2K8CB

Solution structure of plaa family ubiquitin binding domain (pfuc) trans isomer in complex with ubiquitin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
b'ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k8cB00
2K8AA 3L3FX 2K8BB 2K89A 3PSPA 3PSTA 2K8CB
chains in the Genus database with same CATH superfamily
4RNNA 3HKZF 3ZDEA 2FMQA 1QLNA 1FEZA 1KEJA 3UM9A 4O5EA 5AKYA 3GZFA 2F44A 2KVSA 1XC9A 4DWIA 4I2IA 2FI1A 4EYIB 2OYYA 4KLUA 1N62A 2LMRA 3N28A 3M6ZA 1S0MA 2E8OA 2M9NA 3BQ7A 3RB0A 3T5HA 3ZDCA 3FYHA 1NK6A 5CB1A 2J6SA 3GIKA 3JPQA 1HUOA 4GLXA 2ZJAA 2PMZF 4UBCA 3ISCA 2H3QA 1MQ2A 3RAQA 2HHXA 5DBAA 3QX7A 1NK4A 4KLDA 3PMLA 1KFTA 3MC1A 2EAMA 2FLPA 5J0TA 3MGVA 4QZFA 4ED2A 4ZH4A 4C4SA 2JZBB 2Y0SC 4RQ3A 4UB3A 3QE9Y 2ZG6A 4GIBA 2HCFA 1RG6A 5J0WA 1ZRMA 2A19A 5ALQA 1QSSA 1OW5A 4DQRA 4DFPA 2I1QA 2BCSA 1ZQHA 2BPGA 2HSZA 2HHVA 5KFHA 2KEYA 9ICTA 4B9MA 2W9AA 4HAIA 4J9KA 2XICA 2ZUCA 5DDMA 5CA7A 4Y2VA 1COKA 3EWAA 2Q4TA 2F1JA 5IILA 1CI4A 4YVZA 2FE9A 5ALNA 2HHSA 5KFZA 3PSPA 7ICQA 2QB0A 4K4IA 5J2BA 4PZNA 4P0PA 2F8LA 1NJZA 1BNPA 3QEBZ 5ALWA 2DL0A 2WFAA 1HJPA 1NZPA 4QW8A 4I2BA 2R8HA 3WKCA 3AU2A 3QZ7A 3MFIA 4MEXA 8ICUA 8ICZA 4GC6A 3Q8PB 5KT3A 5DQIA 4C8MA 2YX8A 4ELTA 3V6KA 2JEJA 3MABA 4I29A 4RU9A 5EE1A 2JMGA 1BPDA 3PNCA 3RR7A 3M6KA 8ICTA 1FIQA 1CRXA 9ICCA 3KZIU 5HHIA 4R8UB 2KICA 3JPPA 2WHEA 4ED6A 5KFAA 5KFLA 3AU6A 1DGSA 2C2EA 1YT3A 2ISPA 4C8OA 2DWQA 2DFLA 5AK5A 2L5YA 7ICHA 1JXLA 4NXZA 1WWUA 1F0MA 1TE2A 2KFNA 5AKGA 3AQFA 2WAQF 1V9PA 4I27A 4UAWA 4I2JA 8ICMA 4P4PA 5IIJA 3RFAA 2UVVA 3H4DA 1XO0A 1Z00A 2FPKA 2WTFA 3ZI4A 2UVWA 4NV0A 2D8CA 1S0NA 2E1FA 1IXRA 5G5HA 2G06A 3UXPA 1URJA 1SKRA 4M04A 4E0DA 3RJKA 3SEIA 1ZYQA 5DB8A 5CJ7A 1SXDA 4U7CA 9ICLA 5KG7A 3TFSA 4USAA 3V72A 2KN7A 4J9OA 1T3QA 1BNOA 1S0OA 2BPFA 4O3RA 5IIOA 3UQ0A 4J9RA 5KFVA 3ISBA 1ZQMA 9ICRA 1QSLA 2YY6A 2K8CB 3M9OB 3FM9A 1RQLA 5KTQA 5KFGA 4EX7A 3NS1A 4YCXA 5J8YA 2IHMA 5ALLA 4EZ9A 2YN4A 1D9FA 3TACB 2RP5A 1PVRA 3SR6A 1ZD5A 4DQSA 2MA1A 1SV4A 5KFCA 1HEKA 4R63A 2JXJA 3PV8A 3IV6A 2F1IA 2KG5A 1ZQLA 4ECVA 3H8MA 3PZPA 5BOMA 2XC9A 2BZFA 5AIAA 1S5LU 1U48A 2OH2A 5JU5A 4DOAA 3AUOA 5KFQA 7ICTA 1SWVA 2EAPA 1SV0C 1L7NA 5DG9A 2VANA 4US9A 3RAXA 4JUZA 2C22A 9ICBA 1U9LA 2NO5A 3CP8A 1J97A 5L1MA 1NZBA 1D8BA 4RT3A 4DCCA 1J2NA 4DSKA 3D6JA 5D46A 2NRWA 4RQ7A 5DGBA 4KLSA 4C7ZA 2R18A 2YB4A 5GTHU 1COOA 4UW9A 4GXIA 2K4HA 3RRHA 1L8OA 7ICLA 1ZD4A 2K4EA 4UARA 4M9LA 2EANA 8ICRA 4IQTA 8ICCA 1WWVA 3RJHA 4ECQA 4Y2TA 3RB4A 1L3SA 5DB7A 5JTIA 3UMBA 2DPIA 4C4TA 1ZQXA 5DG8A 9ICXA 4C80A 4UAYA 3GU3A 5DDYA 1ZQEA 3WKBA 2ZUDA 5ALUA 5J2HA 4DQIA 4NLBA 4F4KA 2K8BB 5KNIA 1IV8A 1QCKA 3GIJA 1NKCA 4BXOA 3F2BA 2I6XA 2HHUA 4PGQA 2BHNA 4YR0A 3PX4A 3RJJA 5J2JA 1O08A 1ZQOA 5AKXA 2WB1C 3F2CA 2IOFA 3GFKB 4P0QB 5EE9A 4O3OA 1S8OA 1ZQYA 1SXEA 4OJLA 4KLHA 1N5XA 2IOHA 4FZNA 5KT5A 1YZ6A 2HDOA 2ZIVB 2EZYA 4PHEA 4AYBC 2BQUA 3QXGA 2ISOA 4OJPA 3V6JA 4DQPA 4ECSA 2W9CA 1IM4A 4J9NA 1RQNA 2V9WA 3KKAC 3RBDA 1D8YA 4OD0A 1JXEA 5J2DA 4IC9A 8ICOA 3H4BA 4YMMA 1L7MA 3SMVA 4KX5A 1XNSA 4ED1A 2GWSA 1ZQ1C 3MR5A 1MA7A 4QIWC 9ICFA 4ECYA 5ALTA 5ALVA 1RM6C 3L5KA 3JPNA 4YXMA 2CN1A 2LYAA 3EYZA 3IM1A 2HW3A 4ED8A 1T4GA 2P66A 3I28A 5EOZA 4DL4A 3BQ2A 4XQ8A 4UAVA 4KITB 1F44A 5ALOA 4Q44A 8ICEA 2QLTA 1SKSA 1UA1A 3TADA 4OJOA 4C4RA 1XU4A 3GIMA 4FO6A 1RYSA 3QZ8A 1QSYA 3SZ2A 2XVTA 1S77D 5ALKA 1RDFA 5CWRA 4QZEA 4EBDA 5L9XA 3PW2A 2ZIXB 3MDCA 3AL0B 8ICQA 4O0IA 1RPLA 4RQ1A 3WK9A 3G6XA 2LM1A 1UA0A 1U47A 4O9MA 1SZPA 3ORYA 9ICVA 7ICSA 2ODGA 4Y2PA 2CRXA 3G6VA 3K4GA 2VA8A 3TQ1A 4DSIA 2K8AA 4DOBA 1RZTA 1L3VA 1N2XA 3B0YA 5G5GA 4B9LA 2AQ0A 5KT6A 2EQYA 2CXYA 7ICJA 1PK1A 3HKZC 3LVVA 3Q8SB 2RDIA 1BGXT 3EUB2 2IMWP 1WCLA 4DL6A 1MN8A 4I2CA 4TUPA 1Z3EB 3UXOA 3F2DA 4DSJA 3V7JA 1TAUA 3PW0A 2JV3A 5ALGA 2PMZC 1Z1BA 3WU2U 1L6NA 2ZIWA 1S10A 4ECZA 1ZQNA 2IBKA 4DL2A 3AQEA 4ECXA 2VJ5A 2XY5A 1PUZA 3AM9A 4PGYA 7ICKA 4B6JA 4UATA 1X9XA 2ZIUA 4LZGA 3RH6A 1ZQUA 1UCVA 1DK3A 3PO5A 3ED5A 4B9NA 4I2DA 7ICVA 3QUQA 2MUTA 1L7PA 2BPCA 2WF8A 3N7PD 1LB2B 4NL9A 1UT8A 2OCEA 4TQSA 3TKAA 4P4MA 5IIIA 3OTQA 4YFKA 1UPHA 4BUGA 1HIWA 2KVCA 2KMDA 1NNLA 2F77X 8ICKA 2A1AA 5DLGA 1LV5A 3GILA 4DFMA 1RYUA 3RJFA 