCNA 4KLOA 5J0RA 1PVRA 3MFIA 5J0PA 3KZXA 3Q8LA 4C4TA 1LKYB 3V7LA 4QIWC 3A0BU 3ETRA 2OWOA 3U26A 5KFIA 7ICVA 4CGZA 2HBMA 1HUZA 3NRZA 8ICNA 2BCQA 1TAUA 1B4FA 3C2LA 4BXOB 2ZUDA 4DQPA 3OJSA 1ZQ1C 3M6ZA 1X6IA 5GTHU 3E58A 3PW2A 2OCEA 1OUQA 4G3IA 5KFRA 2BR0A 3EUB2 5AK3A 2WFAA 2KNJA 5L9XA 2M0NA 3PNCA 1JX4A 3IHQB 3LDAA 2VANA 3HPOA 2OYYA 5IIMA 1A77A 4Q8EA 2F77X 4DSLA 2VKQA 3WK6A 2RRDA 5CEHA 3SZ2A 2LYHA
chains in the Genus database with same CATH topology
4OJ6A 3ICXA 4PL2A 1Q3UA 2R18A 1DRGA 3HKZC 3F2BA 1NZBA 3DEEA 1PVPA 3PSIA 1KBUA 2JMGA 2YB4A 2E1EA 3ONNA 3PSFA 1SZHA 3F2CA 2KHVA 2CN1A 4ACOA 4OJLA 1Z19A 2PMZC 2F76X 3NUQA 2YX8A 1YT3A 2VJ5A 2H3ZA 2JH1A 2DQNB 2K8BB 4C0ZA 2N1RA 3ALRA 3L3FX 2A3VA 3H0RB 2HBJA 3PSTA 3RFAA 2LHTA 1WUDA 2Y0SF 3CYMA 2HMXA 3LVWA 2E1FA 2KVCA 1MA7A 2K4EA 3VC8A 2XI9A 4KMOB 1XO0A 2WAQC 2ZXHA 3F5EA 3N7SC 3N7PD 3AQEA 3IN5A 2H3FA 5KL8B 3SQIA 2G5HB 2ZXIA 4WJ3B 2HOQA 5A0LA 4NLBA 2GOLA 3H0MB 3IG8A 2K4HA 2XIDA 3CP8A 4FE3A 2RP5A 3F5AA 4GFJA 3K1ZA 4ICAA 2G09A 2KJ9A 2BDUA 3E0FA 4OJOA 1URJA 3F2DA 2KKPA 3M7DA 1TAMA 3D2QA 2G0AA 4FZMA 2K4IA 3KFUF 2XVTA 2ZIUB 3IG5A 4NLCA 4U6PA 2JGAA 1F44A 2KD1A 2ZIUA 2G07A 1P7DA 2ZIVB 4CRXA 2LYAA 3SAGA 1D8BA 3SMVA 4QJFB 2K89A 1Q3VA 1GO3F 2Q4TA 2CRXA 3MGVA 1T94A 2DF4B 3O0FA 2HOFA 2RHFA 3IP4B 2VJ4A 3LVVA 2W7OA 1Z1BA 2OXOA 1A6SA 2KIWA 1PVQA 3F53A 1L6NA 4BJQA 2HOIA 3PSPA 2G08A 2JHDA 4O3MA 4P0QB 5HR6A 4AYBC 1HIWA 3H0LB 3M6KA 4FZNA 3C28A 3OPXA 2OH2A 4AYBF 2KJ8A 2KEYA 4P0PA 2ZIVA 2KV2A 4KX3A 3AL0B 2G06A 5HR7A 3VCBA 2NV3A 1IIPA 2W03A 2ZIWA 3HKZF 2ZIXB 3N7RC 1PVRA 4KX5A 2VIXA 1HEKA 3GZFA 3KZXA 1CRXA 2ZIXA 3T79A 2H3QA 4NWIA 4FZLA 4QIWC 5C0YA 3C29A 2K8CB 3PZPA 2K8AA 3SAHA 2HBKA 2XICA 2E5SA 4CGZA 2HBMA 2H3VA 4QNLA 4BUGA 2Y0SC 3RF9A 2KOBA 2ZIWB 4P0QA 2YB1A 2KHQA 2D6FC 2KJ5A 3GU3A 4P0PB 4U7CA 2PMZF 4NV0A 4JMUA 2DGZA 2F2AB 5CRXA 2CPRA 4OJ5A 5T14A 1ZQ1C 2JH7A 3M6ZA 4QIWF 1A0PA 3NRWA 2Z7JA 2WAQF 1ED1A 2GH1A 4PL1A 1OUQA 2ZG6A 2HBLA 2W7PA 1UPHA 4OJPA 3CRXA 1ECWA 2KNJA 2OM6A 2WB1C 2M0NA 3LYSA 2MRLA 2W04A 2KICA 2LBOA 2G5IB 4A8EA 3D2SA 2OYYA 3AQFA 5KL1B 4OO1J 2LKYA 4IC9A 2F77X 2KKVA 1XNSA 4BX9C 2F8LA 2VKQA 4CDGA 3D2NA 3SAFA 2H3IA 2MA1A 2RRDA 2LYBA 2WB1F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L3F X;  3PST A;  3PSP A;  2K89 A;  2K8C B;  2K8B B;  2K8A A; 
#chains in the Genus database with same CATH topology
