2K8CB

Solution structure of plaa family ubiquitin binding domain (pfuc) trans isomer in complex with ubiquitin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
b'ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
molecule keywords Ubiquitin
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k8cB00
2K8BB 3PSTA 2K8AA 2K8CB 3L3FX 2K89A 3PSPA
chains in the Genus database with same CATH superfamily
4ECUA 3QYPA 3H8SA 5DLGA 1MA7A 3ETRA 2M9NA 5KFVA 5ALYA 4FS2A 1ZQCA 2DUYA 1S10A 4OJ6A 5AI4A 2RQ5A 3DEEA 4UB6U 5J8YA 5KFLA 4OD0A 4BXOB 1HJPA 1N63A 9ICRA 1D9FA 7ICEA 2GH1A 4M9GA 4DFDA 5KAIU 3GU3A 1MC8A 4C8KA 2F77X 2PI4A 3SAHA 1NZBA 1BPYA 4XRHA 3WU2U 1S77D 1T8EA 3IHQB 4Z6EA 1XO1A 2QARB 2NO4A 4BJQA 4QZCA 4F3OA 2PKEA 2KK0A 2DKZA 8ICCA 3TACB 1N56A 4RQ0A 4YXMA 3CRXA 4ZH4A 2Y1IA 2E8PA 3GV5B 2W9MA 8ICKA 4UW9A 8ICRA 3H4DA 1UHUA 2AGQA 1BPDA 1ZD4A 4IS7A 5KFMA 1YZ6A 2LI6A 4R66A 5B5EU 2H3IA 1V85A 2YB4A 5CJ7A 4QZFA 4NL9A 3NASA 1SL0A 5HNKA 1S9FA 1CI4A 1CUKA 3IG5A 1GO3F 1L3TA 7ICKA 3GIJA 4F91B 1N60A 2C2DA 1UA1A 2XVTA 4DQRA 4IRDA 3TANA 2LMRA 2PI5A 3LVVA 4OCZA 5ALJA 2GO7A 1KKXA 3IP4B 4GC6A 4ICAA 3PSFA 1KFTA 1UT8A 2CRXA 3C28A 2OXOA 5KFDA 3OHBA 1RXVA 3KKAA 7ICSA 7ICJA 1U49A 3AU6A 5G5GA 3RR7A 1X42A 3RB4A 4C8OA 3N7PD 2BCVA 4RPZA 5DKWA 1WWUA 2IOHA 9ICTA 2XY5A 2N1RA 5J0YA 4GC7A 1J97A 3KD3A 3MFHA 2BPGA 2D3DA 4UB1A 2R8IA 4I2JA 5ALXA 7ICNA 3C21A 4J9SA 5KFIA 3PNCA 4EENA 4FE3A 5KFPA 2ZTCA 1L3UA 4DL6A 2AJQA 3UQ2A 2DFLA 3KBBA 4DCCA 2KG5A 2HVHA 5HR6A 3Q8MA 1Z19A 2V4RA 3EYZA 2HBLA 4ECTA 1YT3A 4XUSA 4ELUA 2G5HB 1KFDA 5KFFA 8ICXA 4YD1A 3Q8QB 4YMMA 2H3QA 3SENA 1ZQVA 3RF9A 1QTMA 2I6XA 4Z6CA 3RB3A 4RT2A 4PJ0U 8ICIA 7ICQA 4Q43A 1HEKA 2ZIXA 3UM9A 2B0CA 1NK9A 1MQ3A 3F5EA 1U9LA 3ALRA 3MGIA 2OWOA 5BOMA 4DWIA 4QZIA 3U26A 5ALIA 3QU7A 1LV5A 1NKEA 9ICMA 2NRXA 3A0BU 4PZOA 4KLIA 2XGPA 5KT3A 8ICEA 4RPXA 4JV2A 1Y88A 3K75D 1RZTA 1MSWD 4KLEA 2KEYA 5AI6A 3KTQA 4ELVA 3GZFA 4KLUA 2KV2A 3WKCA 4I2EA 2PMZC 5KFYA 4C8NA 5HHHA 2BHNA 1TKDA 4IRKA 2R8HA 5D49A 4UBCA 4Q8FA 2WB1F 5KFCA 3C1ZA 2F76X 3SI8A 5J29A 2ASJA 4QIWF 3AU2A 3KOOA 4C4SA 4R65A 3MR2A 2DL0A 3AUOA 2JV3A 4C80A 1EXNA 1TV9A 9ICSA 