1Y88A 4YG2A 1A77A 3LWLA 1CEZA 2B6GA 2JEGA 5DQGA 1S76D 2PFOA 3ICXA 5KFPA 2ZJ8A 4MEYA 4M9NA 4TUQA 2ES6A 5TISU 4DFDA 2HI0A 2HOIA 2KJ5A 4F5QA 1SIJA 4F8RA 7ICUA 3M1YA 1L3UA 2PXIA 1BPBA 1FFVA 5AHXA 2D6FC 4M9GA 5KFDA 5L1KA 1KKXA 2NYVA 1NJXA 1T3NA 3KD3A 1X9WA 2C28A 4MF8A 2A1JA 3BZKA 3BDPA 5J0PA 4EEYA 4M47A 5CHGA 2HBJA 3IDWA 5C0YA 1ZQZA 1K1QA 5HHHA 4LJXA 4QWDA 1L8LA 5AIBA 1BPEA 4KLLA 5AK4A 2ASLA 2DKXA 2F1HA 2FJ6A 1LKYA 5ALEA 1ZQKA 4ED3A 2G08A 1K1SA 3MGIA 2K4PA 3Q8KA 1ZQVA 2J6TA 1LVHA 1ZD3A 3PSIA 1NK8A 4NM1A 1Z19A 2KNJA 3DDHA 3Q8QB 3EW9A 5DQHA 4CDGA 4QZCA 3NVYA 3PW5A 4IRKA 1TKDA 3OJSA 4Z6FA 2ZTDA 7ICFA 2W9CB 5KL8B 2W3RA 3TANA 2WAQC 1OUQA 2KV2A 2KZZA 1ZETA 3E58A 1TK8A 3ONNA 2W55A 2LKYA 1U49A 2LPEA 2Z7JA 3KOOA 3RJGA 2XGQA 3ETLA 1KQQA 2NRVA 2W04A 1A6SA 3NRWA 5AKEA 2QARB 4BGDA 4P4OA 5HNKA 4KLJA 1N61A 4UB8U 2ALZA 3LDAA 3T5JA 4CF3A 4Z6DA 1ED1A 1Z4NA 3ZDDA 5AICA 5ALMA 4Q43A 3BQTA 3GV7B 2FPLA 4Y2YA 4BDPA 1Q46A 1ZD2P 3RBEA 2EH9A 4PGXA 3GDXA 3A0BU 1ZQRA 5KG6A 4IQWA 3QUCA 2EDUA 2DQNB 4QZ9A 3TFRA 3H0LB 3NVWA 2JEIA 3H40A 4KLMA 5IIKA 5GTIU 5DBCA 2AXTU 5J2EA 2BGWA 5AI4A 1DXSA 4ECRA 4MF2A 4J03A 4Z6EA 2F2AB 5B66U 4PH5A 5HMMA 4J9MA 1B4FA 3VC8A 4Y2SA 2XCPA 2O6KA 7ICGA 5CEHA 4U6PA 5DB6A 3H8WA 5HR6A 4R66A 4RNOA 3C5GA 3ZDBA 4F5PA 2HHTA 1JMSA 3GV8B 1X42A 4GFJA 2W9BB 2KD1A 3PR5B 4EBEA 1X6JA 4YQWA 3N7RC 1BPXA 2D3DA 4F91B 3M9MB 4A8EA 2V4RA 3T5KA 3SAHA 1C20A 1KBUA 4UB2A 2KSOA 1X2IA 1NJWA 1ZQCA 2E3TA 2Q0ZX 3H8JA 4M9HA 3DEEA 1J2MA 5EWGA 2RHFA 4B9VA 3C1ZA 4DL7A 5J0OA 4RUCA 4IQVA 3KTQA 4F93B 1KSPA 4BWJA 5KFRA 1QQ7A 2NO4A 2R8JA 4KN4A 2W8LA 5AM2A 1B22A 7ICMA 5DG7A 2ATLA 3H7IA 3HJEA 3SENA 2B21A 5J0SA 2VIXA 4F5RA 3H0MB 3THVA 3FDSA 5KFFA 5ALPA 3KBBA 3C23A 4M2YA 7ICEA 3LVWA 2E5SA 2WF7A 1QH9A 1TK0A 1VDVA 4MFAA 3UMGA 3PMNA 3TAQA 1NJYA 2VA3A 2AGQA 5J2CA 3C29A 4I28A 3UMCA 2KZMA 3O0FA 4MFFA 1T8EA 1Q8KA 3L3FX 4EELA 4F3OA 1IIPA 1UT5A 5AK3A 4JV0A 4Z6CA 5J2IA 3OGUA 5ALIA 2OEHA 3H8SA 3UQ2A 5ALYA 3MGHA 3C2LA 5E79U 3UXNA 4Q8FA 2K89A 3AMZA 2BCQA 3U26A 1A76A 1P7DA 4EZ6A 2RRDA 4Y2QA 4NLZA 3SV3A 4M0AA 1SGGA 5KG3A 1ZXIA 2ZXIA 2DGZA 3HPOA 5KG5A 3MR6A 4OCZA 3ZD9A 5AI9A 1K5OA 2RQ5A 4MHVA 2HHQA 4Y2RA 3KHGA 4BJQA 4JV2A 1KRPA 2H3ZA 2OWOA 2E1EA 5KFMA 4FZLA 5KFIA 3T3FA 2PFPA 2XY6A 2W8KA 1TAQA 3PW7A 4BX9C 3QU9A 1OXJA 4RPXA 4UB6U 3IRUA 3D2SA 5IIMA 4DF4A 1N48A 3NVZA 2E8MA 2N1RA 4KMUA 3HX0A 1NK9A 4IRCA 3Q8LA 4Y2XA 5ALHA 4XUSA 9ICMA 4DSEA 4OJ6A 4IR1A 2A1JB 2OHFA 3KZXA 3MR3A 2BQ3A 4DS5A 4DOCA 2ZXHA 3UPQA 3IG8A 3S6JA 3TARA 2QB0B 4EBCA 4EENA 4P0PB 4DSLA 2R8IA 4F2SA 3NGDA 5JUMA 4KLIA 5KG2A 2CPRA 5AKZA 1FO4A 3IG5A 4WJ3B 1GO3F 2EAOA 3RH5A 3RF9A 1ZQWA 3D2NA 2AGPA 2YMQA 4KLTA 2KJ9A 2NRXA 2OM6A 4UAUA 1ZQDA 4O3QA 5KFYA 4K4HA 1NOMA 2W11A 5F9LA 4PL1A 5D4BA 5BPCA 4Y2UA 3PX0A 2BCRA 1N56A 4R8UA 4KLGA 1SL0A 3BS5A 5KFBA 2DF4B 5J2AA 3CRXA 3V7LA 1KDHA 1B43A 4F50A 5FP0A 5J0QA 5AM0A 9ICHA 4FZMA 3RJIA 3F5AA 2GOLA 5L1IA 9ICSA 3C21A 9ICKA 1L3TA 2PI4A 2ZTEA 4UQGA 2P35A 4I2HA 4DL5A 2YQEA 5ALZA 2AHOB 1ZQSA 4PL2A 3CNHA 4QNLA 4M6WA 3QNMA 1SKWA 4DQQA 4KLEA 2H3FA 2ASDA 2PFNA 1DK2A 5ALDA 3WKEA 5EE0A 3AN1A 4KLOA 1RXVA 1PZNA 1NI3A 3V7KA 2BDUA 4O3SA 3ISDA 4MFCA 5J2GA 1Z4OA 3V6HA 2WF6A 9ICIA 2IOFK 4XA5A 2G07A 2XIDA 1Z00B 2HOQA 1ZQGA 4LVSA 4KMOB 4KX3A 3C2MA 2C2RA 4NLNA 2KP7A 3N4MB 4CF4A 4ED7A 4OJ5A 5T14A 2GO7A 2QB1A 4RQ2A 4B9UA 4QZIA 5L1LA 4CRXA 3WK7A 4US8A 4PPXA 2F76X 4I2AA 2FDRA 1Q3UA 4EX6A 1PVPA 3WK6A 1SZHA 5J2KA 5KG0A 1JRPA 5J8YC 1BVSA 1Q3VA 2KIVA 3WK5A 3WKAA 2H3VA 2XO7A 4FBUA 4G9BA 1TV9A 2JRZA 4C8LA 1SB3C 5KG1A 5AI8A 1KFSA 1FFUA 2YB1A 3QU7A 3QUTA 2KK0A 4RNMA 1TAMA 4RQNA 1ZQIA 4YP3A 3RRGA 5J0UA 5HP4A 2KJ8A 4CNQA 2HVHA 2HOFA 4DFKA 4RQ4A 3RJEA 5HMLA 3GQCA 5AKLA 1XS9D 4B9SA 2LYBA 1A0PA 1UQVA 4J9QA 2JHDA 3M8RA 5KFKA 3FC4A 3NVVA 4F4ZA 5AM3A 5F3XB 2LBOA 2B0CA 4DSFA 4QZ8A 2JH7A 5HR7A 1BPZA 9ICGA 3LYSA 2YMPA 4IQUA 2V4QA 2FMSA 3HWTA 3JPSA 1N63A 4C8NA 3H0RB 4YMNA 1QQ5A 8ICNA 3SV4A 2KIWA 1SV0A 8ICYA 1ZJMA 3MDAA 5K4LA 1ZOLA 4F4WA 3QU4A 2W03A 1VJ5A 5AKKA 3HILA 2K60A 4IR9A 2XI9A 2LYHA 1D9DA 1NKEA 2Y9UA 2HMXA 3PO4A 2DPJA 2LM4A 1XSNA 3SD7A 2VJ4A 4YN4A 5CP2A 8ICIA 2MAXA 3MR2A 3B9JA 3JPRA 4DFJA 3ETRA 1S9FA 3RB6A 