2K8CB

Solution structure of plaa family ubiquitin binding domain (pfuc) trans isomer in complex with ubiquitin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k8cB00
2K8CB 3PSPA 3PSTA 3L3FX 2K8AA 2K8BB 2K89A
chains in the Genus database with same CATH superfamily
1XWLA 1ZQWA 2BCVA 5L1KA 1X9XA 2DGZA 8ICGA 1URJA 3F5AA 5ALEA 3KFUF 4EZ9A 3CW2C 2PMZF 5F9NA 1HUOA 3OJSA 1N5WA 5DB9A 3PW0A 3T79A 3C2KA 1U45A 4DSFA 3RB3A 1UT8A 5EWFA 4KLLA 3TANA 5J0SA 1XSNA 8ICPA 3NVZA 4NLZA 2G0AA 3N7RC 4I2HA 1S5LU 4J9OA 2ZIVA 3SAHA 4XQ8A 4ED2A 8ICVA 3JPTA 3BS5A 4DL6A 4UB4A 2GWSA 2EAPA 2LPEA 1ED1A 4C7ZA 1WWVA 4J9MA 4DF4A 3PNCA 3M9MB 2P6RA 5J0RA 4JMUA 5J2IA 3A0BU 3MFIA 4RPYA 1V97A 5J2EA 2FLNA 1MQ3A 3H8MA 1UCVA 1IIPA 4O9MA 1KLNA 3KKAC 1CUKA 2CRXA 5AKZA 2QARB 2F8LA 2VJ5A 1ZQUA 9ICIA 5J8YC 5AK4A 2QLTA 3MABA 8ICKA 2RP5A 5AI6A 3RJJA 2WB1C 4QZDA 5HR6A 4KITB 2AJQA 1RYSA 4KX5A 4RPZA 2IA6A 1MSWD 5CEHA 1NK5A 4LZDA 3RR7A 2P66A 2F1HA 2AU0A 1X42A 4KLUA 1S9FA 1UA0A 2ZG6A 1NKBA 1TFRA 2ZJAA 4FZMA 4FBTA 4K4GA 1ZETA 2DUYA 3AU6A 2F2AB 4JB3A 5AKXA 8ICHA 3M9NB 4M0AA 3V6HA 5EE0A 5L9XA 3LK9A 3ONNA 5AM0A 2N1RA 1Z00B 3G6YA 4IRCA 5DQHA 2JRZA 1U49A 4ICAA 2E8MA 5AI4A 5ALQA 5D4BA 4RQ2A 1T7PA 4YXJA 2M9NA 4IQVA 4HYKA 4MHVA 1XNSA 1HUZA 3EPGA 2KKPA 4QZGA 4PHDA 3V7LA 3SAFA 5KG1A 2PI4A 1TKDA 4KLMA 3WKEA 7ICPA 2Q0ZX 2I9GA 2A3VA 1JRPA 2BQ3A 1EXNA 3UXNA 7ICMA 1F0MA 3RB4A 2ASDA 4I2JA 5CR0A 4RNNA 1BPYA 2WF6A 9ICTA 2KE7A 2KN7A 1RXWA 3RB0A 3BDPA 3TAQA 4RQ7A 8ICXA 2I6XA 7ICRA 2PXIA 4QZEA 5DG8A 2LI6A 2VANA 3HT3A 2RHFA 4R63A 4YMNA 9ICMA 5AKHA 4ECXA 1PK1B 1UHUA 8ICAA 9ICQA 4Z6EA 4CF5A 4YMMA 4PHPA 4P0PB 2RDJA 5DQGA 1T3NA 1DRGA 8ICOA 2WB1F 1ZQXA 3UM9A 2BCUA 5AM4A 5KT5A 2W3SA 3C28A 4B6JA 3PO5A 3ISCA 5BOMA 4XA5A 3PW7A 5F3XB 5CB1A 2WTFA 1N56A 2FJ6A 2VKQA 5KFVA 5J0OA 5AM3A 1OUQA 1KW4A 3K4GA 3FM9A 1SL2A 3IRUA 4DS4A 2H3ZA 4R64A 3C5FA 5KFPA 2DQNB 5KFTA 1ZQVA 4EX7A 1PVRA 4FBUA 3HP6A 1SXEA 4OJPA 5CHGA 5K4LA 5AICA 2AGOA 1L7PA 2LYHA 2YMLA 2XI9A 1Z4OA 4Y2YA 1L5UA 5JRTA 4TURA 2IOFK 3IN5A 3RH4A 5AKIA 2NRZA 7ICIA 5KG0A 1VDVA 5TZVA 2JEJA 3V7JA 2G07A 2HDOA 5L1LA 4DSKA 4YR0A 1KRPA 1F5SA 5KNIA 3TI0A 2PKEA 1S0VA 3UQ0A 4F50A 2K4HA 2HHSA 2O6KA 2WF5A 3GZFA 3RF9A 3FC4A 3TARA 2QB0B 1JXLA 1NJWA 2ZIUA 1KDHA 2ISOA 2W3RA 4KX3A 4P4OA 1TK8A 4QZFA 2BKEA 5F9LA 1X2IA 2FDRA 1KKXA 3KZIU 4J9PA 2FMPA 1JXEA 3B0YA 2KFNA 3JPQA 3G6VA 4QZIA 5KG3A 5ALVA 4QNLA 3KD3A 2KOBA 2ZTCA 4UB2A 4PPXA 5KFJA 2LM4A 3IM1A 4PL2A 1JALA 2BZFA 7ICKA 5KFNA 4O3PA 3GFKB 1Z1BA 1ZQGA 2ISPA 4M04A 3H8SA 5KAFU 1L8OA 2DBYA 2KSOB 2GH1A 3E2EA 5D49A 8ICLA 4UAVA 3M9OB 2XY7A 4BXOB 5FP0A 3QNMA 4RU9A 5AKYA 4TQRA 3F2DA 4U6PA 2EAOA 1U4BA 5J2JA 4F8RA 4P4MA 3UXPA 4BUGA 3SMVA 4DQRA 2W7OA 2R8GA 1RXVA 4GLXA 4ACOA 1ZQQA 4JK1A 1LKYA 1Z00A 5L1MA 5KFEA 1ZQDA 4C8KA 4K4HA 3PMLA 3AU2A 5ALRA 2UVVA 4Y2XA 2KG5A 4M9LA 3IHQB 1WCNA 4DSLA 1N61A 5CWRA 4G9BA 4RQ1A 3H0LB 3ZI4A 4UAYA 2KZZA 2C2RA 4PH5A 3PMNA 3T5LA 2VA2A 1ZQTA 9ICAA 1FEZA 3GIMA 1ZQLA 3V7KA 1NK0A 2FMQA 2G06A 4F5QA 2BCSA 3OJUA 4FS2A 1MN8A 1U9LA 9ICBA 3ZDBA 4DSIA 2F77X 1BVSA 3QU9A 4ECUA 4AP9A 1ZXIA 5IIJA 4KLQA 3MC1A 4BWJA 4MFCA 7ICVA 2ODGA 1X9WA 2R8KA 1LB2B 4CDGA 5KFQA 5B5EU 1JX4A 1FFVA 2ESEA 3SD7A 1SZHA 2G5IB 4YQWA 8ICRA 4YMOA 1PK1A 7ICQA 3HPOA 4UB6U 5CP2A 1ZQPA 4KLFA 4PGYA 4UB8U 4P0PA 4ED0A 2PFNA 2LHTA 3Q8SB 2KTQA 4DOCA 2ATLA 2UVRA 4Z6FA 3EYZA 2UVUA 4LJXA 5T14A 5J2AA 2OM6A 3QUQA 4MF2A 5JTIA 8ICBA 3SR6A 3HW8A 1WWUA 2JH1A 3QEBZ 2FMSA 3ZDCA 1BPBA 5G5HA 4ECTA 4MFFA 2F1JA 2HOQA 3GIKA 3LVVA 1S76D 8ICSA 3AN1A 3KHGA 3SENA 5E79U 4RUAA 3SV3A 4RQMA 1HIWA 3Q8PB 4I2AA 4O5EA 3RJKA 1CEZA 3THVA 2W7PA 4OCZA 3QZ8A 5ALKA 5AKEA 4NLGA 1ZQSA 1CI4A 1VLBA 3SAGA 1JN3A 2FI1A 3TFRA 4MEXA 4Q45A 4F4KA 1OXJA 1NJXA 3KOOA 3ORYA 4RT3A 2XVTA 4QW8A 4PZNA 2R8HA 5KT7A 4RQ6A 3OPXA 3QXGA 2JGAA 2HOFA 1WYGA 3OSPA 3AM9A 2DKXA 4MF8A 3C5GA 1K5OA 1X9SA 3GILA 1ZQAA 1JMSA 2KIWA 5AI9A 4QWCA 4C4RA 2DWQA 5KFWA 1C20A 4OJLA 4US9A 5KTQA 4KLIA 2NO4A 1UQVA 4Y2RA 1B4FA 5AM5A 2ZUCA 2FE9A 4M9HA 9ICKA 5AKKA 1XC9A 3EZ5A 1U48A 5ALPA 3PX6A 2A1JB 1BPEA 1L3VA 1ZQMA 5ALLA 5J2KA 8ICUA 3CP8A 2JXJA 9ICCA 5AK3A 4J9KA 4NLNA 3LWMA 1B0XA 3GV8B 1L8LA 1KN5A 5KFIA 