3NVZA 2KFNA 1Z1VA 2NRWA 5E79U 2OM6A 5DB7A 4QNLA 4OJLA 5C5JA 1DK2A 5DB9A 5AICA 3IDWA 2A1AA 4US8A 3GIMA 3RBDA 3H0RB 4DO9A 7ICTA 1ZQRA 3RJKA 3PMNA 4O3SA 2KVSA 2QB0B 2W55A 3F53A 3PW0A 2VIXA 3PR4A 9ICUA 3WKBA 4LZGA 2FI1A 5KAFU 2FJ6A 5IIJA 2LHTA 3PW2A 1TVAA 1SXDA 1XU4A 3M1YA 3D2QA 7ICHA 4RQ4A 3H7IA 2AGPA 3M9MB 2MRLA 3SEIA 8ICOA 2ALZA 5AIAA 2JEFA 1T94A 5DBCA 2XIDA 1H38A 4M9LA 1QLNA 4PH5A 2WAQF 4F5OA 3QZ8A 2Y0SF 3JPQA 1ZQWA 1SGGA 4KLTA 2KHQA 3HP6A 2H5XA 4DFPA 2H3FA 1YZ7A 3CP8A 3QUTA 5AM0A 5AM5A 3N4MB 5J2AA 1L7NA 4I28A 1Z00A 4O0IA 4QIWC 3HT3A 1SV0A 1X9SA 4PHAA 4EEYA 4ECVA 2D8CA 4JUZA 5KFWA 2W04A 5J2JA 1S0OA 2EAMA 3PSIA 3PV8A 2KIWA 2FPMA 4QWAA 1V9PA 4DFMA 4P0PA 4RUCA 5ALEA 3EWAA 1ZOLA 3K1RB 3UMBA 3NUQA 4MF2A 4CDGA 2ZJ5A 5G5HA 2W8KA 4NL9C 5KG1A 3WKDA 5IIIA 1SWVA 1ZD5A 4F4ZA 5IIOA 2NRVA 4OJPA 4M6WA 5KT4A 3H8WA 4DS5A 3RJIA 5D4BA 2PXIA 4YR3A 4QW9A 3T5HA 1D8LA 3VCBA 1CEZA 1LKYB 2J6UA 4TUQA 5IIKA 5ALWA 3KHGA 4YQWA 4B9TA 4I27A 3KKAC 8ICLA 9ICEA 2CN1A 5KG2A 1A76A 3JPNA 2YQEA 1NKCA 1ZQ1C 3GFKB 5KFSA 3L4PA 4I2GA 2C22A 3E58A 3MBYA 8ICYA 4UAZA 4UARA 4CCHA 4GXJA 4Q8EA 2ATLA 4EEKA 5IIMA 1PK1A 5KFOA 4EX6A 1CRXA 1KEJA 5CHGA 1N48A 3H8JA 1JN3A 2M0NA 3TAQA 2HHTA 1KN5A 4Y2JA 9ICGA 2ZXIA 2MUTB 4Z6DA 3B9JA 1JALA 5KFZA 3AQEA 3E0FA 4F2SA 1JXLA 4J9OA 3QNMA 2KN7A 2VJ4A 1VLBA 3ICXA 4TUPA 3PX4A 2ZIWA 1ZRMA 3C1YA 2W7OA 1O08A 1DOQA 3PW4A 2FDRA 5GTIU 5J0RA 4DQQA 1BNOA 4I2IA 3V6HA 1RYRA 1HIWA 2E3TA 5KG4A 1ZQPA 2V4QA 4Y2UA 3TARA 4C0ZA 2OCEA 7ICPA 3QUBA 5AK6A 1SXEA 3M7DA 4DL4A 1A6SA 4CE6A 1OXJA 9ICKA 2VA8A 4HAIA 1VJ5A 3H0MB 3RJEA 4F5QA 4O3NA 4NLNA 2W9BA 1X9WA 2R8KA 5AI8A 4TUSA 1T4GA 4O5CA 4I29A 3GIIA 2WTFA 3T5KA 2BDPA 1TK0A 5AI0A 4KN4A 5AKEA 1IM4A 5EWGA 1FEZA 5KT2A 5DLFA 4DSFA 2EANA 2W11A 2HCFA 3EPIA 1X6JA 2KNJA 2F1HA 3OPXA 3T3FA 3G6VA 4JK1A 2HW3A 2RLTA 1IXRA 4R8UA 1Q8KA 5AKIA 1SKWA 2XI9A 1NK0A 3QU2A 4XQ8A 4F50A 2C2RA 1A77A 1IIPA 1ZD3A 4EYHB 1WCNA 2EZZA 2MA1A 4DL7A 1ZQXA 4QZHA 3BS7A 5KFXA 2ZIUA 5FP0A 8ICMA 3SZ2A 3PO4A 4UAYA 3QEAZ 4QZGA 1NK7A 5DGAA 5KT5A 1TFRA 4P0QB 4YN4A 3MC1A 2PFPA 2W3RA 2YMMA 4JV0A 4ED1A 1SWWA 2IOFA 4Y2PA 1X66A 3ZD9A 2HHUA 4ED6A 4NXZA 1L5UA 