 5TIS U;  5KFO A;  8ICC A;  1PVP A;  4O3P A;  4ACO A;  1L7M A;  3RAX A;  2F76 X;  1TE2 A;  2P6R A;  2WHE A;  5L1M A;  5ALQ A;  3TAR A;  4I2I A;  5KFJ A;  4KMO B;  2YMP A;  4O5C A;  2P35 A;  4IS7 A;  5DB8 A;  3UXN A;  1X6J A;  2G5H B;  2PFO A;  1MQ3 A;  5BPC A;  3C1Z A;  2KTQ A;  4FE3 A;  4GFJ A;  3ZDE A;  3ZDC A;  4RU9 A;  2XGP A;  3PX6 A;  3D6J A;  1TK8 A;  2FMQ A;  5HMM A;  1NI3 A;  2EAO A;  2E3T A;  2HVI A;  2V9W A;  4UB4 A;  3SAG A;  2E8P A;  3UXO A;  3MFH A;  5KFA A;  1X9M A;  3MGV A;  3JPQ A;  2B0C A;  1ZQD A;  5AI6 A;  2QB1 A;  5AM1 A;  3NS1 A;  3Q8R B;  1SV4 A;  2J6U A;  9ICI A;  3H0L B;  4Z6F A;  4ED0 A;  1JXE A;  1ZQL A;  5J2G A;  4RNO A;  3KHR A;  4LVS A;  5KT5 A;  4QWC A;  4ECQ A;  1CRX A;  1Q8K A;  4FZL A;  3ZDA A;  4PHP A;  3RB3 A;  5J0W A;  2A1A A;  3RF9 A;  8ICZ A;  4Y2U A;  1CEZ A;  4B9L A;  4USA A;  4U7C A;  1N5X A;  1RDF A;  5CJ7 A;  4QIW F;  1ZQH A;  4IL6 U;  2ZG6 A;  3HT3 A;  3UQ2 A;  1NK6 A;  4F8R A;  2P6U A;  3ISB A;  2V4R A;  2W04 A;  1KEJ A;  3RJI A;  4JV0 A;  4RUC A;  3N4M B;  2AGO A;  2PI4 A;  3GV8 B;  3ZDD A;  2MU2 A;  2GWS A;  4DSE A;  2KE7 A;  1UT5 A;  5KG3 A;  1L8O A;  1PZN A;  1SIJ A;  1ZQT A;  1NZB A;  4C8N A;  1UCV A;  1Z19 A;  3KKA C;  4YMO A;  1V38 A;  3K1R B;  5KG6 A;  2XY5 A;  5DLF A;  3SV3 A;  7ICF A;  4UAS A;  4M47 A;  1QCK A;  1NK4 A;  1N62 A;  3PMN A;  1XO1 A;  2P66 A;  2HHV A;  4GXI A;  1JIH A;  3IRU A;  1D8Y A;  3BZK A;  2FLN A;  4PPX A;  5D46 A;  2I1Q A;  3M7D A;  5ALH A;  1UHU A;  2GLE A;  2OEH A;  3WKB A;  1UA1 A;  5DBA A;  5J2D A;  2DF4 B;  3BQ1 A;  4QWD A;  1C20 A;  2R8J A;  4UB1 A;  1BPE A;  4BJQ A;  5TZV A;  3KHL A;  5AIB A;  5HNK A;  4PZO A;  1WG8 A;  1S0M A;  2NV3 A;  4KLF A;  2XY7 A;  2NO4 A;  1KSP A;  4Z6E A;  3TFS A;  5CWR A;  4EEK A;  7ICE A;  4PGX A;  4O5E A;  4LJX A;  3V6J A;  4P4O A;  4TQS A;  4K4I A;  1A0P A;  2A1J A;  4DOB A;  2W7P A;  3C5F A;  3HRD D;  3TFR A;  2ASD A;  1WYG A;  1ZQA A;  3D2S A;  3GII A;  5EE9 A;  4EYH B;  2RDI A;  4CE6 A;  2BPF A;  3SAF A;  4MFF A;  4F3O A;  2LYB A;  1L6N A;  2XCA A;  3EYZ A;  4DF4 A;  4DFK A;  4KLI A;  3H4D A;  1T7P A;  2E1E A;  3OHB A;  2LMR A;  4J9R A;  2A3V A;  1LVH A;  2ASL A;  5K4L A;  2W9C B;  2K4E A;  3VC8 A;  2LPE A;  4YFK A;  3C2K A;  4US9 A;  1XO0 A;  3Q8M A;  3RJJ A;  4DFM A;  4J9L A;  3IG8 A;  2HSZ A;  1ZXI A;  1ZD4 A;  5DKW A;  2VA2 A;  2NRW A;  3QZ8 A;  4YP3 A;  5AI4 A;  3MBY A;  3EPI A;  4NM2 A;  1BVS A;  4ECS A;  5AKL A;  3SMV A;  1S9F A;  1GO3 F;  1RXV A;  5KFY A;  3MR3 A;  4NLZ A;  8ICF A;  3QU4 A;  1EXN A;  3BJY A;  3H8W A;  3MDA A;  3M9O B;  1S8O A;  4AYB C;  3QNM A;  1JMS A;  4ELU A;  4KN7 A;  1L3V A;  1KFD A;  4B9N A;  3HKZ F;  2ZJA A;  2M9N A;  1SWW A;  2HBK A;  4UW9 A;  3SI8 A;  3QU7 A;  1ZQZ A;  5AIA A;  1RPL A;  3MR6 A;  1QQ5 A;  4QW9 A;  4Q44 A;  1BGX T;  4EX6 A;  1ZRN A;  5T14 A;  3TAP A;  3M8R A;  3HW8 A;  3SEN A;  5J2H A;  1NKB A;  4RNN A;  4R66 A;  4XUS A;  2WB1 C;  2CXY A;  3OJU A;  2BCV A;  2K4P A;  4M9J A;  4OO1 J;  5F3X B;  4F2S A;  4C8L A;  4C80 A;  2UVW A;  4DFD A;  3F2B A;  3THV A;  3KD3 A;  1ZD3 A;  