4UW9A 1KSPA 1KFDA 1HJPA 4J9LA 2ZTDA 3NGDA 4C8LA 4YN4A 4YR3A 2YQEA 1SWWA 3FYHA 3RH6A 3MR6A 2QB1A 2BHNA 4PJ0U 3KHLA 5KT6A 5ALDA 5J0QA 1ZQHA 3EW9A 4QZBA 2P6UA 4GC6A 4FFDA 4BXOA 1X40A 4UATA 5AM2A 2IBKA 2E1EA 3GIIA 3ISDA 1LVHA 3KHRA 2ES6A 9ICWA 9ICLA 4DOAA 4DLEA 5J2BA 3QUBA 1KFSA 3GDXA 5KFKA 3QE9Y 3QU2A 3GV5B 2V4RA 4DF8A 5KT3A 4DOBA 2MUTB 2JHDA 4PZOA 3PX4A 5J0YA 2YX8A 7ICOA 3WK7A 5KAIU 3PO4A 3ISBA 3RAXA 5CJ7A 4B9MA 4ED7A 4DSJA 4E0DA 4F3OA 2R8IA 3S6JA 5AK5A 5KFYA 2K8BB 3R9KA 1RDFA 2MAXA 4NWIA 2NV3A 4O5KA 4LZGA 5KFZA 2NO5A 3C23A 9ICPA 4F5PA 3PZPA 5KFBA 3LWLA 5KFUA 3EUB2 2HBLA 3RBDA 4B9SA 3D2NA 3PSPA 1QLNA 1TVAA 4F2SA 3QU4A 4O3QA 4QWEA 2HHVA 4XRHA 2Q4TA 4YVZA 4UBBA 2KKVA 2OHFA 2XY6A 2W9BB 3H4BA 1ZRMA 3QU7A 3GU3A 3ETLA 3PV8A 4G3IA 2Y9UA 1A77A 5J0UA 2EH9A 1J97A 2V4QA 4RUCA 2IMWP 3MR3A 4YD2A 2HI0A 4BGDA 5HHIA 1L6NA 3F53A 2IHMA 5DBAA 3Q8RB 4DLGA 3H8JA 3L3FX 1L7OA 2ALZA 4J9QA 1M6YA 4P2HA 3RAQA 2ZIXB 5DB7A 1X6IA 5AIBA 4CGZA 1RQLA 1AROP 4NM2A 1XSPA 3QUCA 3QX7A 9ICGA 2XCPA 1N62A 4C7YA 1JROA 1WG8A 3RJFA 4CF3A 2C2EA 4KLEA 3DEEA 3C2LA 4Q44A 3F2CA 3NTUA 8ICYA 8ICQA 2WF9A 4DL3A 3BQ7A 3B9JA 3RFAA 4KN7A 4UARA 2HHQA 3LDAA 4QWBA 5J2CA 9ICRA 3RRHA 2ZJ8A 3OSNA 3C1ZA 3I28A 3RJEA 2YMMA 3C1YA 2JR5A 1CRXA 3PSIA 4ED1A 5KT2A 4EENA 1XU4A 2KJ8A 5DDMA 1NK7A 1NJYA 2HVHA 4GXJA 3WKCA 1O08A 1D9FA 3NVVA 4KTQA 4GC7A 4NL9A 2I5HA 4DQSA 3SYZA 1Q3VA 1S0OA 5KFGA 4GFJA 3AQFA 8ICIA 3NS1A 3TACB 2JZBB 1SZPA 2W04A 3CNHA 4J03A 2V9WA 1A0PA 1Z3EB 3A0HU 4FS1A 1RQNA 3H4DA 7ICEA 9ICJA 3H7IA 3HILA 1A6SA 1TE2A 2WFAA 4EX6A 2KJ9A 2DPJA 4HAIA 2D6FC 1IM4A 4FE3A 4O3NA 3V6JA 2G08A 3QEAZ 1T4GA 2WHEA 3SEIA 1UT5A 4I29A 1BPDA 1NZBA 1S77D 2RRDA 5EE9A 2EZXA 3RJHA 1D8LA 1QQ5A 2H3FA 4IL6U 1SKRA 1SL0A 4ED6A 2KFZA 3MR5A 4NJ8A 5KL1B 4RNOA 3KBBA 4OO1J 5ALNA 3C21A 1KEJA 2Y0SC 2A19A 3MGIA 2XY5A 4RNMA 4EELA 4DFPA 5DLFA 3PW4A 2XGQA 2NYVA 2NRWA 5HP4A 1ZQ1C 2FLLA 4DEZA 9ICHA 2QARA 3BZKA 2EZYA 4QZ9A 3UMGA 5AKJA 2EDUA 4EBCA 2MUTA 1N60A 1ZQFA 4Z6DA 4UB5A 1ZD5A 3GV7B 1NK8A 3WK6A 2DL0A 9ICSA 4F5OA 1SKSA 3UMBA 4DQPA 3MR2A 3MFHA 4ECSA 3VCBA 4O3MA 3MGVA 2BR0A 3QYPA 3WKDA 1DOQA 2ZIVB 7ICUA 1N2XA 4NL9C 5DBBA 5EE1A 3KTQA 4RPXA 1JI7A 1Z4NA 3WK9A 2JEFA 2JV3A 3ZDDA 3UQ2A 4OJOA 4DFMA 1SWVA 3HRDD 2KZMA 3BQ1A 3DV9A 1DK2A 4DCCA 3BQ2A 5KG7A 2BPCA 5CRXA 2AHOB 2XIDA 3K1ZA 4Y2JA 4P0QB 4GXIA 3RR8A 4O3RA 5AI0A 4CE6A 5C0YA 3T3FA 4BX9C 3OHAA 4EBEA 1QH9A 1V9PA 4QZCA 1TK0A 4M9GA 1QTMA 2AXTU 4F4YA 4F2RA 1ZQJA 4F71A 1DGJA 4RQ8A 3G6XA 5J29A 1ZYQA 1XO1A 4Q8FA 4TUSA 2W9AA 2ZIXA 2HMXA 3FDSA 2KV2A 4M9NA 1SL1A 4KN4A 1XO0A 4NLBA 5AK6A 1Q8KA 2Y0SF 5DBCA 7ICJA 2GLEA 3KHHA 2F76X 2JH7A 1N48A 2HHTA 2CXYA 3N7SC 3RH5A 2KEYA 7ICLA 2HCFA 4PL1A 3N4MB 4DQIA 4CRXA 5H2FU 2D8CA 4U7CA 3T5JA 1BPXA 5AI8A 4ECYA 4OJ5A 4M9JA 5DQIA 4CCHA 4PHAA 4DL7A 1Q3UA 1SV0A 5AKLA 2KK0A 2LYAA 3TKAA 3MDAA 4YCXA 4JWNA 2EANA 5EWEA 1YZ6A 5KFCA 4JV0A 2ASLA 5JUMA 2VA3A 1PVPA 4DFKA 1L3TA 1FFUA 4DFDA 3H40A 7ICTA 3WK8A 9ICEA 3TADA 1TV9A 4ELUA 5IIKA 4ELVA 4EEYA 4JUZA 2J6SA 4DO9A 3C2MA 4NY8A 2CPRA 5ALFA 1Q46A 2W9CB 4QJFB 4I2GA 1IXRA 1DGSA 3GQCA 2PFOA 1RYUA 2KJ5A 1NK9A 2ZJ5A 2JZBA 4PGQA 3RB6A 2GOLA 2BQRA 2W8KA 2YMQA 4R65A 5L1IA 1ZQEA 4RQ3A 2KVSA 2NRXA 3TQ1A 2E5SA 7ICSA 4R66A 2KD1A 5GTIU 2AQ4A 1T94A 2WF7A 4IQUA 9ICOA 2K8CB 4A8EA 2P35A 5KT4A 3MDCA 2KIVA 5ALHA 3RJGA 2IOFA 4B9LA 5G5GA 5J0XA 3C29A 3L4PA 3KZXA 3PSTA 3GIJA 4I2IA 3U26A 2G5HB 1L3SA 2RLTA 1IG6A 4PGXA 5J2GA 2E8OA 5BPCA 2QB0A 4F5NA 3PY8A 3UXOA 3IG5A 3M6ZA 3OGUA 4NV0A 4KMOB 4C80A 7ICFA 2BCQA 4CF4A 2K60A 5AIAA 3LVWA 2Z7JA 2OEHA 4B9VA 4YXMA 3H0RB 5KG6A 3AQEA 1T8EA 1XS9D 3N97B 2OYYA 1BPZA 3QUTA 4KLGA 2YN4A 1KL9A 1ZQYA 5IIOA 4YD1A 4J9NA 1SV0C 3TFSA 9ICNA 2E8NA 5ALOA 1NI3A 3CRXA 1K1QA 4ED8A 4ECVA 4WJ3B 5ALTA 2FLPA 2PFPA 2B0CA 1ZJMA 3PW2A 2KSOA 1ZQNA 1PZNA 3I1YA 3TADC 7ICHA 2W9MA 4ZH4A 2XGPA 4IQTA 3ED5A 4KLDA 2C28A 3K75D 2G09A 3IG8A 3SZ2A 3QU5A 4ECZA 1Z1VA 2E8PA 1ZD4A 3JPPA 4C4SA 4KLJA 5KFSA 2ZIUB 5JU5A 9ICFA 5KFOA 1N63A 4BJQA 1MQ2A 1Y88A 3AMZA 2UVWA 2JEIA 4P0QA 3M7DA 1FO4A 2YY6A 3EWAA 2W55A 4KLTA 4US8A 3IDWA 2C2DA 3JPRA 4B9NA 2HBKA 3NASA 3SQIA 4DQQA 2BCRA 3HKZC 1RM6C 3K1RB 4OD0A 2MSNA 3VC8A 4RQ0A 