1NKBA 1U4BA 3OSPA 3ZD8A 3TI0A 4Q8EA 3SYZA 3M9NB 3QUBA 4NJ8A 4UB1A 2ZUBA 2FLNA 4P0QA 4UASA 8ICPA 2DKZA 4KLFA 3T79A 1CUKA 1XSLA 5ALSA 2IHNA 3JPTA 1JALA 4BXOB 4FS1A 3FAHA 2Y0SF 1C7YA 5AM5A 3C28A 7ICRA 3AEVA 4O5CA 2EZXA 4YXJA 4PHPA 2BR0A 2ZIVA 3PSFA 4YMOA 4QZDA 4RQ6A 5AKIA 1PK3A 5AI6A 5DKWA 2ZTCA 2R8GA 1MSWD 5EWEA 4XRHA 3SQIA 2Y9TA 3GV5B 3K1RB 1ZQJA 4DLEA 2AQ4A 2KTQA 4BWMA 4QZHA 4ECTA 2JEFA 7ICPA 3BJYA 1XWLA 4ACOA 4O3NA 8ICBA 3C1YA 1TVAA 3KKAA 4DO9A 2H5XA 2G5HB 4ECWA 8ICAA 3F5EA 4UAZA 1T94A 4TQRA 5DB9A 3BS5B 3QEAZ 3TADC 4QZGA 3F53A 2VA2A 3TAPA 4FE3A 4GXKA 2GH1A 3PSTA 4C7YA 2PI5A 2W9MA 4LZDA 1H38A 1WCNA 3BZCA 4FBTA 2ZJ5A 4I2EA 3RTVA 1NK0A 4JK1A 1V97A 2G09A 1L5UA 2ZIXA 1KW4A 5KAIU 2LI6A 4G3IA 5CRXA 3MBYA 4DF8A 5CR0A 2MRLA 4PHAA 1KN5A 5KFSA 3WKDA 1N5WA 3HP6A 4NLGA 1HUZA 4P2HA 5KFNA 1X6IA 4FFDA 4C0ZA 2OXOA 3I76A 5KT2A 4IL6U 3IP4B 4QWCA 2JGAA 4M6WB 2ASJA 2KKVA 3GIIA 1WYGA 4DLGA 3EZ5A 4DS4A 2XY7A 2W7OA 2BDPA 1X9MA 1JN3A 1TFRA 2JH1A 2ESEA 4ED0A 1ZQQA 1U45A 1X9SA 4F4XA 8ICLA 3KFUF 5EE3A 4JWNA 3SAFA 4Q45A 1SWWA 1VLBA 3SAGA 9ICJA 2LHTA 4PZOA 1ZRNA 3N7SC 4DEZA 5KFEA 4NY8A 2NRZA 5AKJA 1ZQPA 1S97A 4YD2A 3RB3A 3QYPA 5J29A 4I2FA 1PK1B 4KLQA 3IHQB 5KT7A 3RR8A 2DUYA 2W7PA 1B0XA 4YD1A 3HRDD 2IA6A 4UB5A 2E8PA 1ZQBA 2BCVA 4JMUA 5F9NA 3NUQA 4NLKA 9ICEA 5DGAA 2KE7A 4YR3A 2P6RA 9ICAA 1V38A 4YR2A 2PKEA 4KTQA 2P6UA 4TURA 3WK4A 1N60A 5A0LA 8ICHA 4IS7A 3PY8A 3J81j 2ZIWB 4NL9C 1NK7A 3ZDAA 4RZRA 4F71A 5L1JA 3BQ0A 4O5KA 4ZOHC 2I9GA 1QQ6A 4NWIA 5IINA 2RDJA 8ICSA 4F92B 5KT4A 2G0AA 4F72A 1YZ7A 2ZIUB 5C5JA 2NV3A 4R65A 9ICOA 1ZQFA 2MUTB 4J9LA 5KAFU 3A0HU 4ICAA 4F5OA 4ELVA 1JUDA 1ZQAA 1DGJA 4RPZA 3DV9A 4GXJA 1JX4A 3BS7A 5KFOA 3KHHA 1UHUA 4J9SA 2JR5A 4UB4A 3LWMA 3KHRA 2F8KA 4J9PA 2JZBA 1F5SA 2RLTA 3C5FA 4HYKA 3OPXA 8ICJA 5AM4A 1V85A 3D2QA 4ELUA 3B0XA 3QU2A 3NTUA 3PX6A 2R8KA 3MFHA 2E8NA 2AH5A 2XCAA 4CCHA 1MQ3A 5KG4A 3PW4A 4QZAA 5J0XA 1PVQA 2UVRA 2YMLA 1ZJNA 5J2FA 5J0YA 3OJUA 3ALRA 1JIHA 1X66A 4O3PA 5AM1A 4TUSA 3NRZA 4R64A 3OHBA 1L7OA 5ALXA 1AROP 2PFQA 4NM2A 5AKHA 1WG8A 3EPGA 4DL3A 1JROA 1DRGA 3M8SA 7ICOA 2KFZA 2FPMA 4F5NA 5TZVA 3K75D 4M9JA 4OO1J 1O03A 3L4PA 2G5IB 5AI5A 4FS2A 2K4IA 5KFWA 4JV1A 4X5VA 2MU2A 4CE6A 1T7PA 4QZBA 2HHWA 1KFDA 4RPYA 3SI8A 3Q8MA 5KFTA 1LKYB 1BPYA 9ICNA 3LK9A 3PVXA 2J6UA 9ICWA 8ICFA 2KKPA 4RUAA 5ALFA 2AGOA 8ICGA 5DBBA 2I5HA 4Y2JA 3RH4A 1WUDA 5D49A 4C8KA 2DBYA 5ALJA 4F2RA 2W3SA 3N97B 1ZQTA 9ICQA 5EWFA 9ICUA 3BQ1A 5H2FU 7ICIA 4PJ0U 2WB1F 4KN7A 4RT2A 2FLLA 2NRTA 4O3MA 2W54A 5KFUA 4JB3A 4PHDA 5DLFA 2BCUA 3IN5A 3PR4A 4B9TA 1M6YA 2KHQA 2QARA 3M7DA 4EEKA 3JPOA 4NLCA 5KL1B 4JWMA 4UBBA 4IRDA 4AYBF 5AI0A 5JRTA 2W43A 1MC8A 4QWBA 2YMMA 4RQ8A 3OSNA 1Z1VA 3C2KA 4RQ5A 2YTUA 1EXNA 3G6YA 1XO1A 8ICWA 2WF5A 5ALRA 2QKQA 7ICNA 5B5EU 1NK5A 4RQ0A 3HT3A 3EPIA 1D8LA 3Q8RB 8ICVA 2C2DA 2AU0A 4QIWF 2A3VA 3I1YA 1KL9A 2VKQA 4RQMA 1XSPA 2KOBA 3E0FA 1TK5A 1SL1A 1QTMA 3HW8A 1KLNA 2MSNA 2H3IA 4K4GA 1SL2A 4GC7A 5BOLA 4QW9A 2HBMA 3CYMA 2FMPA 4CGZA 4I2GA 2BKEA 1RYRA 2BQRA 3CW2C 2UVUA 1RXWA 3WK8A 2GLEA 5KFXA 1S0VA 3R9KA 4ECUA 4QWAA 2Y1JA 3T5LA 8ICXA 2W9BA 3K1ZA 2AJQA 3OHAA 1X40A 4QWEA 1ECWA 9ICPA 4CF5A 3NASA 1IG6A 4AP9A 2HVIA 3KHLA 2XGPA 1AQ6A 4EYHB 2F3NA 1KTQA 3QU5A 2HBLA 5J0RA 1JI7A 2KZ3A 2KSOB 5KFJA 5AK6A 2M0NA 2WF9A 4F4YA 4QJFB 3E2EA 3VCBA 2HBKA 2Y1IA 2EZZA 2KHVA 1DOQA
chains in the Genus database with same CATH topology
2W7PA 3KZXA 3H0MB 2XIDA 3CP8A 2F8LA 3HKZF 4ACOA 4P0PA 2HOQA 1ZQ1C 1NZBA 1URJA 4KMOB 1D8BA 2ZXHA 3H0RB 3GZFA 3F2DA 3IG8A 4JMUA 1MA7A 4KX3A 4QIWC 1ED1A 2KIWA 3NUQA 1XNSA 3LVWA 4P0PB 2E5SA 2G5HB 2OYYA 2PMZC 1Z1BA 2R18A 3F5EA 2YB4A 1L6NA 2ZIWA 1T94A 3M6ZA 4OJ5A 5T14A 4U7CA 2CPRA 3AQEA 3IG5A 1DRGA 2W03A 5A0LA 4WJ3B 2K4HA 2VJ5A 3C29A 1GO3F 2CN1A 2LYAA 4CRXA 4QIWF 2A3VA 3RF9A 2XI9A 3O0FA 2ZIWB 2VKQA 2F76X 4OO1J 2HBJA 3D2NA 3F53A 2K4EA 2YX8A 2G5IB 2KOBA 2PMZF 3E0FA 2GH1A 4FE3A 3L3FX 2DQNB 2K4IA 2KJ9A 2OM6A 2H3QA 2HMXA 2ZIUA 1Q3UA 5C0YA 3PSTA 4NWIA 3H0LB 1PVPA 2H3IA 1IIPA 1SZHA 2JMGA 4PL1A 2HBMA 1F44A 3CYMA 2G0AA 2VJ4A 3M6KA 2ZIUB 4CGZA 1Q3VA 2NV3A 1CRXA 2F2AB 2DF4B 3N7PD 2G08A 4OJOA 2G09A 3GU3A 3CRXA 2ZIXA 2H3VA 2K8CB 3VC8A 2KICA 