3ORY A;  1X9S A;  3QUT A;  1Z00 B;  2ZTD A;  2RLT A;  3H0R B;  1UT8 A;  2LHT A;  3LVW A;  5DBC A;  2D8C A;  5IIJ A;  1SL1 A;  1QSS A;  2HDO A;  3WKE A;  4ECV A;  1MA7 A;  3AQE A;  8ICX A;  2HOQ A;  2W9M A;  3CP8 A;  1H38 A;  2EQY A;  2FDR A;  2G09 A;  3TQ1 A;  3HWT A;  1FFV A;  2KVS A;  5IIN A;  2ZTE A;  3HJE A;  2NRZ A;  3EPG A;  4U6P A;  9ICT A;  2JGA A;  5AKG A;  3KHG A;  4YXJ A;  4QZI A;  4RUA A;  4J03 A;  3IP4 B;  4I27 A;  1QQ6 A;  1O03 A;  2IOF A;  4EBC A;  4ZOH C;  4MHV A;  3R9K A;  3OTQ A;  2GO7 A;  3GDX A;  3M6K A;  3PO5 A;  5KT3 A;  3I1Y A;  2EAM A;  2KV2 A;  3ISD A;  3TI0 A;  1NJY A;  4DS4 A;  1OXJ A;  1J97 A;  1NK8 A;  1RZT A;  4C4S A;  3T79 A;  4F4K A;  1S10 A;  3BS7 A;  4I28 A;  3H7I A;  5KFL A;  2W43 A;  4BUG A;  1S0O A;  2PMZ F;  5KFP A;  4JMU A;  1ZQE A;  2ZJ5 A;  4RQ3 A;  4FBT A;  4MEY A;  1ED1 A;  2GH1 A;  3KHH A;  5J0O A;  3H4B A;  3CRX A;  4ECW A;  1ECW A;  1ZQU A;  5KG4 A;  4C4R A;  2LBO A;  1ZQY A;  3QYP A;  2Y9T A;  1T4G A;  5HML A;  1WWU A;  4YXM A;  3UPQ A;  1BPY A;  1ZRM A;  2ISO A;  1ZQJ A;  3IM1 A;  2WF6 A;  2MA1 A;  5DDM A;  1T3Q A;  4F4W A;  4KLU A;  4OJ6 A;  3FYH A;  4ECU A;  4GXJ A;  4NLK A;  9ICJ A;  1L3U A;  5ALR A;  5EWF A;  2W9C A;  9ICL A;  5J2J A;  3N28 A;  5FP0 A;  2KP7 A;  4EEN A;  4R8U B;  2H3Z A;  3C2M A;  5KT6 A;  1MQ2 A;  2MSN A;  3QUQ A;  4G9B A;  7ICT A;  2V4Q A;  4EBD A;  2KG5 A;  5EE1 A;  2H3F A;  2FPL A;  4ED1 A;  2E8N A;  5AKI A;  3NVZ A;  2BQ3 A;  4OCZ A;  4UB8 U;  2MUT A;  2K4H A;  2DL0 A;  4OJO A;  2BGW A;  3NVW A;  2F1I A;  4KLH A;  4NL9 C;  3WKC A;  1NJX A;  1RYR A;  8ICW A;  3LK9 A;  3RJH A;  1TVA A;  4F2R A;  4GC6 A;  1Z4N A;  2AGP A;  1N56 A;  1SKS A;  2JR5 A;  5H2F U;  1QSL A;  3OPX A;  2ZIV A;  3WK7 A;  3KZI U;  4PJ0 U;  9ICG A;  3QU9 A;  4F71 A;  2NRV A;  4GXK A;  2W9A A;  4RQN A;  2W11 A;  1TK0 A;  1KN5 A;  1DK2 A;  4YVZ A;  4YD1 A;  2FLP A;  2BZF A;  5ALM A;  2KJ5 A;  4F92 B;  1U48 A;  5AM2 A;  4M9G A;  5J2E A;  9ICO A;  1KQQ A;  4KLT A;  2PKE A;  4ED2 A;  4KLG A;  4DSK A;  2WF8 A;  2JXJ A;  4IQU A;  3G6V A;  3BQ7 A;  5ALU A;  4YN4 A;  4Y2X A;  1SKW A;  2W3R A;  5D49 A;  2F8L A;  3QEB Z;  1PK1 B;  1KW4 A;  5AM4 A;  4BWJ A;  3J81 j;  4ECT A;  4FFD A;  4F72 A;  2DBY A;  7ICH A;  1YT3 A;  3PW4 A;  1KFS A;  1SXE A;  5G5G A;  5KFU A;  4M6W B;  2ZUB A;  8ICG A;  2WAQ C;  4F4Y A;  5ALE A;  2KSO A;  2ZXI A;  3QU2 A;  2GOL A;  2XID A;  4ICA A;  1ARO P;  2HHX A;  1URJ A;  3AUO A;  2G0A A;  1ZQO A;  2K4I A;  3KFU F;  2FLL A;  2ATL A;  2J6T A;  2K89 A;  2DPJ A;  3PX4 A;  5KFM A;  8ICO A;  4B6J A;  4NM1 A;  1WCL A;  4DEZ A;  4KLD A;  2G08 A;  4P0Q B;  5E79 U;  1O08 A;  4AYB F;  3ZDB A;  8ICQ A;  2ZIW A;  4C8M A;  4DQQ A;  3LWM