1NJZA 2J6UA 1P7DA 1ZQKA 2IHNA 4ECRA 1DK3A 1QQ6A 4M6WB 3M8SA 1YZ7A 2HBMA 5GTHU 4FO6A 3BJYA 5J0WA 4O3OA 4DL2A 3PW5A 4IR9A 3JPSA 4R8UB 4Z6CA 4QZHA 2FPMA 4JV2A 5J2HA 2JMGA 3MGHA 4QW9A 2HBJA 2VIXA 2YTUA 1S97A 4C8OA 2FPLA 4F92B 1X9MA 1U47A 8ICWA 5KG2A 1AQ6A 3AUOA 2ZIWB 3PVXA 1OW5A 5ALJA 3Q8KA 4BDPA 2BPGA 2F8KA 2NRTA 2OXOA 2HOIA 1MA7A 1LKYB 4B9TA 4QZAA 3MBYA 5AHXA 1D8YA 1LV5A 2MA1A 2YMPA 4YG2A 3ZDAA 3ZDEA 1A76A 4I2CA 3D2SA 4YFKA 2FPKA 2ZXHA 3L5KA 2DF4B 8ICFA 8ICTA 4DSEA 4IR1A 5J0PA 5BOLA 8ICCA 1ZRNA 1NKEA 3M8RA 1YT3A 5IIMA 2BGWA 5EWGA 4Y2QA 5EOZA 3NVYA 1FIQA 5AI5A 2W9CA 1ZD2P 3J81j 5ALYA 7ICNA 2XICA 3ALRA 3Q8MA 1SKWA 1SIJA 2F44A 2RQ5A 3OTQA 4I2BA 4K4IA 3BQ0A 3UMCA 1S0NA 4F72A 2K89A 2ZTEA 5HHHA 2I1QA 4UAZA 2NRVA 3Q8LA 2KVCA 1ZJNA 1S0MA 4Y2VA 5ALXA 2ZUDA 4UB1A 2K4EA 4DL5A 1F44A 1QSSA 2YB4A 3HJEA 4FZNA 4EEKA 1SGGA 3WKAA 5ALSA 5ALIA 2B6GA 5HNKA 1TAMA 4Y2SA 4USAA 3HKZF 5AM1A 7ICGA 3WKBA 5EE3A 3WK4A 5CA7A 4Q8EA 1QSYA 3ZD8A 3Q8QB 4J9SA 2Y1IA 2W43A 3SV4A 2H3VA 1ZQOA 1KFTA 1MC8A 5C5JA 3IP4B 3E0FA 1TAQA 2HHUA 1BNPA 1HEKA 1JIHA 4RQNA 3N28A 5KFLA 4MFAA 1ZQIA 2A1JA 2MRLA 2Y1JA 5TISU 1X66A 2IOHA 2DPIA 4UAUA 4QIWC 1V38A 4DWIA 1QQ7A 1S10A 4J9RA 3HX0A 2ZXIA 3EPIA 5HMLA 2DKZA 4RZRA 5DB6A 1WCLA 3ICXA 5L1JA 4DS5A 1D8BA 4RQ4A 2HW3A 1KQQA 4DFJA 4RT2A 4GIBA 1IV8A 4ED3A 5KFFA 3V72A 4IRKA 4NM1A 2ASJA 2BPFA 1H38A 5KFMA 2LBOA 2LM1A 2HSZA 4ECWA 2L5YA 3NUQA 4B9UA 4XUSA 2XO7A 1JUDA 4KLOA 1ZQCA 2C22A 4F4XA 1ZD3A 2CN1A 4TUQA 4Y2PA 4NLKA 1QCKA 1COOA 4C8MA 4RQ5A 3H8WA 1J2MA 4F5RA 2BQUA 3HWTA 4KLSA 3LYSA 4I2EA 8ICJA 1S8OA 3ETRA 4YR2A 1XSLA 2K4IA 3QZ7A 5D46A 3PSFA 1KBUA 2Y9TA 3D6JA 4LVSA 5B66U 2JEGA 5KG5A 3RBEA 3F5EA 2XC9A 1KTQA 3JPOA 3T5HA 2BDUA 4UASA 3NVWA 3E58A 4QWDA 2KICA 1O03A 1ZOLA 4IS7A 5HMMA 5DB8A 1PK3A 1ZQBA 1COKA 1RG6A 3RRGA 2KNJA 3N7PD 1ZQZA 4FZLA 5DGBA 4KLHA 3I76A 1L7MA 1NK6A 3O0FA 4IC9A 4M6WA 2WAQC 4GXKA 2OCEA 4OJ6A 2AGQA 3BS5B 1NK4A 5HR7A 4C4TA 9ICUA 1NZPA 4AYBC 5KFHA 2HHXA 4F91B 2KMDA 1PUZA 3M1YA 4R8UA 5DLGA 2W03A 2W54A 2DFLA 1BNOA 4X5VA 4IRDA 2B21A 1NOMA 5ALZA 4IQWA 2W9BA 2EAMA 4PHEA 2EZZA 5KFDA 2YB1A 4YP3A 4TQSA 4I2FA 5IILA 4MEYA 4ECQA 2ZIWA 2RDIA 3B0XA 5DGAA 3T5KA 2GO7A 4I28A 3TAPA 4O5CA 4QIWF 2MU2A 1V85A 3JPNA 1SV4A 4F4ZA 1UPHA 2HVIA 5DG7A 8ICZA 1WUDA 1B43A 1UA1A 4CNQA 2VJ4A 2LMRA 2AQ0A 4DL4A 4UAWA 3V6KA 4UBCA 2A1AA 4QZ8A 8ICEA 3DDHA 3IV6A 1VJ5A 2EQYA 3F2BA 2OH2A 2XCAA 2PFQA 1T3QA 5KFAA 3RTVA 4JV1A 2R8JA 2OWOA 4M2YA 4ELTA 8ICMA 3PR5B 2KHVA 2W8LA 2WF8A 4KMUA 5KL8B 2J6TA 4EYHB 3AL0B 4Y2TA 1N5XA 4EBDA 1ZQRA 4BWMA 3OHBA 2M0NA 1DXSA 2PI5A 1C7YA 5DG9A 1RPLA 2LYBA 3M6KA 2H3IA 2VA8A 9ICVA 2PMZC 9ICXA 5DKWA 3BZCA 4NXZA 2D3DA 1BGXT 1B22A 5AKGA 2AGPA 2K8AA 4I27A 1ECWA 3BQTA 2QKQA 2W11A 1L7NA 3BS7A 5ALGA 4O0IA 4QWAA 1Z19A 1SXDA 3RJIA 4C0ZA 3D2QA 3SI8A 1NKCA 2KHQA 4P4PA 5ALWA 5KG4A 1TK5A 5A0LA 3WK5A 1GO3F 3NRWA 2WAQF 2R18A 1NNLA 4AYBF 4ZOHC 2ZUBA 4EZ6A 3ZD9A 5J0TA 4NLCA 4C8NA 2E1FA 5KFXA 4F93B 5IINA 3UPQA 2BDPA 4F4WA 2F3NA 3PX0A 5J2FA 1SB3C 3KKAA 2F1IA 1D9DA 2E3TA 2LKYA 4M47A 3PR4A 2KZ3A 4I2DA 5J8YA 1RYRA 4JWMA 3WU2U 2H5XA 1RZTA 5KFRA 1K1SA 5ALMA 5IIIA 2K4PA 2KP7A 4EYIB 2HHWA 3H0MB 1QSLA 5ALUA 5DDYA 4UB3A 1J2NA 4Y2UA 1TAUA 4UQGA 1PVQA 8ICNA 4TUPA 2AH5A 3CYMA 4O3SA 5J2DA 3NRZA 1L3UA 3AEVA 3FAHA 1X6JA 4Q43A 2H3QA
chains in the Genus database with same CATH topology
3GZFA 3RF9A 2E1EA 4FE3A 3L3FX 2CPRA 3IP4B 2ZIWB 3E0FA 2KNJA 3N7PD 5CRXA 3CRXA 2G08A 2ZIUA 2DGZA 2ZIXB 4FZLA 4WJ3B 2G06A 4QJFB 4P0PB 4CGZA 2K8AA 2OXOA 2XIDA 2XVTA 4KX3A 3K1ZA 1HEKA 1URJA 3F5AA 3O0FA 1NZBA 4IC9A 2KJ5A 2RRDA 1MA7A 2HOIA 4P0QB 2WAQC 1DRGA 4OJ6A 1ECWA 2WB1F 2ZG6A 3KFUF 5HR7A 2MRLA 3OPXA 2F77X 2H3FA 2GOLA 2MA1A 4FZMA 4AYBC 2JHDA 2JGAA 1Z19A 2PMZF 2HOFA 3C28A 4C0ZA 3DEEA 4QIWC 5C0YA 5KL1B 2W03A 3D2QA 2F2AB 4BX9C 4OO1J 3F2CA 2YX8A 2ZXIA 3D2SA 3T79A 2ZXHA 2KIWA 2Y0SC 2KHQA 2DF4B 3ONNA 4CDGA 2VKQA 4QNLA 2KOBA 3ICXA 2G09A 4OJLA 3IG8A 1OUQA 1D8BA 5A0LA 2E5SA 3RFAA 1SZHA 2YB1A 1GO3F 2G5IB 3NRWA 2WAQF 4PL2A 2KD1A 2N1RA 1YT3A 2G0AA 2R18A 1ZQ1C 2ZIWA 3N7RC 1T94A 2H3ZA 2K8BB 2ZIUB 4AYBF 2K8CB 1Z1BA 2DQNB 2ZIXA 4A8EA 2HMXA 4NWIA 2ZIVA 3SAHA 4P0PA 4ICAA 4BJQA 