5CRXA 2K89A 2MRLA 2XVTA 3MGVA 1P7DA 2YB1A 2RRDA 4ICAA 4U6PA 4NLBA 2Y0SC 2ZIXB 3PSIA 3AL0B 2K8BB 4FZMA 4C0ZA 5HR6A 2OXOA 2KKPA 1UPHA 4BUGA 2KNJA 1HIWA 1TAMA 2DGZA 2ZXIA 3IP4B 1Z19A 2JGAA 3F2BA 2RP5A 3F5AA 3K1ZA 4P0QA 2KVCA 2GOLA 1WUDA 4CDGA 1PVRA 2F77X 2ZG6A 2KKVA 1ECWA 3T79A 4GFJA 2KJ8A 2MA1A 2HOFA 2KD1A 2WB1C 2W7OA 3F2CA 2Y0SF 1HEKA 3C28A 1YT3A 3N7RC 4P0QB 2JH1A 5KL8B 2WAQC 4OJLA 2KV2A 1OUQA 2ZIVA 3PSFA 4A8EA 4PL2A 3OPXA 3SAHA 2CRXA 3D2QA 3ONNA 4QNLA 4BJQA 1KBUA 2KEYA 2H3ZA 4FZNA 2E1EA 3SAFA 4FZLA 2K8AA 3PZPA 3ICXA 3KFUF 3DEEA 2LKYA 2WB1F 2H3FA 2HBLA 2RHFA 2LYBA 2ZIVB 4BX9C 3SAGA 3SQIA 4AYBC 4O3MA 2OH2A 1A0PA 2XICA 3AQFA 2LHTA 2WAQF 2Z7JA 3IN5A 4OJPA 2JHDA 3D2SA 2KHQA 3M7DA 3N7SC 2M0NA 3HKZC 2Q4TA 2HOIA 2N1RA 2W04A 2KJ5A 1A6SA 4QJFB 2LBOA 3LVVA 3RFAA 4NLCA 1PVQA 5KL1B 2BDUA 3NRWA 3VCBA 1XO0A 2JH7A 4AYBF 5HR7A 4NV0A 2HBKA 2E1FA 4IC9A 3LYSA 4OJ6A 3PSPA 3ALRA 2KHVA 2VIXA 2D6FC 3SMVA 4KX5A 2G07A 2G06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8A A;  3L3F X;  2K8B B;  2K89 A;  3PSP A;  3PST A;  2K8C B; 
#chains in the Genus database with same CATH topology
 4RNN A;  3HKZ F;  3ZDE A;  2FMQ A;  1QLN A;  1FEZ A;  1KEJ A;  3UM9 A;  4O5E A;  5AKY A;  3GZF A;  2F44 A;  2KVS A;  1XC9 A;  4DWI A;  4I2I A;  2FI1 A;  4EYI B;  2OYY A;  4KLU A;  1N62 A;  2LMR A;  3N28 A;  3M6Z A;  1S0M A;  2E8O A;  2M9N A;  3BQ7 A;  3RB0 A;  3T5H A;  3ZDC A;  3FYH A;  1NK6 A;  5CB1 A;  2J6S A;  3GIK A;  3JPQ A;  1HUO A;  4GLX A;  2ZJA A;  2PMZ F;  4UBC A;  3ISC A;  2H3Q A;  1MQ2 A;  3RAQ A;  2HHX A;  5DBA A;  3QX7 A;  1NK4 A;  4KLD A;  3PML A;  1KFT A;  3MC1 A;  2EAM A;  2FLP A;  5J0T A;  3MGV A;  4QZF A;  4ED2 A;  4ZH4 A;  4C4S A;  2JZB B;  2Y0S C;  4RQ3 A;  4UB3 A;  3QE9 Y;  2ZG6 A;  4GIB A;  2HCF A;  1RG6 A;  5J0W A;  1ZRM A;  2A19 A;  5ALQ A;  1QSS A;  1OW5 A;  4DQR A;  4DFP A;  2I1Q A;  2BCS A;  1ZQH A;  2BPG A;  2HSZ A;  2HHV A;  5KFH A;  2KEY A;  9ICT A;  4B9M A;  2W9A A;  4HAI A;  4J9K A;  2XIC A;  2ZUC A;  5DDM A;  5CA7 A;  4Y2V A;  1COK A;  3EWA A;  2Q4T A;  2F1J A;  5IIL A;  1CI4 A;  4YVZ A;  2FE9 A;  5ALN A;  2HHS A;  5KFZ A;  3PSP A;  7ICQ A;  2QB0 A;  4K4I A;  5J2B A;  4PZN A;  4P0P A;  2F8L A;  1NJZ A;  1BNP A;  3QEB Z;  5ALW A;  2DL0 A;  2WFA A;  1HJP A;  1NZP A;  4QW8 A;  4I2B A;  2R8H A;  3WKC A;  3AU2 A;  3QZ7 A;  3MFI A;  4MEX A;  8ICU A;  8ICZ A;  4GC6 A;  3Q8P B;  5KT3 A;  5DQI A;  4C8M A;  2YX8 A;  4ELT A;  3V6K A;  2JEJ A;  3MAB A;  4I29 A;  4RU9 A;  5EE1 A;  2JMG A;  1BPD A;  3PNC A;  3RR7 A;  3M6K A;  8ICT A;  1FIQ A;  1CRX A;  9ICC A;  3KZI U;  5HHI A;  4R8U B;  2KIC A;  3JPP A;  2WHE A;  4ED6 A;  5KFA A;  5KFL A;  3AU6 A;  1DGS A;  2C2E A;  1YT3 A;  2ISP A;  4C8O A;  2DWQ A;  2DFL A;  5AK5 A;  2L5Y A;  7ICH A;  1JXL A;  4NXZ A;  1WWU A;  1F0M A;  1TE2 A;  2KFN A;  5AKG A;  3AQF A;  2WAQ F;  1V9P A;  4I27 A;  4UAW A;  4I2J A;  8ICM A;  4P4P A;  5IIJ A;  3RFA A;  2UVV A;  3H4D A;  1XO0 A;  1Z00 A;  2FPK A;  2WTF A;  3ZI4 A;  2UVW A;  4NV0 A;  2D8C A;  1S0N A;  2E1F A;  1IXR A;  5G5H A;  2G06 A;  3UXP A;  1URJ A;  1SKR A;  4M04 A;  4E0D A;  3RJK A;  3SEI A;  1ZYQ A;  5DB8 A;  5CJ7 A;  1SXD A;  4U7C A;  9ICL A;  5KG7 A;  3TFS A;  4USA A;  3V72 A;  2KN7 A;  4J9O A;  1T3Q A;  1BNO A;  1S0O A;  2BPF A;  4O3R A;  5IIO A;  3UQ0 A;  4J9R A;  5KFV A;  3ISB A;  1ZQM A;  9ICR A;  1QSL A;  2YY6 A;  2K8C B;  3M9O B;  3FM9 A;  1RQL A;  5KTQ A;  5KFG A;  4EX7 A;  3NS1 A;  4YCX A;  5J8Y A;  2IHM A;  5ALL A;  4EZ9 A;  2YN4 A;  1D9F A;  3TAC B;  2RP5 A;  1PVR A;  3SR6 A;  1ZD5 A;  4DQS A;  2MA1 A;  1SV4 A;  5KFC A;  1HEK A;  4R63 A;  2JXJ A;  3PV8 A;  3IV6 A;  2F1I A;  2KG5 A;  1ZQL A;  4ECV A;  3H8M A;  3PZP A;  5BOM A;  2XC9 A;  2BZF A;  5AIA A;  1S5L U;  1U48 A;  2OH2 A;  5JU5 A;  4DOA A;  3AUO A;  5KFQ A;  7ICT A;  1SWV A;  2EAP A;  1SV0 C;  1L7N A;  5DG9 A;  2VAN A;  4US9 A;  3RAX A;  4JUZ A;  2C22 A;  9ICB A;  1U9L A;  2NO5 A;  3CP8 A;  1J97 A;  5L1M A;  1NZB A;  1D8B A;  4RT3 A;  4DCC A;  1J2N A;  4DSK A;  3D6J A;  5D46 A;  2NRW A;  4RQ7 A;  5DGB A;  4KLS A;  4C7Z A;  2R18 A;  2YB4 A;  5GTH U;  1COO