A;  3GIJ A;  1K1S A;  4R63 A;  4QZF A;  1ZQF A;  2UVU A;  3MGH A;  2YY6 A;  2H3V A;  7ICR A;  4I2C A;  1B0X A;  4F4X A;  1XC9 A;  2YB1 A;  3K4G A;  4TUS A;  3PY8 A;  4M9L A;  4QZE A;  2FI1 A;  4F5P A;  2A19 A;  4TUP A;  4IQV A;  4EZ6 A;  4DO9 A;  8ICA A;  4CF5 A;  1A76 A;  9ICN A;  5AIC A;  5CA7 A;  4UB2 A;  2DFL A;  2WF9 A;  3D2N A;  2FMP A;  4EYI B;  3GIM A;  1QTM A;  4PL2 A;  4ECR A;  3KKA A;  1DRG A;  2Y9U A;  3PSI A;  3ONN A;  4EEY A;  4RPZ A;  1JRP A;  8ICP A;  7ICK A;  4O3R A;  2N1R A;  1ZQV A;  2HMX A;  5AKZ A;  5GTI U;  3UQ0 A;  4QZG A;  4KIT B;  4F5R A;  3UXP A;  2HHT A;  3M1Y A;  1MN8 A;  4DLE A;  1IM4 A;  4QW8 A;  1RQN A;  1ZOL A;  5HP4 A;  5KTQ A;  4PZN A;  3RRG A;  2KD1 A;  5KFN A;  4RPY A;  9ICC A;  3GV7 B;  2LI6 A;  3QZ7 A;  2ISP A;  4KLQ A;  2Q4T A;  1PUZ A;  5J0X A;  1Z1B A;  2HHU A;  5DLG A;  5ALO A;  4DLG A;  5KNI A;  3LWL A;  1YZ7 A;  4UAZ A;  4K4H A;  5KFX A;  2EAP A;  2BCU A;  3UMC A;  5EE0 A;  2QLT A;  3VCB A;  2ZIX A;  1JI7 A;  4ELV A;  4XRH A;  9ICE A;  3TAN A;  2KHQ A;  3GU3 A;  3H8J A;  4P0P B;  2DGZ A;  2JH7 A;  4RT2 A;  3RH5 A;  5KFQ A;  2L5Y A;  1X9X A;  1NJW A;  2HBL A;  5KG2 A;  4F50 A;  1KRP A;  2IOF K;  1B22 A;  9ICQ A;  5KFD A;  1S77 D;  2XC9 A;  2C22 A;  4YQW A;  2F44 A;  2H3I A;  2W9B A;  2Y0S F;  4UBC A;  3WK4 A;  3AMZ A;  4RQ0 A;  3H40 A;  3QX7 A;  2D3D A;  2BPG A;  3KBB A;  2KZM A;  2KHV A;  3NUQ A;  2YX8 A;  5JTI A;  5HHI A;  3RFA A;  2FE9 A;  3Q8Q B;  2E1F A;  3FC4 A;  4UB6 U;  4LZG A;  2ZXH A;  5C5J A;  3SQI A;  3RTV A;  5CB1 A;  4DFP A;  3KOO A;  1NK7 A;  3MR2 A;  2KMD A;  3F5A A;  1U4B A;  1JUD A;  2C28 A;  4QZD A;  3SD7 A;  1HJP A;  3UMB A;  8ICY A;  1F44 A;  3FM9 A;  5B66 U;  5KFT A;  1XSN A;  3WK8 A;  4K4G A;  2LYA A;  2B21 A;  3B0Y A;  4DL7 A;  1Q3V A;  4KTQ A;  3TKA A;  4DSJ A;  1T94 A;  3EWA A;  1S0V A;  2RHF A;  4J9O A;  1TV9 A;  2W54 A;  4DCC A;  1U45 A;  2IMW P;  2RDJ A;  1VDV A;  3I28 A;  4J9P A;  1Q46 A;  3PML A;  3AL0 B;  1IIP A;  4DL5 A;  4EX7 A;  5KFG A;  4KLL A;  1LV5 A;  2BQR A;  4M04 A;  2ZJ8 A;  2K8A A;  5ALP A;  3Q8S B;  3V7K A;  5AM0 A;  2F2A B;  2BQU A;  5KG0 A;  2LM1 A;  3AU6 A;  5DQH A;  3TAD C;  5BOM A;  4KMU A;  2KIV A;  4O3Q A;  3WK9 A;  3RBD A;  1QLN A;  8ICK A;  5KL1 B;  4KLJ A;  1ZYQ A;  2AXT U;  1ZQR A;  2PFN A;  2IHN A;  1TAQ A;  2RQ5 A;  5EOZ A;  4DSF A;  3TAC B;  3WKA A;  3EW9 A;  2EDU A;  4EEL A;  1NK9 A;  5AI5 A;  1K5O A;  2BPC A;  4QZ9 A;  5KFF A;  5J2F A;  5KFV A;  2JEJ A;  9ICF A;  3H8S A;  2UVR A;  1SL2 A;  2PMZ C;  5CHG A;  1VJ5 A;  3NGD A;  2K8B B;  2DQN B;  4YD2 A;  4PHD A;  8ICS A;  4YR2 A;  3L3F X;  5ALN A;  4DOA A;  4XA5 A;  2EZY A;  1F5S A;  5A0L A;  3H0M B;  4YCX A;  4I2G A;  2HCF A;  