4QIWF 2NV3A 4NLCA 2KV2A 2LHTA 4P0QA 2LBOA 2E1FA 3M7DA 1PVRA 2XICA 3PSIA 1CRXA 3ALRA 3PZPA 2GH1A 3NUQA 4NLBA 4OJPA 1XO0A 2Y0SF 1UPHA 2HBLA 2KJ8A 2RHFA 3C29A 2F76X 2JH7A 1ED1A 3CP8A 3D2NA 3KZXA 3PSPA 1WUDA 3PSTA 3N7SC 5T14A 2G5HB 2KEYA 2HBKA 2LKYA 1XNSA 2OM6A 4PL1A 2XI9A 2CN1A 4U6PA 3F2DA 3SQIA 2VJ4A 2Q4TA 2KKPA 3HKZC 4CRXA 4JMUA 2KKVA 1Q3VA 3SAFA 2JH1A 4BUGA 3SMVA 2K89A 3IG5A 2W7OA 4U7CA 3VC8A 3VCBA 4GFJA 4O3MA 3M6ZA 2HOQA 4ACOA 3AQFA 4NV0A 4OJ5A 3LVVA 3MGVA 3IN5A 4KMOB 1P7DA 3F2BA 3LYSA 2OH2A 2A3VA 2KVCA 1IIPA 2K4IA 3GU3A 2CRXA 3H0MB 2HBMA 2K4EA 2G07A 1Q3UA 2KHVA 1KBUA 2W04A 3PSFA 3LVWA 2LYAA 2Z7JA 1F44A 1A0PA 1HIWA 2ZIVB 2F8LA 2YB4A 2VJ5A 4FZNA 5KL8B 1PVQA 3AL0B 1TAMA 3H0RB 2RP5A 3F5EA 3HKZF 2W7PA 2M0NA 2JMGA 3AQEA 2HBJA 2VIXA 3H0LB 1PVPA 2WB1C 3CYMA 2BDUA 4OJOA 5HR6A 2KICA 2LYBA 2H3IA 2OYYA 3M6KA 1A6SA 2KJ9A 3SAGA 2K4HA 1L6NA 2PMZC 3F53A 2H3QA 4KX5A 2D6FC 2H3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8C B;  3PSP A;  3PST A;  3L3F X;  2K8A A;  2K8B B;  2K89 A; 
#chains in the Genus database with same CATH topology
 1XWL A;  1ZQW A;  2BCV A;  5L1K A;  1X9X A;  2DGZ A;  8ICG A;  1URJ A;  3F5A A;  5ALE A;  3KFU F;  4EZ9 A;  3CW2 C;  2PMZ F;  5F9N A;  1HUO A;  3OJS A;  1N5W A;  5DB9 A;  3PW0 A;  3T79 A;  3C2K A;  1U45 A;  4DSF A;  3RB3 A;  1UT8 A;  5EWF A;  4KLL A;  3TAN A;  5J0S A;  1XSN A;  8ICP A;  3NVZ A;  4NLZ A;  2G0A A;  3N7R C;  4I2H A;  1S5L U;  4J9O A;  2ZIV A;  3SAH A;  4XQ8 A;  4ED2 A;  8ICV A;  3JPT A;  3BS5 A;  4DL6 A;  4UB4 A;  2GWS A;  2EAP A;  2LPE A;  1ED1 A;  4C7Z A;  1WWV A;  4J9M A;  4DF4 A;  3PNC A;  3M9M B;  2P6R A;  5J0R A;  4JMU A;  5J2I A;  3A0B U;  3MFI A;  4RPY A;  1V97 A;  5J2E A;  2FLN A;  1MQ3 A;  3H8M A;  1UCV A;  1IIP A;  4O9M A;  1KLN A;  3KKA C;  1CUK A;  2CRX A;  5AKZ A;  2QAR B;  2F8L A;  2VJ5 A;  1ZQU A;  9ICI A;  5J8Y C;  5AK4 A;  2QLT A;  3MAB A;  8ICK A;  2RP5 A;  5AI6 A;  3RJJ A;  2WB1 C;  4QZD A;  5HR6 A;  4KIT B;  2AJQ A;  1RYS A;  4KX5 A;  4RPZ A;  2IA6 A;  1MSW D;  5CEH A;  1NK5 A;  4LZD A;  3RR7 A;  2P66 A;  2F1H A;  2AU0 A;  1X42 A;  4KLU A;  1S9F A;  1UA0 A;  2ZG6 A;  1NKB A;  1TFR A;  2ZJA A;  4FZM A;  4FBT A;  4K4G A;  1ZET A;  2DUY A;  3AU6 A;  2F2A B;  4JB3 A;  5AKX A;  8ICH A;  3M9N B;  4M0A A;  3V6H A;  5EE0 A;  5L9X A;  3LK9 A;  3ONN A;  5AM0 A;  2N1R A;  1Z00 B;  3G6Y A;  4IRC A;  5DQH A;  2JRZ A;  1U49 A;  4ICA A;  2E8M A;  5AI4 A;  5ALQ A;  5D4B A;  4RQ2 A;  1T7P A;  4YXJ A;  2M9N A;  4IQV A;  4HYK A;  4MHV A;  1XNS A;  1HUZ A;  3EPG A;  2KKP A;  4QZG A;  4PHD A;  3V7L A;  3SAF A;  5KG1 A;  2PI4 A;  1TKD A;  4KLM A;  3WKE A;  7ICP A;  2Q0Z X;  2I9G A;  2A3V A;  1JRP A;  2BQ3 A;  1EXN A;  3UXN A;  7ICM A;  1F0M A;  3RB4 A;  2ASD A;  4I2J A;  5CR0 A;  4RNN A;  1BPY A;  2WF6 A;  9ICT A;  2KE7 A;  2KN7 A;  1RXW A;  3RB0 A;  3BDP A;  3TAQ A;  4RQ7 A;  8ICX A;  2I6X A;  7ICR A;  2PXI A;  4QZE A;  5DG8 A;  2LI6 A;  2VAN A;  3HT3 A;  2RHF A;  4R63 A;  4YMN A;  9ICM A;  5AKH A;  4ECX A;  1PK1 B;  1UHU A;  8ICA A;  9ICQ A;  4Z6E A;  4CF5 A;  4YMM A;  4PHP A;  4P0P B;  2RDJ A;  5DQG A;  1T3N A;  1DRG A;  8ICO A;  2WB1 F;  1ZQX A;  3UM9 A;  2BCU A;  5AM4 A;  5KT5 A;  2W3S A;  3C28 A;  4B6J A;  3PO5 A;  3ISC A;  5BOM A;  4XA5 A;  3PW7 A;  5F3X B;  5CB1 A;  2WTF A;  1N56 A;  2FJ6 A;  2VKQ A;  5KFV A;  5J0O A;  5AM3 A;  1OUQ A;  1KW4 A;  3K4G A;  3FM9 A;  1SL2 A;  3IRU A;  4DS4 A;  2H3Z A;  4R64 A;  3C5F A;  5KFP A;  2DQN B;  5KFT A;  1ZQV A;  4EX7 A;  1PVR A;  4FBU A;  3HP6 A;  1SXE A;  4OJP A;  5CHG A;  5K4L A;  5AIC A;  2AGO A;  1L7P A;  2LYH A;  2YML A;  2XI9 A;  1Z4O A;  4Y2Y A;  1L5U A;  5JRT A;  4TUR A;  2IOF K;  3IN5 A;  3RH4 A;  5AKI A;  2NRZ A;  7ICI A;  5KG0 A;  1VDV A;  5TZV A;  2JEJ A;  3V7J A;  2G07 A;  2HDO A;  5L1L A;  4DSK A;  4YR0 A;  1KRP A;  1F5S A;  5KNI A;  3TI0 A;  2PKE A;  1S0V A;  3UQ0 A;  4F50 A;  2K4H A;  2HHS A;  2O6K A;  2WF5 A;  3GZF A;  3RF9 A;  3FC4 A;  3TAR A;  2QB0 B;  1JXL A;  1NJW A;  2ZIU A;  1KDH A;  2ISO A;  2W3R A;  4KX3 A;  4P4O A;  1TK8 A;  4QZF A;  2BKE A;  5F9L A;  1X2I A;  2FDR A;  1KKX