A;  4UW9 A;  4GXI A;  2K4H A;  3RRH A;  1L8O A;  7ICL A;  1ZD4 A;  2K4E A;  4UAR A;  4M9L A;  2EAN A;  8ICR A;  4IQT A;  8ICC A;  1WWV A;  3RJH A;  4ECQ A;  4Y2T A;  3RB4 A;  1L3S A;  5DB7 A;  5JTI A;  3UMB A;  2DPI A;  4C4T A;  1ZQX A;  5DG8 A;  9ICX A;  4C80 A;  4UAY A;  3GU3 A;  5DDY A;  1ZQE A;  3WKB A;  2ZUD A;  5ALU A;  5J2H A;  4DQI A;  4NLB A;  4F4K A;  2K8B B;  5KNI A;  1IV8 A;  1QCK A;  3GIJ A;  1NKC A;  4BXO A;  3F2B A;  2I6X A;  2HHU A;  4PGQ A;  2BHN A;  4YR0 A;  3PX4 A;  3RJJ A;  5J2J A;  1O08 A;  1ZQO A;  5AKX A;  2WB1 C;  3F2C A;  2IOF A;  3GFK B;  4P0Q B;  5EE9 A;  4O3O A;  1S8O A;  1ZQY A;  1SXE A;  4OJL A;  4KLH A;  1N5X A;  2IOH A;  4FZN A;  5KT5 A;  1YZ6 A;  2HDO A;  2ZIV B;  2EZY A;  4PHE A;  4AYB C;  2BQU A;  3QXG A;  2ISO A;  4OJP A;  3V6J A;  4DQP A;  4ECS A;  2W9C A;  1IM4 A;  4J9N A;  1RQN A;  2V9W A;  3KKA C;  3RBD A;  1D8Y A;  4OD0 A;  1JXE A;  5J2D A;  4IC9 A;  8ICO A;  3H4B A;  4YMM A;  1L7M A;  3SMV A;  4KX5 A;  1XNS A;  4ED1 A;  2GWS A;  1ZQ1 C;  3MR5 A;  1MA7 A;  4QIW C;  9ICF A;  4ECY A;  5ALT A;  5ALV A;  1RM6 C;  3L5K A;  3JPN A;  4YXM A;  2CN1 A;  2LYA A;  3EYZ A;  3IM1 A;  2HW3 A;  4ED8 A;  1T4G A;  2P66 A;  3I28 A;  5EOZ A;  4DL4 A;  3BQ2 A;  4XQ8 A;  4UAV A;  4KIT B;  1F44 A;  5ALO A;  4Q44 A;  8ICE A;  2QLT A;  1SKS A;  1UA1 A;  3TAD A;  4OJO A;  4C4R A;  1XU4 A;  3GIM A;  4FO6 A;  1RYS A;  3QZ8 A;  1QSY A;  3SZ2 A;  2XVT A;  1S77 D;  5ALK A;  1RDF A;  5CWR A;  4QZE A;  4EBD A;  5L9X A;  3PW2 A;  2ZIX B;  3MDC A;  3AL0 B;  8ICQ A;  4O0I A;  1RPL A;  4RQ1 A;  3WK9 A;  3G6X A;  2LM1 A;  1UA0 A;  1U47 A;  4O9M A;  1SZP A;  3ORY A;  9ICV A;  7ICS A;  2ODG A;  4Y2P A;  2CRX A;  3G6V A;  3K4G A;  2VA8 A;  3TQ1 A;  4DSI A;  2K8A A;  4DOB A;  1RZT A;  1L3V A;  1N2X A;  3B0Y A;  5G5G A;  4B9L A;  2AQ0 A;  5KT6 A;  2EQY A;  2CXY A;  7ICJ A;  1PK1 A;  3HKZ C;  3LVV A;  3Q8S B;  2RDI A;  1BGX T;  3EUB 2;  2IMW P;  1WCL A;  4DL6 A;  1MN8 A;  4I2C A;  4TUP A;  1Z3E B;  3UXO A;  3F2D A;  4DSJ A;  3V7J A;  1TAU A;  3PW0 A;  2JV3 A;  5ALG A;  2PMZ C;  1Z1B A;  3WU2 U;  1L6N A;  2ZIW A;  1S10 A;  4ECZ A;  1ZQN A;  2IBK A;  4DL2 A;  3AQE A;  4ECX A;  2VJ5 A;  2XY5 A;  1PUZ A;  3AM9 A;  4PGY A;  7ICK A;  4B6J A;  4UAT A;  1X9X A;  2ZIU A;  4LZG A;  3RH6 A;  1ZQU A;  1UCV A;  1DK3 A;  3PO5 A;  3ED5 A;  4B9N A;  4I2D A;  7ICV A;  3QUQ A;  2MUT A;  1L7P A;  2BPC A;  2WF8 A;  3N7P D;  1LB2 B;  4NL9 A;  1UT8 A;  2OCE A;  4TQS A;  3TKA A;  4P4M A;  5III A;  3OTQ A;  4YFK A;  1UPH A;  4BUG A;  1HIW A;  2KVC A;  2KMD A;  1NNL A;  2F77 X;  8ICK A;  2A1A A;  5DLG A;  1LV5 A;  3GIL A;  4DFM A;  1RYU A;  3RJF A;  1Y88 A;  4YG2 A;  1A77 A;  3LWL A;  1CEZ A;  2B6G A;  2JEG A;  5DQG A;  1S76 D;  2PFO A;  3ICX A;  5KFP A;  2ZJ8 A;  4MEY A;  4M9N A;  4TUQ A;  2ES6 A;  5TIS U;  4DFD A;  2HI0 A;  2HOI A;  2KJ5 A;  4F5Q A;  1SIJ A;  4F8R A;  7ICU A;  3M1Y A;  1L3U A;  2PXI A;  1BPB A;  1FFV A;  5AHX A;  2D6F C;  4M9G A;  5KFD A;  5L1K A;  1KKX A;  2NYV A;  1NJX A;  1T3N A;  3KD3 A;  1X9W A;  2C28 A;  4MF8 A;  2A1J A;  3BZK A;  3BDP A;  5J0P A;  4EEY A;  4M47 A;  5CHG A;  2HBJ A;  3IDW A;  5C0Y A;  1ZQZ A;  1K1Q A;  5HHH A;  4LJX A;  4QWD A;  1L8L A;  5AIB A;  1BPE A;  4KLL A;  5AK4 A;  2ASL A;  2DKX A;  2F1H A;  2FJ6 A;  1LKY A;  5ALE A;  1ZQK A;  4ED3 A;  2G08 A;  1K1S A;  3MGI A;  2K4P A;  3Q8K A;  1ZQV A;  2J6T A;  1LVH A;  1ZD3 A;  3PSI A;  1NK8 A;  4NM1 A;  1Z19 A;  2KNJ A;  3DDH A;  3Q8Q B;  3EW9 A;  5DQH A;  4CDG A;  4QZC A;  3NVY A;  3PW5 A;  4IRK A;  1TKD A;  3OJS A;  4Z6F A;  2ZTD A;  7ICF A;  2W9C B;  5KL8 B;  2W3R A;  3TAN A;  2WAQ C;  1OUQ A;  2KV2 A;  2KZZ A;  1ZET A;  3E58 A;  1TK8 A;  3ONN A;  2W55 A;  2LKY A;  1U49 A;  2LPE A;  2Z7J A;  3KOO A;  3RJG A;  2XGQ A;  3ETL A;  1KQQ A;  2NRV A;  2W04 A;  1A6S A;  3NRW A;  5AKE A;  2QAR B;  4BGD A;  4P4O A;  5HNK A;  4KLJ A;  1N61 A;  4UB8 U;  2ALZ A;  3LDA A;  3T5J A;  4CF3 A;  4Z6D A;  1ED1 A;  1Z4N A;  3ZDD A;  5AIC A;  5ALM A;  4Q43 A;  3BQT A;  3GV7 B;  2FPL A;  4Y2Y A;  4BDP A;  1Q46 A;  1ZD2 P;  3RBE A;  2EH9 A;  4PGX