4KLS A;  3PO4 A;  3MR5 A;  3E0F A;  9ICV A;  1QSY A;  4FZM A;  3T5J A;  5D4B A;  4M2Y A;  3IG5 A;  4PGY A;  1RQL A;  2DKZ A;  5J2I A;  5ALK A;  1PK3 A;  1DGJ A;  4O5K A;  4QJF B;  4Y2R A;  1DXS A;  3MDC A;  3V6H A;  1Z1V A;  3IV6 A;  3A0H U;  3GFK B;  3G6Y A;  1BPB A;  2C2R A;  4I29 A;  3ZD9 A;  7ICO A;  2HHW A;  7ICU A;  3NVV A;  1XS9 D;  3BS5 A;  4FZN A;  2B6G A;  5KT4 A;  3I76 A;  2MUT B;  1J2N A;  2PXI A;  3M9N B;  3G6X A;  5J0Q A;  3TAQ A;  2BDP A;  2H5X A;  3M8S A;  4F91 B;  1XSP A;  4QNL A;  3SV4 A;  4B9V A;  2MAX A;  2Y0S C;  2KOB A;  2ZIW B;  1X2I A;  1N5W A;  4F93 B;  3PV8 A;  1RYS A;  1L7P A;  2BHN A;  4RQ7 A;  1T3N A;  3JPS A;  5JRT A;  3JPN A;  5DG7 A;  4MF8 A;  4CF4 A;  5DB7 A;  4R64 A;  5DQI A;  8ICM A;  1ZQX A;  2KKV A;  3FAH A;  5J29 A;  4B9S A;  4PGQ A;  2WB1 F;  3HKZ C;  5JUM A;  4MFC A;  1SZH A;  4DWI A;  4FS1 A;  2PFP A;  4TQR A;  4C0Z A;  2PI5 A;  1ZQS A;  5IIO A;  1NK5 A;  2XI9 A;  5DBB A;  2AJQ A;  3N7P D;  4QZB A;  4BDP A;  2KN7 A;  1FIQ A;  1LB2 B;  3K1Z A;  4B9M A;  5DDY A;  4NL9 A;  3RJG A;  5J0T A;  1N48 A;  2EZZ A;  2ZIU B;  3AN1 A;  2ZIU A;  8ICB A;  3RJK A;  4FBU A;  1NK0 A;  5DGB A;  4ECX A;  5J8Y A;  2HOF A;  2J6S A;  4IRC A;  4NXZ A;  4RQ5 A;  4GLX A;  2HVH A;  2DUY A;  4M6W A;  3DDH A;  1S0N A;  1MC8 A;  2JEG A;  5KFK A;  4ED3 A;  4KX3 A;  4RQ4 A;  2G06 A;  1L7N A;  1XU4 A;  4YMN A;  3QE9 Y;  2VIX A;  3GZF A;  3Q8P B;  1SKR A;  9ICX A;  1QH9 A;  2EH9 A;  3PZP A;  1ZQQ A;  4UQG A;  4TUQ A;  2WTF A;  5KFZ A;  3RH6 A;  4JV2 A;  9ICU A;  4PHE A;  4UAY A;  3JPO A;  4B9T A;  3RH4 A;  2DWQ A;  5DB9 A;  3RJF A;  2DKX A;  4F5N A;  2ESE A;  3T5K A;  3RRH A;  2QKQ A;  4Y2T A;  2YQE A;  2KK0 A;  2YTU A;  1ZQG A;  4KN4 A;  4OJP A;  2F8K A;  3LYS A;  1Y88 A;  2MRL A;  4JUZ A;  1MSW D;  5L1K A;  1RM6 C;  1KL9 A;  4GIB A;  2XGQ A;  2BCR A;  4IC9 A;  5ALV A;  3IDW A;  4DOC A;  4DQR A;  4Q8F A;  5KT7 A;  4OD0 A;  4F5Q A;  1IG6 A;  1SB3 C;  2KVC A;  2YN4 A;  4O3S A;  5L1J A;  2UVV A;  1B43 A;  1ZQP A;  5AKY A;  4BXO A;  3DV9 A;  1CI4 A;  5J8Y C;  3C21 A;  9ICM A;  5HHH A;  5AI9 A;  3RAQ A;  5J0S A;  4DL3 A;  3V6K A;  2R8K A;  1P7D A;  5KAI U;  1UA0 A;  1WWV A;  4CRX A;  2EAN A;  5KFS A;  4QWE A;  5KFC A;  3QUB A;  1RG6 A;  1L8L A;  1AQ6 A;  2CRX A;  3KTQ A;  8ICE A;  1X66 A;  5KFB A;  1ZET A;  1V9P A;  4DL4 A;  4B9U A;  5AK6 A;  5G5H A;  3NVY A;  2IHM A;  2W3S A;  9ICH A;  1N60 A;  4UB3 A;  3S6J A;  1ZQI A;  2W03 A;  1FO4 A;  2E8M A;  1QQ7 A;  3C23 A;  3B9J A;  4KX5 A;  4QWA A;  4DQS A;  4DQI A;  2W8L A;  3SEI A;  3C29 A;  4ED7 A;  4I2B A;  4I2D A;  2ALZ A;  5AKX A;  2KSO B;  4Y2S A;  1LKY A;  1X42 A;  3T5H A;  2YMQ A;  3NRW A;  1KLN A;  5AM3 A;  4R8U A;  5J0U