A;  3KZI U;  4J9P A;  2FMP A;  1JXE A;  3B0Y A;  2KFN A;  3JPQ A;  3G6V A;  4QZI A;  5KG3 A;  5ALV A;  4QNL A;  3KD3 A;  2KOB A;  2ZTC A;  4UB2 A;  4PPX A;  5KFJ A;  2LM4 A;  3IM1 A;  4PL2 A;  1JAL A;  2BZF A;  7ICK A;  5KFN A;  4O3P A;  3GFK B;  1Z1B A;  1ZQG A;  2ISP A;  4M04 A;  3H8S A;  5KAF U;  1L8O A;  2DBY A;  2KSO B;  2GH1 A;  3E2E A;  5D49 A;  8ICL A;  4UAV A;  3M9O B;  2XY7 A;  4BXO B;  5FP0 A;  3QNM A;  4RU9 A;  5AKY A;  4TQR A;  3F2D A;  4U6P A;  2EAO A;  1U4B A;  5J2J A;  4F8R A;  4P4M A;  3UXP A;  4BUG A;  3SMV A;  4DQR A;  2W7O A;  2R8G A;  1RXV A;  4GLX A;  4ACO A;  1ZQQ A;  4JK1 A;  1LKY A;  1Z00 A;  5L1M A;  5KFE A;  1ZQD A;  4C8K A;  4K4H A;  3PML A;  3AU2 A;  5ALR A;  2UVV A;  4Y2X A;  2KG5 A;  4M9L A;  3IHQ B;  1WCN A;  4DSL A;  1N61 A;  5CWR A;  4G9B A;  4RQ1 A;  3H0L B;  3ZI4 A;  4UAY A;  2KZZ A;  2C2R A;  4PH5 A;  3PMN A;  3T5L A;  2VA2 A;  1ZQT A;  9ICA A;  1FEZ A;  3GIM A;  1ZQL A;  3V7K A;  1NK0 A;  2FMQ A;  2G06 A;  4F5Q A;  2BCS A;  3OJU A;  4FS2 A;  1MN8 A;  1U9L A;  9ICB A;  3ZDB A;  4DSI A;  2F77 X;  1BVS A;  3QU9 A;  4ECU A;  4AP9 A;  1ZXI A;  5IIJ A;  4KLQ A;  3MC1 A;  4BWJ A;  4MFC A;  7ICV A;  2ODG A;  1X9W A;  2R8K A;  1LB2 B;  4CDG A;  5KFQ A;  5B5E U;  1JX4 A;  1FFV A;  2ESE A;  3SD7 A;  1SZH A;  2G5I B;  4YQW A;  8ICR A;  4YMO A;  1PK1 A;  7ICQ A;  3HPO A;  4UB6 U;  5CP2 A;  1ZQP A;  4KLF A;  4PGY A;  4UB8 U;  4P0P A;  4ED0 A;  2PFN A;  2LHT A;  3Q8S B;  2KTQ A;  4DOC A;  2ATL A;  2UVR A;  4Z6F A;  3EYZ A;  2UVU A;  4LJX A;  5T14 A;  5J2A A;  2OM6 A;  3QUQ A;  4MF2 A;  5JTI A;  8ICB A;  3SR6 A;  3HW8 A;  1WWU A;  2JH1 A;  3QEB Z;  2FMS A;  3ZDC A;  1BPB A;  5G5H A;  4ECT A;  4MFF A;  2F1J A;  2HOQ A;  3GIK A;  3LVV A;  1S76 D;  8ICS A;  3AN1 A;  3KHG A;  3SEN A;  5E79 U;  4RUA A;  3SV3 A;  4RQM A;  1HIW A;  3Q8P B;  4I2A A;  4O5E A;  3RJK A;  1CEZ A;  3THV A;  2W7P A;  4OCZ A;  3QZ8 A;  5ALK A;  5AKE A;  4NLG A;  1ZQS A;  1CI4 A;  1VLB A;  3SAG A;  1JN3 A;  2FI1 A;  3TFR A;  4MEX A;  4Q45 A;  4F4K A;  1OXJ A;  1NJX A;  3KOO A;  3ORY A;  4RT3 A;  2XVT A;  4QW8 A;  4PZN A;  2R8H A;  5KT7 A;  4RQ6 A;  3OPX A;  3QXG A;  2JGA A;  2HOF A;  1WYG A;  3OSP A;  3AM9 A;  2DKX A;  4MF8 A;  3C5G A;  1K5O A;  1X9S A;  3GIL A;  1ZQA A;  1JMS A;  2KIW A;  5AI9 A;  4QWC A;  4C4R A;  2DWQ A;  5KFW A;  1C20 A;  4OJL A;  4US9 A;  5KTQ A;  4KLI A;  2NO4 A;  1UQV A;  4Y2R A;  1B4F A;  5AM5 A;  2ZUC A;  2FE9 A;  4M9H A;  9ICK A;  5AKK A;  1XC9 A;  3EZ5 A;  1U48 A;  5ALP A;  3PX6 A;  2A1J B;  1BPE A;  1L3V A;  1ZQM A;  5ALL A;  5J2K A;  8ICU A;  3CP8 A;  2JXJ A;  9ICC A;  5AK3 A;  4J9K A;  4NLN A;  3LWM A;  1B0X A;  3GV8 B;  1L8L A;  1KN5 A;  5KFI A;  4UW9 A;  1KSP A;  1KFD A;  1HJP A;  4J9L A;  2ZTD A;  3NGD A;  4C8L A;  4YN4 A;  4YR3 A;  2YQE A;  1SWW A;  3FYH A;  3RH6 A;  3MR6 A;  2QB1 A;  2BHN A;  4PJ0 U;  3KHL A;  5KT6 A;  5ALD A;  5J0Q A;  1ZQH A;  3EW9 A;  4QZB A;  2P6U A;  4GC6 A;  4FFD A;  4BXO A;  1X40 A;  4UAT A;  5AM2 A;  2IBK A;  2E1E A;  3GII A;  3ISD A;  1LVH A;  3KHR A;  2ES6 A;  9ICW A;  9ICL A;  4DOA A;  4DLE A;  5J2B A;  3QUB A;  1KFS A;  3GDX A;  5KFK A;  3QE9 Y;  3QU2 A;  3GV5 B;  2V4R A;  4DF8 A;  5KT3 A;  4DOB A;  2MUT B;  2JHD A;  4PZO A;  3PX4 A;  5J0Y A;  2YX8 A;  7ICO A;  3WK7 A;  5KAI U;  3PO4 A;  3ISB A;  3RAX A;  5CJ7 A;  4B9M A;  4ED7 A;  4DSJ A;  4E0D A;  4F3O A;  2R8I A;  3S6J A;  5AK5 A;  5KFY A;  2K8B B;  3R9K A;  1RDF A;  2MAX A;  4NWI A;  2NV3 A;  4O5K A;  4LZG A;  5KFZ A;  2NO5 A;  3C23 A;  9ICP A;  4F5P A;  3PZP A;  5KFB A;  3LWL A;  5KFU A;  3EUB 2;  2HBL A;  3RBD A;  4B9S A;  3D2N A;  3PSP A;  1QLN A;  1TVA A;  4F2S A;  3QU4 A;  4O3Q A;  4QWE A;  2HHV A;  4XRH A;  2Q4T A;  4YVZ A;  4UBB A;  2KKV A;  2OHF A;  2XY6 A;  2W9B B;  3H4B A;  1ZRM A;  3QU7 A;  3GU3 A;  3ETL A;  3PV8 A;  4G3I A;  2Y9U A;  1A77 A;  5J0U A;  2EH9 A;  1J97 A;  2V4Q A;  4RUC A;  2IMW P;  3MR3 A;  4YD2 A;  2HI0 A;  4BGD A;  5HHI A;  1L6N A;  3F53 A;  2IHM A;  5DBA A;  3Q8R B;  4DLG A;  3H8J A;  3L3F X;  1L7O A;  2ALZ A;  4J9Q A;  1M6Y A;  4P2H A;  3RAQ A;  