A;  3GDX A;  3A0B U;  1ZQR A;  5KG6 A;  4IQW A;  3QUC A;  2EDU A;  2DQN B;  4QZ9 A;  3TFR A;  3H0L B;  3NVW A;  2JEI A;  3H40 A;  4KLM A;  5IIK A;  5GTI U;  5DBC A;  2AXT U;  5J2E A;  2BGW A;  5AI4 A;  1DXS A;  4ECR A;  4MF2 A;  4J03 A;  4Z6E A;  2F2A B;  5B66 U;  4PH5 A;  5HMM A;  4J9M A;  1B4F A;  3VC8 A;  4Y2S A;  2XCP A;  2O6K A;  7ICG A;  5CEH A;  4U6P A;  5DB6 A;  3H8W A;  5HR6 A;  4R66 A;  4RNO A;  3C5G A;  3ZDB A;  4F5P A;  2HHT A;  1JMS A;  3GV8 B;  1X42 A;  4GFJ A;  2W9B B;  2KD1 A;  3PR5 B;  4EBE A;  1X6J A;  4YQW A;  3N7R C;  1BPX A;  2D3D A;  4F91 B;  3M9M B;  4A8E A;  2V4R A;  3T5K A;  3SAH A;  1C20 A;  1KBU A;  4UB2 A;  2KSO A;  1X2I A;  1NJW A;  1ZQC A;  2E3T A;  2Q0Z X;  3H8J A;  4M9H A;  3DEE A;  1J2M A;  5EWG A;  2RHF A;  4B9V A;  3C1Z A;  4DL7 A;  5J0O A;  4RUC A;  4IQV A;  3KTQ A;  4F93 B;  1KSP A;  4BWJ A;  5KFR A;  1QQ7 A;  2NO4 A;  2R8J A;  4KN4 A;  2W8L A;  5AM2 A;  1B22 A;  7ICM A;  5DG7 A;  2ATL A;  3H7I A;  3HJE A;  3SEN A;  2B21 A;  5J0S A;  2VIX A;  4F5R A;  3H0M B;  3THV A;  3FDS A;  5KFF A;  5ALP A;  3KBB A;  3C23 A;  4M2Y A;  7ICE A;  3LVW A;  2E5S A;  2WF7 A;  1QH9 A;  1TK0 A;  1VDV A;  4MFA A;  3UMG A;  3PMN A;  3TAQ A;  1NJY A;  2VA3 A;  2AGQ A;  5J2C A;  3C29 A;  4I28 A;  3UMC A;  2KZM A;  3O0F A;  4MFF A;  1T8E A;  1Q8K A;  3L3F X;  4EEL A;  4F3O A;  1IIP A;  1UT5 A;  5AK3 A;  4JV0 A;  4Z6C A;  5J2I A;  3OGU A;  5ALI A;  2OEH A;  3H8S A;  3UQ2 A;  5ALY A;  3MGH A;  3C2L A;  5E79 U;  3UXN A;  4Q8F A;  2K89 A;  3AMZ A;  2BCQ A;  3U26 A;  1A76 A;  1P7D A;  4EZ6 A;  2RRD A;  4Y2Q A;  4NLZ A;  3SV3 A;  4M0A A;  1SGG A;  5KG3 A;  1ZXI A;  2ZXI A;  2DGZ A;  3HPO A;  5KG5 A;  3MR6 A;  4OCZ A;  3ZD9 A;  5AI9 A;  1K5O A;  2RQ5 A;  4MHV A;  2HHQ A;  4Y2R A;  3KHG A;  4BJQ A;  4JV2 A;  1KRP A;  2H3Z A;  2OWO A;  2E1E A;  5KFM A;  4FZL A;  5KFI A;  3T3F A;  2PFP A;  2XY6 A;  2W8K A;  1TAQ A;  3PW7 A;  4BX9 C;  3QU9 A;  1OXJ A;  4RPX A;  4UB6 U;  3IRU A;  3D2S A;  5IIM A;  4DF4 A;  1N48 A;  3NVZ A;  2E8M A;  2N1R A;  4KMU A;  3HX0 A;  1NK9 A;  4IRC A;  3Q8L A;  4Y2X A;  5ALH A;  4XUS A;  9ICM A;  4DSE A;  4OJ6 A;  4IR1 A;  2A1J B;  2OHF A;  3KZX A;  3MR3 A;  2BQ3 A;  4DS5 A;  4DOC A;  2ZXH A;  3UPQ A;  3IG8 A;  3S6J A;  3TAR A;  2QB0 B;  4EBC A;  4EEN A;  4P0P B;  4DSL A;  2R8I A;  4F2S A;  3NGD A;  5JUM A;  4KLI A;  5KG2 A;  2CPR A;  5AKZ A;  1FO4 A;  3IG5 A;  4WJ3 B;  1GO3 F;  2EAO A;  3RH5 A;  3RF9 A;  1ZQW A;  3D2N A;  2AGP A;  2YMQ A;  4KLT A;  2KJ9 A;  2NRX A;  2OM6 A;  4UAU A;  1ZQD A;  4O3Q A;  5KFY A;  4K4H A;  1NOM A;  2W11 A;  5F9L A;  4PL1 A;  5D4B A;  5BPC A;  4Y2U A;  3PX0 A;  2BCR A;  1N56 A;  4R8U A;  4KLG A;  1SL0 A;  3BS5 A;  5KFB A;  2DF4 B;  5J2A A;  3CRX A;  3V7L A;  1KDH A;  1B43 A;  4F50 A;  5FP0 A;  5J0Q A;  5AM0 A;  9ICH A;  4FZM A;  3RJI A;  3F5A A;  2GOL A;  5L1I A;  9ICS A;  3C21 A;  9ICK A;  1L3T A;  2PI4 A;  2ZTE A;  4UQG A;  2P35 A;  4I2H A;  4DL5 A;  2YQE A;  5ALZ A;  2AHO B;  1ZQS A;  4PL2 A;  3CNH A;  4QNL A;  4M6W A;  3QNM A;  1SKW A;  4DQQ A;  4KLE A;  2H3F A;  2ASD A;  2PFN A;  1DK2 A;  5ALD A;  3WKE A;  5EE0 A;  3AN1 A;  4KLO A;  1RXV A;  1PZN A;  1NI3 A;  3V7K A;  2BDU A;  4O3S A;  3ISD A;  4MFC A;  5J2G A;  1Z4O A;  3V6H A;  2WF6 A;  9ICI A;  2IOF K;  4XA5 A;  2G07 A;  2XID A;  1Z00 B;  2HOQ A;  1ZQG A;  4LVS A;  4KMO B;  4KX3 A;  3C2M A;  2C2R A;  4NLN A;  2KP7 A;  3N4M B;  4CF4 A;  4ED7 A;  4OJ5 A;  5T14 A;  2GO7 A;  2QB1 A;  4RQ2 A;  4B9U A;  4QZI A;  5L1L A;  4CRX A;  3WK7 A;  4US8 A;  4PPX A;  2F76 X;  4I2A A;  2FDR A;  1Q3U A;  4EX6 A;  1PVP A;  3WK6 A;  1SZH A;  5J2K A;  5KG0 A;  1JRP A;  5J8Y C;  1BVS A;  1Q3V A;  2KIV A;  3WK5 A;  3WKA A;  2H3V A;  2XO7 A;  4FBU A;  4G9B A;  1TV9 A;  2JRZ A;  4C8L A;  1SB3 C;  5KG1 A;  5AI8 A;  1KFS A;  1FFU A;  2YB1 A;  3QU7 A;  3QUT A;  2KK0 A;  4RNM A;  1TAM A;  4RQN A;  1ZQI A;  4YP3 A;  3RRG A;  5J0U A;  5HP4 A;  2KJ8 A;  4CNQ A;  2HVH A;  2HOF A;  4DFK A;  4RQ4 A;  3RJE A;  5HML A;  3GQC A;  5AKL A;  1XS9 D;  4B9S A;  2LYB A;  1A0P A;  1UQV A;  4J9Q A;  2JHD A;  3M8R A;  5KFK