A;  2FMS A;  1UPH A;  5ALF A;  4RT3 A;  4QZH A;  4GC7 A;  1NJZ A;  5AHX A;  4P2H A;  2KIC A;  2LKY A;  1K1Q A;  1BPZ A;  1N63 A;  3FDS A;  4BX9 C;  4I2H A;  3QXG A;  5ALZ A;  2XY6 A;  1KDH A;  2QB0 A;  2JEF A;  8ICJ A;  2YB4 A;  4Y2P A;  3F2C A;  2K60 A;  5III A;  2IOH A;  1ZD2 P;  3UMG A;  4UAW A;  4E0D A;  4M9H A;  3CYM A;  1WUD A;  4Q43 A;  2JRZ A;  2AQ0 A;  4Q45 A;  4C8K A;  2NRT A;  1NNL A;  2AH5 A;  1BNP A;  3BDP A;  1SGG A;  1N61 A;  2QAR A;  3NTU A;  4PHA A;  2G07 A;  4CCH A;  2ZIV B;  1BPX A;  1D8B A;  1SWV A;  3E2E A;  3O0F A;  1F0M A;  4UAV A;  3PW5 A;  4NLN A;  2W7O A;  2YMM A;  1PVQ A;  1BNO A;  2HI0 A;  2HOI A;  3CNH A;  2FPK A;  2Q0Z X;  2JHD A;  4J9K A;  3JPR A;  1JXL A;  4RQ1 A;  5AKH A;  1FEZ A;  4AP9 A;  2AQ4 A;  5HR7 A;  4O3N A;  2I9G A;  2H3Q A;  4I2A A;  4ECZ A;  9ICB A;  2WF5 A;  1COO A;  1CUK A;  4IQT A;  1KTQ A;  3PW7 A;  4DFJ A;  7ICM A;  2ASJ A;  3BZC A;  5KFW A;  5BOL A;  5CRX A;  2CPR A;  3L5K A;  2WF7 A;  8ICV A;  2WAQ F;  2W9B B;  2FJ6 A;  4RQ2 A;  4EZ9 A;  3RB0 A;  1ZQB A;  4Y2J A;  1XNS A;  2HHS A;  1JN3 A;  1L5U A;  4FS2 A;  5L1I A;  4UAR A;  4EBE A;  3ICX A;  4CNQ A;  3UM9 A;  1RXW A;  1X40 A;  4OJL A;  1ZQN A;  2BKE A;  4P4P A;  7ICQ A;  3ALR A;  2C2D A;  4JK1 A;  4ECY A;  4I2J A;  4NLG A;  5ALS A;  7ICS A;  1X9W A;  4ED8 A;  2QB0 B;  4J9M A;  2BCS A;  3F2D A;  1Z00 A;  2KKP A;  5DG9 A;  3HP6 A;  4DSI A;  1N2X A;  5EWE A;  1SV0 C;  3HX0 A;  3MAB A;  1DOQ A;  2NYV A;  4F4Z A;  7ICG A;  1A6S A;  5ALY A;  4ELT A;  4IR1 A;  3PSP A;  4TUR A;  4O3M A;  1L7O A;  3C28 A;  2F3N A;  5ALJ A;  2IBK A;  4KLM A;  3N7R C;  4UAT A;  1TK5 A;  4LZD A;  7ICL A;  2YML A;  4DL6 A;  3PR4 A;  4QWB A;  2KZZ A;  2K8C B;  3T5L A;  2VA8 A;  3H8M A;  4JV1 A;  3QUC A;  5ALG A;  2ES6 A;  5J2C A;  5KG7 A;  3BQ2 A;  3OHA A;  4JWN A;  5DQG A;  2F1J A;  2JZB B;  5AKK A;  2Z7J A;  3ZI4 A;  2LM4 A;  2O6K A;  7ICP A;  3V7J A;  4Y2V A;  4J9S A;  1L3S A;  1RYU A;  2G5I B;  4A8E A;  3AQF A;  5DG8 A;  4BGD A;  3Q8K A;  4CDG A;  1IV8 A;  1UQV A;  2NO5 A;  3HIL A;  1Q3U A;  3ZD8 A;  3N97 B;  2W55 A;  2JMG A;  5ALI A;  4RQM A;  2CN1 A;  4YMM A;  1NZP A;  3RB4 A;  2JV3 A;  4MEX A;  5ALL A;  3IN5 A;  2EZX A;  4NLB A;  1SV0 A;  1YZ6 A;  1T8E A;  5J2K A;  2RP5 A;  3BQ0 A;  2KJ9 A;  5KFH A;  4PH5 A;  1IXR A;  3L4P A;  3C5G A;  1TAM A;  4O3O A;  3K75 D;  2XVT A;  4NLC A;  1D8L A;  5EWG A;  4RZR A;  4J9N A;  3RBE A;  2AGQ A;  4MFA A;  3BS5 B;  5ALW A;  4KLE A;  4Y2Q A;  4C7Z A;  1U49 A;  4YR0 A;  3LVV A;  2OXO A;  3JPT A;  4CF3 A;  1ZD5 A;  4UAU A;  2KEY A;  4P0P A;  1U47 A;  8ICT A;  5AK5 A;  1NKC A;  4Y2Y A;  1TFR A;  5J2A A;  4NWI A;  3PW0 A;  5L1L A;  2XO7 A;  1VLB A;  5C0Y A;  4C8O A;  