2ZIX B;  5DB7 A;  1X6I A;  5AIB A;  4CGZ A;  1RQL A;  1ARO P;  4NM2 A;  1XSP A;  3QUC A;  3QX7 A;  9ICG A;  2XCP A;  1N62 A;  4C7Y A;  1JRO A;  1WG8 A;  3RJF A;  4CF3 A;  2C2E A;  4KLE A;  3DEE A;  3C2L A;  4Q44 A;  3F2C A;  3NTU A;  8ICY A;  8ICQ A;  2WF9 A;  4DL3 A;  3BQ7 A;  3B9J A;  3RFA A;  4KN7 A;  4UAR A;  2HHQ A;  3LDA A;  4QWB A;  5J2C A;  9ICR A;  3RRH A;  2ZJ8 A;  3OSN A;  3C1Z A;  3I28 A;  3RJE A;  2YMM A;  3C1Y A;  2JR5 A;  1CRX A;  3PSI A;  4ED1 A;  5KT2 A;  4EEN A;  1XU4 A;  2KJ8 A;  5DDM A;  1NK7 A;  1NJY A;  2HVH A;  4GXJ A;  3WKC A;  1O08 A;  1D9F A;  3NVV A;  4KTQ A;  4GC7 A;  4NL9 A;  2I5H A;  4DQS A;  3SYZ A;  1Q3V A;  1S0O A;  5KFG A;  4GFJ A;  3AQF A;  8ICI A;  3NS1 A;  3TAC B;  2JZB B;  1SZP A;  2W04 A;  3CNH A;  4J03 A;  2V9W A;  1A0P A;  1Z3E B;  3A0H U;  4FS1 A;  1RQN A;  3H4D A;  7ICE A;  9ICJ A;  3H7I A;  3HIL A;  1A6S A;  1TE2 A;  2WFA A;  4EX6 A;  2KJ9 A;  2DPJ A;  4HAI A;  2D6F C;  1IM4 A;  4FE3 A;  4O3N A;  3V6J A;  2G08 A;  3QEA Z;  1T4G A;  2WHE A;  3SEI A;  1UT5 A;  4I29 A;  1BPD A;  1NZB A;  1S77 D;  2RRD A;  5EE9 A;  2EZX A;  3RJH A;  1D8L A;  1QQ5 A;  2H3F A;  4IL6 U;  1SKR A;  1SL0 A;  4ED6 A;  2KFZ A;  3MR5 A;  4NJ8 A;  5KL1 B;  4RNO A;  3KBB A;  4OO1 J;  5ALN A;  3C21 A;  1KEJ A;  2Y0S C;  2A19 A;  3MGI A;  2XY5 A;  4RNM A;  4EEL A;  4DFP A;  5DLF A;  3PW4 A;  2XGQ A;  2NYV A;  2NRW A;  5HP4 A;  1ZQ1 C;  2FLL A;  4DEZ A;  9ICH A;  2QAR A;  3BZK A;  2EZY A;  4QZ9 A;  3UMG A;  5AKJ A;  2EDU A;  4EBC A;  2MUT A;  1N60 A;  1ZQF A;  4Z6D A;  4UB5 A;  1ZD5 A;  3GV7 B;  1NK8 A;  3WK6 A;  2DL0 A;  9ICS A;  4F5O A;  1SKS A;  3UMB A;  4DQP A;  3MR2 A;  3MFH A;  4ECS A;  3VCB A;  4O3M A;  3MGV A;  2BR0 A;  3QYP A;  3WKD A;  1DOQ A;  2ZIV B;  7ICU A;  1N2X A;  4NL9 C;  5DBB A;  5EE1 A;  3KTQ A;  4RPX A;  1JI7 A;  1Z4N A;  3WK9 A;  2JEF A;  2JV3 A;  3ZDD A;  3UQ2 A;  4OJO A;  4DFM A;  1SWV A;  3HRD D;  2KZM A;  3BQ1 A;  3DV9 A;  1DK2 A;  4DCC A;  3BQ2 A;  5KG7 A;  2BPC A;  5CRX A;  2AHO B;  2XID A;  3K1Z A;  4Y2J A;  4P0Q B;  4GXI A;  3RR8 A;  4O3R A;  5AI0 A;  4CE6 A;  5C0Y A;  3T3F A;  4BX9 C;  3OHA A;  4EBE A;  1QH9 A;  1V9P A;  4QZC A;  1TK0 A;  4M9G A;  1QTM A;  2AXT U;  4F4Y A;  4F2R A;  1ZQJ A;  4F71 A;  1DGJ A;  4RQ8 A;  3G6X A;  5J29 A;  1ZYQ A;  1XO1 A;  4Q8F A;  4TUS A;  2W9A A;  2ZIX A;  2HMX A;  3FDS A;  2KV2 A;  4M9N A;  1SL1 A;  4KN4 A;  1XO0 A;  4NLB A;  5AK6 A;  1Q8K A;  2Y0S F;  5DBC A;  7ICJ A;  2GLE A;  3KHH A;  2F76 X;  2JH7 A;  1N48 A;  2HHT A;  2CXY A;  3N7S C;  3RH5 A;  2KEY A;  7ICL A;  2HCF A;  4PL1 A;  3N4M B;  4DQI A;  4CRX A;  5H2F U;  2D8C A;  4U7C A;  3T5J A;  1BPX A;  5AI8 A;  4ECY A;  4OJ5 A;  4M9J A;  5DQI A;  4CCH A;  4PHA A;  4DL7 A;  1Q3U A;  1SV0 A;  5AKL A;  2KK0 A;  2LYA A;  3TKA A;  3MDA A;  4YCX A;  4JWN A;  2EAN A;  5EWE A;  1YZ6 A;  5KFC A;  4JV0 A;  2ASL A;  5JUM A;  2VA3 A;  1PVP A;  4DFK A;  1L3T A;  1FFU A;  4DFD A;  3H40 A;  7ICT A;  3WK8 A;  9ICE A;  3TAD A;  1TV9 A;  4ELU A;  5IIK A;  4ELV A;  4EEY A;  4JUZ A;  2J6S A;  4DO9 A;  3C2M A;  4NY8 A;  2CPR A;  5ALF A;  1Q46 A;  2W9C B;  4QJF B;  4I2G A;  1IXR A;  1DGS A;  3GQC A;  2PFO A;  1RYU A;  2KJ5 A;  1NK9 A;  2ZJ5 A;  2JZB A;  4PGQ A;  3RB6 A;  2GOL A;  2BQR A;  2W8K A;  2YMQ A;  4R65 A;  5L1I A;  1ZQE A;  4RQ3 A;  2KVS A;  2NRX A;  3TQ1 A;  2E5S A;  7ICS A;  4R66 A;  2KD1 A;  5GTI U;  2AQ4 A;  1T94 A;  2WF7 A;  4IQU A;  9ICO A;  2K8C B;  4A8E A;  2P35 A;  5KT4 A;  3MDC A;  2KIV A;  5ALH A;  3RJG A;  2IOF A;  4B9L A;  5G5G A;  5J0X A;  3C29 A;  3L4P A;  3KZX A;  3PST A;  3GIJ A;  4I2I A;  3U26 A;  2G5H B;  1L3S A;  2RLT A;  1IG6 A;  4PGX A;  5J2G A;  2E8O A;  5BPC A;  2QB0 A;  4F5N A;  3PY8 A;  3UXO A;  3IG5 A;  3M6Z A;  3OGU A;  4NV0 A;  4KMO B;  4C80 A;  7ICF A;  2BCQ A;  4CF4 A;  2K60 A;  5AIA A;  3LVW A;  2Z7J A;  2OEH A;  4B9V A;  4YXM A;  3H0R B;  5KG6 A;  3AQE A;  1T8E A;  1XS9 D;  3N97 B;  2OYY A;  1BPZ A;  3QUT A;  4KLG A;  2YN4 A;  1KL9 A;  1ZQY A;  5IIO A;  4YD1 A;  4J9N A;  1SV0 C;  3TFS A;  9ICN A;  2E8N A;  5ALO A;  1NI3 A;  3CRX A;  