A;  3FC4 A;  3NVV A;  4F4Z A;  5AM3 A;  5F3X B;  2LBO A;  2B0C A;  4DSF A;  4QZ8 A;  2JH7 A;  5HR7 A;  1BPZ A;  9ICG A;  3LYS A;  2YMP A;  4IQU A;  2V4Q A;  2FMS A;  3HWT A;  3JPS A;  1N63 A;  4C8N A;  3H0R B;  4YMN A;  1QQ5 A;  8ICN A;  3SV4 A;  2KIW A;  1SV0 A;  8ICY A;  1ZJM A;  3MDA A;  5K4L A;  1ZOL A;  4F4W A;  3QU4 A;  2W03 A;  1VJ5 A;  5AKK A;  3HIL A;  2K60 A;  4IR9 A;  2XI9 A;  2LYH A;  1D9D A;  1NKE A;  2Y9U A;  2HMX A;  3PO4 A;  2DPJ A;  2LM4 A;  1XSN A;  3SD7 A;  2VJ4 A;  4YN4 A;  5CP2 A;  8ICI A;  2MAX A;  3MR2 A;  3B9J A;  3JPR A;  4DFJ A;  3ETR A;  1S9F A;  3RB6 A;  1NKB A;  1U4B A;  3OSP A;  3ZD8 A;  3TI0 A;  4Q8E A;  3SYZ A;  3M9N B;  3QUB A;  4NJ8 A;  4UB1 A;  2ZUB A;  2FLN A;  4P0Q A;  4UAS A;  8ICP A;  2DKZ A;  4KLF A;  3T79 A;  1CUK A;  1XSL A;  5ALS A;  2IHN A;  3JPT A;  1JAL A;  4BXO B;  4FS1 A;  3FAH A;  2Y0S F;  1C7Y A;  5AM5 A;  3C28 A;  7ICR A;  3AEV A;  4O5C A;  2EZX A;  4YXJ A;  4PHP A;  2BR0 A;  2ZIV A;  3PSF A;  4YMO A;  4QZD A;  4RQ6 A;  5AKI A;  1PK3 A;  5AI6 A;  5DKW A;  2ZTC A;  2R8G A;  1MSW D;  5EWE A;  4XRH A;  3SQI A;  2Y9T A;  3GV5 B;  3K1R B;  1ZQJ A;  4DLE A;  2AQ4 A;  2KTQ A;  4BWM A;  4QZH A;  4ECT A;  2JEF A;  7ICP A;  3BJY A;  1XWL A;  4ACO A;  4O3N A;  8ICB A;  3C1Y A;  1TVA A;  3KKA A;  4DO9 A;  2H5X A;  2G5H B;  4ECW A;  8ICA A;  3F5E A;  4UAZ A;  1T94 A;  4TQR A;  5DB9 A;  3BS5 B;  3QEA Z;  3TAD C;  4QZG A;  3F53 A;  2VA2 A;  3TAP A;  4FE3 A;  4GXK A;  2GH1 A;  3PST A;  4C7Y A;  2PI5 A;  2W9M A;  4LZD A;  1H38 A;  1WCN A;  3BZC A;  4FBT A;  2ZJ5 A;  4I2E A;  3RTV A;  1NK0 A;  4JK1 A;  1V97 A;  2G09 A;  1L5U A;  2ZIX A;  1KW4 A;  5KAI U;  2LI6 A;  4G3I A;  5CRX A;  3MBY A;  4DF8 A;  5CR0 A;  2MRL A;  4PHA A;  1KN5 A;  5KFS A;  3WKD A;  1N5W A;  3HP6 A;  4NLG A;  1HUZ A;  4P2H A;  5KFN A;  1X6I A;  4FFD A;  4C0Z A;  2OXO A;  3I76 A;  5KT2 A;  4IL6 U;  3IP4 B;  4QWC A;  2JGA A;  4M6W B;  2ASJ A;  2KKV A;  3GII A;  1WYG A;  4DLG A;  3EZ5 A;  4DS4 A;  2XY7 A;  2W7O A;  2BDP A;  1X9M A;  1JN3 A;  1TFR A;  2JH1 A;  2ESE A;  4ED0 A;  1ZQQ A;  1U45 A;  1X9S A;  4F4X A;  8ICL A;  3KFU F;  5EE3 A;  4JWN A;  3SAF A;  4Q45 A;  1SWW A;  1VLB A;  3SAG A;  9ICJ A;  2LHT A;  4PZO A;  1ZRN A;  3N7S C;  4DEZ A;  5KFE A;  4NY8 A;  2NRZ A;  5AKJ A;  1ZQP A;  1S97 A;  4YD2 A;  3RB3 A;  3QYP A;  5J29 A;  4I2F A;  1PK1 B;  4KLQ A;  3IHQ B;  5KT7 A;  3RR8 A;  2DUY A;  2W7P A;  1B0X A;  4YD1 A;  3HRD D;  2IA6 A;  4UB5 A;  2E8P A;  1ZQB A;  2BCV A;  4JMU A;  5F9N A;  3NUQ A;  4NLK A;  9ICE A;  5DGA A;  2KE7 A;  4YR3 A;  2P6R A;  9ICA A;  1V38 A;  4YR2 A;  2PKE A;  4KTQ A;  2P6U A;  4TUR A;  3WK4 A;  1N60 A;  5A0L A;  8ICH A;  4IS7 A;  3PY8 A;  3J81 j;  2ZIW B;  4NL9 C;  1NK7 A;  3ZDA A;  4RZR A;  4F71 A;  5L1J A;  3BQ0 A;  4O5K A;  4ZOH C;  2I9G A;  1QQ6 A;  4NWI A;  5IIN A;  2RDJ A;  8ICS A;  4F92 B;  5KT4 A;  2G0A A;  4F72 A;  1YZ7 A;  2ZIU B;  5C5J A;  2NV3 A;  4R65 A;  9ICO A;  1ZQF A;  2MUT B;  4J9L A;  5KAF U;  3A0H U;  4ICA A;  4F5O A;  4ELV A;  1JUD A;  1ZQA A;  1DGJ A;  4RPZ A;  3DV9 A;  4GXJ A;  1JX4 A;  3BS7 A;  5KFO A;  3KHH A;  1UHU A;  4J9S A;  2JR5 A;  4UB4 A;  3LWM A;  3KHR A;  2F8K A;  4J9P A;  2JZB A;  1F5S A;  2RLT A;  3C5F A;  4HYK A;  3OPX A;  8ICJ A;  5AM4 A;  1V85 A;  3D2Q A;  4ELU A;  3B0X A;  3QU2 A;  3NTU A;  3PX6 A;  2R8K A;  3MFH A;  2E8N A;  2AH5 A;  2XCA A;  4CCH A;  1MQ3 A;  5KG4 A;  3PW4 A;  4QZA A;  5J0X A;  1PVQ A;  2UVR A;  2YML A;  1ZJN A;  5J2F A;  5J0Y A;  3OJU A;  3ALR A;  1JIH A;  1X66 A;  4O3P A;  5AM1 A;  4TUS A;  3NRZ A;  4R64 A;  3OHB A;  1L7O A;  5ALX A;  1ARO P;  2PFQ A;  4NM2 A;  5AKH A;  1WG8 A;  3EPG A;  4DL3 A;  1JRO A;  1DRG A;  3M8S A;  7ICO A;  2KFZ A;  2FPM A;  4F5N A;  5TZV A;  3K75 D;  4M9J A;  4OO1 J;  1O03 A;  3L4P A;  2G5I B;  5AI5 A;  4FS2 A;  2K4I A;  5KFW A;  4JV1 A;  4X5V A;  2MU2 A;  4CE6 A;  1T7P A;  4QZB A;  2HHW A;  1KFD A;  4RPY A;  3SI8 A;  3Q8M A;  5KFT A;  1LKY B;  1BPY A;  9ICN A;  3LK9 A;  3PVX A;  2J6U A;  9ICW A;  8ICF A;  2KKP A;  4RUA A;  5ALF A;  2AGO A;  8ICG A;  5DBB A;  2I5H A;  4Y2J