3SAH A;  5B5E U;  9ICS A;  4RPX A;  2KFZ A;  3C1Y A;  3ISC A;  5DB6 A;  1M6Y A;  9ICK A;  5KAF U;  7ICI A;  1KFT A;  3WKD A;  3CW2 C;  3MGI A;  1C7Y A;  4PL1 A;  2VA3 A;  3RR8 A;  5JU5 A;  1NKE A;  4Z6C A;  2E8O A;  2I5H A;  2OM6 A;  3B0X A;  8ICI A;  4ED6 A;  3SYZ A;  3M9M B;  1BPD A;  3GV5 B;  3OGU A;  4DF8 A;  2AHO B;  3BQT A;  4QZA A;  3DEE A;  5KFE A;  4HAI A;  3TAD A;  1J2M A;  2JZB A;  1D9F A;  4RNM A;  1U9L A;  5AI0 A;  4MF2 A;  1V97 A;  3PR5 B;  2VJ5 A;  2JH1 A;  4IRK A;  4RQ6 A;  4M9N A;  3PST A;  4Z6D A;  5F9N A;  2AU0 A;  5AI8 A;  2KZ3 A;  1S76 D;  3AU2 A;  3SR6 A;  3F5E A;  3N7S C;  2R8I A;  4HYK A;  3OSP A;  3GIL A;  5AKJ A;  1DK3 A;  5J2B A;  3ETL A;  3WU2 U;  1SZP A;  2NRX A;  4IQW A;  4NY8 A;  2BDU A;  1DGS A;  5ALX A;  1ZQC A;  4QZC A;  3QU5 A;  3RR7 A;  5KG1 A;  2I6X A;  4O0I A;  1ZQM A;  9ICA A;  1ZJM A;  4JB3 A;  4C7Y A;  3QEA Z;  2C2E A;  1XSL A;  2FPM A;  2QAR B;  5IIK A;  4X5V A;  2HW3 A;  2KIW A;  4US8 A;  1HUO A;  3F53 A;  2Y1I A;  4RQ8 A;  3T3F A;  1HIW A;  4YR3 A;  5F9L A;  4DS5 A;  5CP2 A;  1COK A;  4FO6 A;  2ZIX B;  3JPP A;  1HEK A;  1ZQK A;  4IR9 A;  3MC1 A;  1OW5 A;  3GQC A;  4YG2 A;  4O9M A;  2XIC A;  2E5S A;  1S97 A;  4IRD A;  8ICL A;  5IIL A;  4P0Q A;  3OSN A;  4XQ8 A;  3RB6 A;  2D6F C;  4M0A A;  3GIK A;  4NV0 A;  2F1H A;  4OJ5 A;  1ZJN A;  1SL0 A;  5KG5 A;  5AK4 A;  8ICH A;  9ICR A;  1Z4O A;  2PFQ A;  1PK1 A;  1XWL A;  2XCP A;  4DL2 A;  3PVX A;  2W8K A;  3EZ5 A;  2R8G A;  3WK5 A;  4UBB A;  4BWM A;  2ODG A;  1D9D A;  2ZTC A;  4JWM A;  2R18 A;  1KBU A;  1ZQW A;  3PSF A;  4J9Q A;  4R65 A;  8ICU A;  1NOM A;  4UB5 A;  1S5L U;  2HHQ A;  2HBJ A;  5AM5 A;  2ZUC A;  2IA6 A;  1SXD A;  5J0Y A;  2Y1J A;  1V85 A;  4WJ3 B;  5KL8 B;  2R8H A;  7ICN A;  3RJE A;  5ALT A;  3NAS A;  3PX0 A;  4QZ8 A;  2OHF A;  1JAL A;  3D2Q A;  4F5O A;  1Z3E B;  3ED5 A;  9ICP A;  5KT2 A;  2JEI A;  1JRO A;  2A1J B;  4I2E A;  8ICR A;  9ICW A;  5ALD A;  1TKD A;  2DPI A;  1FFU A;  2VJ4 A;  5EE3 A;  3AEV A;  1L3T A;  4I2F A;  4NJ8 A;  5DGA A;  5AKE A;  1KKX A;  4ZH4 A;  3AM9 A;  2KFN A;  5HR6 A;  2OH2 A;  4P4M A;  3V72 A;  2KJ8 A;  5CR0 A;  7ICJ A;  1WCN A;  4KLO A;  5J0R A;  1PVR A;  3MFI A;  5J0P A;  3KZX A;  3Q8L A;  4C4T A;  1LKY B;  3V7L A;  4QIW C;  3A0B U;  3ETR A;  2OWO A;  3U26 A;  5KFI A;  7ICV A;  4CGZ A;  2HBM A;  1HUZ A;  3NRZ A;  8ICN A;  2BCQ A;  1TAU A;  1B4F A;  3C2L A;  4BXO B;  2ZUD A;  4DQP A;  3OJS A;  1ZQ1 C;  3M6Z A;  1X6I A;  5GTH U;  3E58 A;  3PW2 A;  2OCE A;  1OUQ A;  4G3I A;  5KFR A;  2BR0 A;  3EUB 2;  5AK3 A;  2WFA A;  2KNJ A;  5L9X A;  2M0N A;  3PNC A;  1JX4 A;  3IHQ B;  3LDA A;  2VAN A;  3HPO A;  2OYY A;  5IIM A;  1A77 A;  4Q8E A;  2F77 X;  4DSL A;  2VKQ A;  3WK6 A;  2RRD A;  5CEH A;  3SZ2 A;  2LYH A; 