1K1Q A;  4ED8 A;  4ECV A;  4WJ3 B;  5ALT A;  2FLP A;  2PFP A;  2B0C A;  1ZJM A;  3PW2 A;  2KSO A;  1ZQN A;  1PZN A;  3I1Y A;  3TAD C;  7ICH A;  2W9M A;  4ZH4 A;  2XGP A;  4IQT A;  3ED5 A;  4KLD A;  2C28 A;  3K75 D;  2G09 A;  3IG8 A;  3SZ2 A;  3QU5 A;  4ECZ A;  1Z1V A;  2E8P A;  1ZD4 A;  3JPP A;  4C4S A;  4KLJ A;  5KFS A;  2ZIU B;  5JU5 A;  9ICF A;  5KFO A;  1N63 A;  4BJQ A;  1MQ2 A;  1Y88 A;  3AMZ A;  2UVW A;  2JEI A;  4P0Q A;  3M7D A;  1FO4 A;  2YY6 A;  3EWA A;  2W55 A;  4KLT A;  4US8 A;  3IDW A;  2C2D A;  3JPR A;  4B9N A;  2HBK A;  3NAS A;  3SQI A;  4DQQ A;  2BCR A;  3HKZ C;  1RM6 C;  3K1R B;  4OD0 A;  2MSN A;  3VC8 A;  4RQ0 A;  1NJZ A;  2J6U A;  1P7D A;  1ZQK A;  2IHN A;  4ECR A;  1DK3 A;  1QQ6 A;  4M6W B;  3M8S A;  1YZ7 A;  2HBM A;  5GTH U;  4FO6 A;  3BJY A;  5J0W A;  4O3O A;  4DL2 A;  3PW5 A;  4IR9 A;  3JPS A;  4R8U B;  4Z6C A;  4QZH A;  2FPM A;  4JV2 A;  5J2H A;  2JMG A;  3MGH A;  4QW9 A;  2HBJ A;  2VIX A;  2YTU A;  1S97 A;  4C8O A;  2FPL A;  4F92 B;  1X9M A;  1U47 A;  8ICW A;  5KG2 A;  1AQ6 A;  3AUO A;  2ZIW B;  3PVX A;  1OW5 A;  5ALJ A;  3Q8K A;  4BDP A;  2BPG A;  2F8K A;  2NRT A;  2OXO A;  2HOI A;  1MA7 A;  1LKY B;  4B9T A;  4QZA A;  3MBY A;  5AHX A;  1D8Y A;  1LV5 A;  2MA1 A;  2YMP A;  4YG2 A;  3ZDA A;  3ZDE A;  1A76 A;  4I2C A;  3D2S A;  4YFK A;  2FPK A;  2ZXH A;  3L5K A;  2DF4 B;  8ICF A;  8ICT A;  4DSE A;  4IR1 A;  5J0P A;  5BOL A;  8ICC A;  1ZRN A;  1NKE A;  3M8R A;  1YT3 A;  5IIM A;  2BGW A;  5EWG A;  4Y2Q A;  5EOZ A;  3NVY A;  1FIQ A;  5AI5 A;  2W9C A;  1ZD2 P;  3J81 j;  5ALY A;  7ICN A;  2XIC A;  3ALR A;  3Q8M A;  1SKW A;  1SIJ A;  2F44 A;  2RQ5 A;  3OTQ A;  4I2B A;  4K4I A;  3BQ0 A;  3UMC A;  1S0N A;  4F72 A;  2K89 A;  2ZTE A;  5HHH A;  2I1Q A;  4UAZ A;  2NRV A;  3Q8L A;  2KVC A;  1ZJN A;  1S0M A;  4Y2V A;  5ALX A;  2ZUD A;  4UB1 A;  2K4E A;  4DL5 A;  1F44 A;  1QSS A;  2YB4 A;  3HJE A;  4FZN A;  4EEK A;  1SGG A;  3WKA A;  5ALS A;  5ALI A;  2B6G A;  5HNK A;  1TAM A;  4Y2S A;  4USA A;  3HKZ F;  5AM1 A;  7ICG A;  3WKB A;  5EE3 A;  3WK4 A;  5CA7 A;  4Q8E A;  1QSY A;  3ZD8 A;  3Q8Q B;  4J9S A;  2Y1I A;  2W43 A;  3SV4 A;  2H3V A;  1ZQO A;  1KFT A;  1MC8 A;  5C5J A;  3IP4 B;  3E0F A;  1TAQ A;  2HHU A;  1BNP A;  1HEK A;  1JIH A;  4RQN A;  3N28 A;  5KFL A;  4MFA A;  1ZQI A;  2A1J A;  2MRL A;  2Y1J A;  5TIS U;  1X66 A;  2IOH A;  2DPI A;  4UAU A;  4QIW C;  1V38 A;  4DWI A;  1QQ7 A;  1S10 A;  4J9R A;  3HX0 A;  2ZXI A;  3EPI A;  5HML A;  2DKZ A;  4RZR A;  5DB6 A;  1WCL A;  3ICX A;  5L1J A;  4DS5 A;  1D8B A;  4RQ4 A;  2HW3 A;  1KQQ A;  4DFJ A;  4RT2 A;  4GIB A;  1IV8 A;  4ED3 A;  5KFF A;  3V72 A;  4IRK A;  4NM1 A;  2ASJ A;  2BPF A;  1H38 A;  5KFM A;  2LBO A;  2LM1 A;  2HSZ A;  4ECW A;  2L5Y A;  3NUQ A;  4B9U A;  4XUS A;  2XO7 A;  1JUD A;  4KLO A;  1ZQC A;  2C22 A;  4F4X A;  1ZD3 A;  2CN1 A;  4TUQ A;  4Y2P A;  4NLK A;  1QCK A;  1COO A;  4C8M A;  4RQ5 A;  3H8W A;  1J2M A;  4F5R A;  2BQU A;  3HWT A;  4KLS A;  3LYS A;  4I2E A;  8ICJ A;  1S8O A;  3ETR A;  4YR2 A;  1XSL A;  2K4I A;  3QZ7 A;  5D46 A;  3PSF A;  1KBU A;  2Y9T A;  3D6J A;  4LVS A;  5B66 U;  2JEG A;  5KG5 A;  3RBE A;  3F5E A;  2XC9 A;  1KTQ A;  3JPO A;  3T5H A;  2BDU A;  4UAS A;  3NVW A;  3E58 A;  4QWD A;  2KIC A;  1O03 A;  1ZOL A;  4IS7 A;  5HMM A;  5DB8 A;  1PK3 A;  1ZQB A;  1COK A;  1RG6 A;  3RRG A;  2KNJ A;  3N7P D;  1ZQZ A;  4FZL A;  5DGB A;  4KLH A;  3I76 A;  1L7M A;  1NK6 A;  3O0F A;  4IC9 A;  4M6W A;  2WAQ C;  4GXK A;  2OCE A;  4OJ6 A;  2AGQ A;  3BS5 B;  1NK4 A;  5HR7 A;  4C4T A;  9ICU A;  1NZP A;  4AYB C;  5KFH A;  2HHX A;  4F91 B;  2KMD A;  1PUZ A;  3M1Y A;  4R8U A;  5DLG A;  2W03 A;  2W54 A;  2DFL A;  1BNO A;  4X5V A;  4IRD A;  2B21 A;  1NOM A;  5ALZ A;  4IQW A;  2W9B A;  2EAM A;  4PHE A;  2EZZ A;  5KFD A;  2YB1 A;  4YP3 A;  4TQS A;  4I2F A;  5IIL A;  4MEY A;  4ECQ A;  2ZIW A;  2RDI A;  3B0X A;  5DGA A;  3T5K A;  2GO7 A;  4I28 A;  3TAP A;  4O5C A;  4QIW F;  2MU2 A;  1V85 A;  3JPN A;  1SV4 A;  4F4Z A;  1UPH A;  2HVI A;  5DG7 A;  8ICZ A;  1WUD A;  1B43 A;  1UA1 A;  4CNQ A;  2VJ4 A;  2LMR A;  2AQ0 A;  4DL4 A;  4UAW