A;  3RH4 A;  1WUD A;  5D49 A;  4C8K A;  2DBY A;  5ALJ A;  4F2R A;  2W3S A;  3N97 B;  1ZQT A;  9ICQ A;  5EWF A;  9ICU A;  3BQ1 A;  5H2F U;  7ICI A;  4PJ0 U;  2WB1 F;  4KN7 A;  4RT2 A;  2FLL A;  2NRT A;  4O3M A;  2W54 A;  5KFU A;  4JB3 A;  4PHD A;  5DLF A;  2BCU A;  3IN5 A;  3PR4 A;  4B9T A;  1M6Y A;  2KHQ A;  2QAR A;  3M7D A;  4EEK A;  3JPO A;  4NLC A;  5KL1 B;  4JWM A;  4UBB A;  4IRD A;  4AYB F;  5AI0 A;  5JRT A;  2W43 A;  1MC8 A;  4QWB A;  2YMM A;  4RQ8 A;  3OSN A;  1Z1V A;  3C2K A;  4RQ5 A;  2YTU A;  1EXN A;  3G6Y A;  1XO1 A;  8ICW A;  2WF5 A;  5ALR A;  2QKQ A;  7ICN A;  5B5E U;  1NK5 A;  4RQ0 A;  3HT3 A;  3EPI A;  1D8L A;  3Q8R B;  8ICV A;  2C2D A;  2AU0 A;  4QIW F;  2A3V A;  3I1Y A;  1KL9 A;  2VKQ A;  4RQM A;  1XSP A;  2KOB A;  3E0F A;  1TK5 A;  1SL1 A;  1QTM A;  3HW8 A;  1KLN A;  2MSN A;  2H3I A;  4K4G A;  1SL2 A;  4GC7 A;  5BOL A;  4QW9 A;  2HBM A;  3CYM A;  2FMP A;  4CGZ A;  4I2G A;  2BKE A;  1RYR A;  2BQR A;  3CW2 C;  2UVU A;  1RXW A;  3WK8 A;  2GLE A;  5KFX A;  1S0V A;  3R9K A;  4ECU A;  4QWA A;  2Y1J A;  3T5L A;  8ICX A;  2W9B A;  3K1Z A;  2AJQ A;  3OHA A;  1X40 A;  4QWE A;  1ECW A;  9ICP A;  4CF5 A;  3NAS A;  1IG6 A;  4AP9 A;  2HVI A;  3KHL A;  2XGP A;  1AQ6 A;  4EYH B;  2F3N A;  1KTQ A;  3QU5 A;  2HBL A;  5J0R A;  1JI7 A;  2KZ3 A;  2KSO B;  5KFJ A;  5AK6 A;  2M0N A;  2WF9 A;  4F4Y A;  4QJF B;  3E2E A;  3VCB A;  2HBK A;  2Y1I A;  2EZZ A;  2KHV A;  1DOQ A; 
#chains in the Genus database with same CATH homology
 2W7P A;  3KZX A;  3H0M B;  2XID A;  3CP8 A;  2F8L A;  3HKZ F;  4ACO A;  4P0P A;  2HOQ A;  1ZQ1 C;  1NZB A;  1URJ A;  4KMO B;  1D8B A;  2ZXH A;  3H0R B;  3GZF A;  3F2D A;  3IG8 A;  4JMU A;  1MA7 A;  4KX3 A;  4QIW C;  1ED1 A;  2KIW A;  3NUQ A;  1XNS A;  3LVW A;  4P0P B;  2E5S A;  2G5H B;  2OYY A;  2PMZ C;  1Z1B A;  2R18 A;  3F5E A;  2YB4 A;  1L6N A;  2ZIW A;  1T94 A;  3M6Z A;  4OJ5 A;  5T14 A;  4U7C A;  2CPR A;  3AQE A;  3IG5 A;  1DRG A;  2W03 A;  5A0L A;  4WJ3 B;  2K4H A;  2VJ5 A;  3C29 A;  1GO3 F;  2CN1 A;  2LYA A;  4CRX A;  4QIW F;  2A3V A;  3RF9 A;  2XI9 A;  3O0F A;  2ZIW B;  2VKQ A;  2F76 X;  4OO1 J;  2HBJ A;  3D2N A;  3F53 A;  2K4E A;  2YX8 A;  2G5I B;  2KOB A;  2PMZ F;  3E0F A;  2GH1 A;  4FE3 A;  3L3F X;  2DQN B;  2K4I A;  2KJ9 A;  2OM6 A;  2H3Q A;  2HMX A;  2ZIU A;  1Q3U A;  5C0Y A;  3PST A;  4NWI A;  3H0L B;  1PVP A;  2H3I A;  1IIP A;  1SZH A;  2JMG A;  4PL1 A;  2HBM A;  1F44 A;  3CYM A;  2G0A A;  2VJ4 A;  3M6K A;  2ZIU B;  4CGZ A;  1Q3V A;  2NV3 A;  1CRX A;  2F2A B;  2DF4 B;  3N7P D;  2G08 A;  4OJO A;  2G09 A;  3GU3 A;  3CRX A;  2ZIX A;  2H3V A;  2K8C B;  3VC8 A;  2KIC A;  5CRX A;  2K89 A;  2MRL A;  2XVT A;  3MGV A;  1P7D A;  2YB1 A;  2RRD A;  4ICA A;  4U6P A;  4NLB A;  2Y0S C;  2ZIX B;  3PSI A;  3AL0 B;  2K8B B;  4FZM A;  4C0Z A;  5HR6 A;  2OXO A;  2KKP A;  1UPH A;  4BUG A;  2KNJ A;  1HIW A;  1TAM A;  2DGZ A;  2ZXI A;  3IP4 B;  1Z19 A;  2JGA A;  3F2B A;  2RP5 A;  3F5A A;  3K1Z A;  4P0Q A;  2KVC A;  2GOL A;  1WUD A;  4CDG A;  1PVR A;  2F77 X;  2ZG6 A;  2KKV A;  1ECW A;  3T79 A;  4GFJ A;  2KJ8 A;  2MA1 A;  2HOF A;  2KD1 A;  2WB1 C;  2W7O A;  3F2C A;  2Y0S F;  1HEK A;  3C28 A;  1YT3 A;  3N7R C;  4P0Q B;  2JH1 A;  5KL8 B;  2WAQ C;  4OJL A;  2KV2 A;  1OUQ A;  2ZIV A;  3PSF A;  4A8E A;  4PL2 A;  3OPX A;  3SAH A;  2CRX A;  3D2Q A;  3ONN A;  4QNL A;  4BJQ A;  1KBU A;  2KEY A;  2H3Z A;  4FZN A;  2E1E A;  3SAF A;  4FZL A;  2K8A A;  3PZP A;  3ICX A;  3KFU F;  3DEE A;  2LKY A;  2WB1 F;  2H3F A;  2HBL A;  2RHF A;  2LYB A;  2ZIV B;  4BX9 C;  3SAG A;  3SQI A;  4AYB C;  4O3M A;  2OH2 A;  1A0P A;  2XIC A;  3AQF A;  2LHT A;  2WAQ F;  2Z7J A;  3IN5 A;  4OJP A;  2JHD A;  3D2S A;  2KHQ A;  3M7D A;  3N7S C;  2M0N A;  3HKZ C;  2Q4T A;  2HOI A;  2N1R A;  2W04 A;  2KJ5 A;  1A6S A;  4QJF B;  2LBO A;  3LVV A;  3RFA A;  4NLC A;  1PVQ A;  5KL1 B;  2BDU A;  3NRW A;  3VCB A;  1XO0 A;  2JH7 A;  4AYB F;  5HR7 A;  4NV0 A;  2HBK A;  2E1F A;  4IC9 A;  3LYS A;  4OJ6 A;  3PSP A;  3ALR A;  2KHV A;  2VIX A;  2D6F C;  3SMV A;  4KX5 A;  2G07 A;  2G06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...