#chains in the Genus database with same CATH homology
 4OJ6 A;  3ICX A;  4PL2 A;  1Q3U A;  2R18 A;  1DRG A;  3HKZ C;  3F2B A;  1NZB A;  3DEE A;  1PVP A;  3PSI A;  1KBU A;  2JMG A;  2YB4 A;  2E1E A;  3ONN A;  3PSF A;  1SZH A;  3F2C A;  2KHV A;  2CN1 A;  4ACO A;  4OJL A;  1Z19 A;  2PMZ C;  2F76 X;  3NUQ A;  2YX8 A;  1YT3 A;  2VJ5 A;  2H3Z A;  2JH1 A;  2DQN B;  2K8B B;  4C0Z A;  2N1R A;  3ALR A;  3L3F X;  2A3V A;  3H0R B;  2HBJ A;  3PST A;  3RFA A;  2LHT A;  1WUD A;  2Y0S F;  3CYM A;  2HMX A;  3LVW A;  2E1F A;  2KVC A;  1MA7 A;  2K4E A;  3VC8 A;  2XI9 A;  4KMO B;  1XO0 A;  2WAQ C;  2ZXH A;  3F5E A;  3N7S C;  3N7P D;  3AQE A;  3IN5 A;  2H3F A;  5KL8 B;  3SQI A;  2G5H B;  2ZXI A;  4WJ3 B;  2HOQ A;  5A0L A;  4NLB A;  2GOL A;  3H0M B;  3IG8 A;  2K4H A;  2XID A;  3CP8 A;  4FE3 A;  2RP5 A;  3F5A A;  4GFJ A;  3K1Z A;  4ICA A;  2G09 A;  2KJ9 A;  2BDU A;  3E0F A;  4OJO A;  1URJ A;  3F2D A;  2KKP A;  3M7D A;  1TAM A;  3D2Q A;  2G0A A;  4FZM A;  2K4I A;  3KFU F;  2XVT A;  2ZIU B;  3IG5 A;  4NLC A;  4U6P A;  2JGA A;  1F44 A;  2KD1 A;  2ZIU A;  2G07 A;  1P7D A;  2ZIV B;  4CRX A;  2LYA A;  3SAG A;  1D8B A;  3SMV A;  4QJF B;  2K89 A;  1Q3V A;  1GO3 F;  2Q4T A;  2CRX A;  3MGV A;  1T94 A;  2DF4 B;  3O0F A;  2HOF A;  2RHF A;  3IP4 B;  2VJ4 A;  3LVV A;  2W7O A;  1Z1B A;  2OXO A;  1A6S A;  2KIW A;  1PVQ A;  3F53 A;  1L6N A;  4BJQ A;  2HOI A;  3PSP A;  2G08 A;  2JHD A;  4O3M A;  4P0Q B;  5HR6 A;  4AYB C;  1HIW A;  3H0L B;  3M6K A;  4FZN A;  3C28 A;  3OPX A;  2OH2 A;  4AYB F;  2KJ8 A;  2KEY A;  4P0P A;  2ZIV A;  2KV2 A;  4KX3 A;  3AL0 B;  2G06 A;  5HR7 A;  3VCB A;  2NV3 A;  1IIP A;  2W03 A;  2ZIW A;  3HKZ F;  2ZIX B;  3N7R C;  1PVR A;  4KX5 A;  2VIX A;  1HEK A;  3GZF A;  3KZX A;  1CRX A;  2ZIX A;  3T79 A;  2H3Q A;  4NWI A;  4FZL A;  4QIW C;  5C0Y A;  3C29 A;  2K8C B;  3PZP A;  2K8A A;  3SAH A;  2HBK A;  2XIC A;  2E5S A;  4CGZ A;  2HBM A;  2H3V A;  4QNL A;  4BUG A;  2Y0S C;  3RF9 A;  2KOB A;  2ZIW B;  4P0Q A;  2YB1 A;  2KHQ A;  2D6F C;  2KJ5 A;  3GU3 A;  4P0P B;  4U7C A;  2PMZ F;  4NV0 A;  4JMU A;  2DGZ A;  2F2A B;  5CRX A;  2CPR A;  4OJ5 A;  5T14 A;  1ZQ1 C;  2JH7 A;  3M6Z A;  4QIW F;  1A0P A;  3NRW A;  2Z7J A;  2WAQ F;  1ED1 A;  2GH1 A;  4PL1 A;  1OUQ A;  2ZG6 A;  2HBL A;  2W7P A;  1UPH A;  4OJP A;  3CRX A;  1ECW A;  2KNJ A;  2OM6 A;  2WB1 C;  2M0N A;  3LYS A;  2MRL A;  2W04 A;  2KIC A;  2LBO A;  2G5I B;  4A8E A;  3D2S A;  2OYY A;  3AQF A;  5KL1 B;  4OO1 J;  2LKY A;  4IC9 A;  2F77 X;  2KKV A;  1XNS A;  4BX9 C;  2F8L A;  2VKQ A;  4CDG A;  3D2N A;  3SAF A;  2H3I A;  2MA1 A;  2RRD A;  2LYB A;  2WB1 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...