A;  3V6K A;  4UBC A;  2A1A A;  4QZ8 A;  8ICE A;  3DDH A;  3IV6 A;  1VJ5 A;  2EQY A;  3F2B A;  2OH2 A;  2XCA A;  2PFQ A;  1T3Q A;  5KFA A;  3RTV A;  4JV1 A;  2R8J A;  2OWO A;  4M2Y A;  4ELT A;  8ICM A;  3PR5 B;  2KHV A;  2W8L A;  2WF8 A;  4KMU A;  5KL8 B;  2J6T A;  4EYH B;  3AL0 B;  4Y2T A;  1N5X A;  4EBD A;  1ZQR A;  4BWM A;  3OHB A;  2M0N A;  1DXS A;  2PI5 A;  1C7Y A;  5DG9 A;  1RPL A;  2LYB A;  3M6K A;  2H3I A;  2VA8 A;  9ICV A;  2PMZ C;  9ICX A;  5DKW A;  3BZC A;  4NXZ A;  2D3D A;  1BGX T;  1B22 A;  5AKG A;  2AGP A;  2K8A A;  4I27 A;  1ECW A;  3BQT A;  2QKQ A;  2W11 A;  1L7N A;  3BS7 A;  5ALG A;  4O0I A;  4QWA A;  1Z19 A;  1SXD A;  3RJI A;  4C0Z A;  3D2Q A;  3SI8 A;  1NKC A;  2KHQ A;  4P4P A;  5ALW A;  5KG4 A;  1TK5 A;  5A0L A;  3WK5 A;  1GO3 F;  3NRW A;  2WAQ F;  2R18 A;  1NNL A;  4AYB F;  4ZOH C;  2ZUB A;  4EZ6 A;  3ZD9 A;  5J0T A;  4NLC A;  4C8N A;  2E1F A;  5KFX A;  4F93 B;  5IIN A;  3UPQ A;  2BDP A;  4F4W A;  2F3N A;  3PX0 A;  5J2F A;  1SB3 C;  3KKA A;  2F1I A;  1D9D A;  2E3T A;  2LKY A;  4M47 A;  3PR4 A;  2KZ3 A;  4I2D A;  5J8Y A;  1RYR A;  4JWM A;  3WU2 U;  2H5X A;  1RZT A;  5KFR A;  1K1S A;  5ALM A;  5III A;  2K4P A;  2KP7 A;  4EYI B;  2HHW A;  3H0M B;  1QSL A;  5ALU A;  5DDY A;  4UB3 A;  1J2N A;  4Y2U A;  1TAU A;  4UQG A;  1PVQ A;  8ICN A;  4TUP A;  2AH5 A;  3CYM A;  4O3S A;  5J2D A;  3NRZ A;  1L3U A;  3AEV A;  3FAH A;  1X6J A;  4Q43 A;  2H3Q A; 
#chains in the Genus database with same CATH homology
 3GZF A;  3RF9 A;  2E1E A;  4FE3 A;  3L3F X;  2CPR A;  3IP4 B;  2ZIW B;  3E0F A;  2KNJ A;  3N7P D;  5CRX A;  3CRX A;  2G08 A;  2ZIU A;  2DGZ A;  2ZIX B;  4FZL A;  4WJ3 B;  2G06 A;  4QJF B;  4P0P B;  4CGZ A;  2K8A A;  2OXO A;  2XID A;  2XVT A;  4KX3 A;  3K1Z A;  1HEK A;  1URJ A;  3F5A A;  3O0F A;  1NZB A;  4IC9 A;  2KJ5 A;  2RRD A;  1MA7 A;  2HOI A;  4P0Q B;  2WAQ C;  1DRG A;  4OJ6 A;  1ECW A;  2WB1 F;  2ZG6 A;  3KFU F;  5HR7 A;  2MRL A;  3OPX A;  2F77 X;  2H3F A;  2GOL A;  2MA1 A;  4FZM A;  4AYB C;  2JHD A;  2JGA A;  1Z19 A;  2PMZ F;  2HOF A;  3C28 A;  4C0Z A;  3DEE A;  4QIW C;  5C0Y A;  5KL1 B;  2W03 A;  3D2Q A;  2F2A B;  4BX9 C;  4OO1 J;  3F2C A;  2YX8 A;  2ZXI A;  3D2S A;  3T79 A;  2ZXH A;  2KIW A;  2Y0S C;  2KHQ A;  2DF4 B;  3ONN A;  4CDG A;  2VKQ A;  4QNL A;  2KOB A;  3ICX A;  2G09 A;  4OJL A;  3IG8 A;  1OUQ A;  1D8B A;  5A0L A;  2E5S A;  3RFA A;  1SZH A;  2YB1 A;  1GO3 F;  2G5I B;  3NRW A;  2WAQ F;  4PL2 A;  2KD1 A;  2N1R A;  1YT3 A;  2G0A A;  2R18 A;  1ZQ1 C;  2ZIW A;  3N7R C;  1T94 A;  2H3Z A;  2K8B B;  2ZIU B;  4AYB F;  2K8C B;  1Z1B A;  2DQN B;  2ZIX A;  4A8E A;  2HMX A;  4NWI A;  2ZIV A;  3SAH A;  4P0P A;  4ICA A;  4BJQ A;  4QIW F;  2NV3 A;  4NLC A;  2KV2 A;  2LHT A;  4P0Q A;  2LBO A;  2E1F A;  3M7D A;  1PVR A;  2XIC A;  3PSI A;  1CRX A;  3ALR A;  3PZP A;  2GH1 A;  3NUQ A;  4NLB A;  4OJP A;  1XO0 A;  2Y0S F;  1UPH A;  2HBL A;  2KJ8 A;  2RHF A;  3C29 A;  2F76 X;  2JH7 A;  1ED1 A;  3CP8 A;  3D2N A;  3KZX A;  3PSP A;  1WUD A;  3PST A;  3N7S C;  5T14 A;  2G5H B;  2KEY A;  2HBK A;  2LKY A;  1XNS A;  2OM6 A;  4PL1 A;  2XI9 A;  2CN1 A;  4U6P A;  3F2D A;  3SQI A;  2VJ4 A;  2Q4T A;  2KKP A;  3HKZ C;  4CRX A;  4JMU A;  2KKV A;  1Q3V A;  3SAF A;  2JH1 A;  4BUG A;  3SMV A;  2K89 A;  3IG5 A;  2W7O A;  4U7C A;  3VC8 A;  3VCB A;  4GFJ A;  4O3M A;  3M6Z A;  2HOQ A;  4ACO A;  3AQF A;  4NV0 A;  4OJ5 A;  3LVV A;  3MGV A;  3IN5 A;  4KMO B;  1P7D A;  3F2B A;  3LYS A;  2OH2 A;  2A3V A;  2KVC A;  1IIP A;  2K4I A;  3GU3 A;  2CRX A;  3H0M B;  2HBM A;  2K4E A;  2G07 A;  1Q3U A;  2KHV A;  1KBU A;  2W04 A;  3PSF A;  3LVW A;  2LYA A;  2Z7J A;  1F44 A;  1A0P A;  1HIW A;  2ZIV B;  2F8L A;  2YB4 A;  2VJ5 A;  4FZN A;  5KL8 B;  1PVQ A;  3AL0 B;  1TAM A;  3H0R B;  2RP5 A;  3F5E A;  3HKZ F;  2W7P A;  2M0N A;  2JMG A;  3AQE A;  2HBJ A;  2VIX A;  3H0L B;  1PVP A;  2WB1 C;  3CYM A;  2BDU A;  4OJO A;  5HR6 A;  2KIC A;  2LYB A;  2H3I A;  2OYY A;  3M6K A;  1A6S A;  2KJ9 A;  3SAG A;  2K4H A;  1L6N A;  2PMZ C;  3F53 A;  2H3Q A;  4KX5 A;  2D6F C;  2H3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...