2KZMA 4BWJA 3BQ2A 1WUDA 5ALKA 1KBUA 2KKPA 4RQ6A 4JV1A 2GOLA 1F44A 1BPZA 4CF4A 3BJYA 2LYHA 4KLSA 3B0XA 4U6PA 2WF7A 3LYSA 1URJA 4Y2SA 2D6FC 9ICQA 4NLBA 3C5GA 3N7RC 2LBOA 1ECWA 2KZ3A 4PL1A 5J0OA 2FPLA 3FC4A 2AHOB 3FDSA 1N5XA 3OSPA 2VA3A 1P7DA 5AKXA 8ICBA 2BR0A 2ES6A 4J03A 2IHMA 3CW2C 2MSNA 4Y2VA 2ZG6A 5HR7A 4DOCA 1ZQFA 4DEZA 2HDOA 4QWBA 5KT7A 2BQRA 2KTQA 8ICNA 4YXJA 8ICHA 5DG9A 8ICUA 1T7PA 4PL2A 5J0QA 5J0UA 3Q8SB 3QX7A 3PW7A 5JUMA 4PGYA 3BQ1A 2BCSA 4C7ZA 3AQFA 4DQIA 4FFDA 2VANA 2KOBA 2ZTDA 4IR1A 2DQNB 8ICTA 4DS4A 1Z4OA 5AI5A 4QWEA 1RM6C 4TURA 2KVCA 5KFNA 9ICLA 4PHDA 3C29A 2ODGA 4RQMA 1JI7A 4IRCA 5JRTA 1U4BA 4UB2A 4NLKA 4O3OA 3NRZA 8ICGA 3OJUA 1TAUA 3V7LA 5KFTA 8ICFA 5AK4A 3SMVA 8ICPA 2JHDA 4Y2QA 9ICFA 2F1JA 1ZRNA 5DG8A 4UAWA 2PMZF 1X2IA 7ICMA 2KJ5A 4QWCA 4ECWA 5J0PA 2NO5A 4Y2XA 3H8MA 4RQ1A 2ESEA 3SAGA 4C8MA 2ZIVA 4ECQA 5CRXA 2K4PA 5ALVA 4EZ6A 4FBTA 3S6JA 1B0XA 2IMWP 4DFKA 9ICCA 2AGOA 2KICA 2AQ0A 4DLGA 5ALOA 2W54A 3UQ0A 4F4KA 3T5LA 1SIJA 5L1JA 2LM1A 4F72A 2KIVA 4ECZA 5J2CA 4B9LA 4UB4A 2PFNA 2FMQA 3QEBZ 4PZNA 5BPCA 4MFCA 2F1IA 1ZQHA 5DQIA 1TE2A 3F2BA 2I9GA 3G6XA 3AN1A 4EBEA 4YMNA 5F3XB 5EE3A 3N28A 3BQ0A 1L7OA 2RHFA 5J0WA 5AM3A 1XO0A 2UVVA 4QZAA 3RJFA 4RNNA 3HRDD 3PW5A 5KFBA 2HBMA 5KG5A 3UMCA 8ICQA 2HI0A 2XY6A 4ELTA 1D8YA 2W7PA 4HYKA 4DQSA 4X5VA 1NOMA 2G0AA 1JROA 2KSOA 1FFVA 1L3VA 5CB1A 9ICIA 5DDMA 4C8LA 5JTIA 1RXWA 3QUCA 2Y1JA 1O03A 3WK7A 2Z7JA 1JIHA 4DOBA 4OJ5A 4YG2A 4O3MA 5J2IA 3BQTA 2WHEA 3KHLA 1KTQA 1IV8A 1DXSA 3C23A 5AM2A 4QZ9A 1DGJA 4F8RA 1Q3UA 1JX4A 5L9XA 4M0AA 3TI0A 5AI9A 4YD2A 2K8AA 4KTQA 4PPXA 2E8MA 4DSJA 3OTQA 4I2AA 4BWMA 1L6NA 4YFKA 1SB3C 3M6KA 4YCXA 3NVYA 5C0YA 3TKAA 2OH2A 7ICLA 3FAHA 4G3IA 3ISBA 9ICAA 5DBAA 1QQ6A 5ALLA 2JEGA 1NK5A 3AL0B 5J0XA 2OYYA 1ZD2P 4F92B 3MR3A 3Q8RB 4R63A 4KLDA 5J8YC 3ONNA 4Q45A 3RRGA 1ZQUA 2AQ4A 1BGXT 2ZIXB 1UT5A 3NVVA 2GLEA 5F9LA 3I28A 4KMOB 4KMUA 2VKQA 2C28A 1ZQJA 1KW4A 1Z3EB 3QZ7A 1ZQLA 2BCRA 9ICPA 2W9CA 8ICWA 2E8OA 5KFEA 2K60A 2NV3A 9ICNA 2MAXA 1K5OA 1J2MA 3RB0A 4YR0A 3ZDBA 4B9VA 3V7JA 5J2KA 1ZJMA 2UVUA 4BGDA 1L7PA 5EE9A 3RH6A 3PSPA 3AEVA 3MFIA 2JEJA 5CR0A 2ISOA 4EZ9A 2R8JA 5AKGA 1M6YA 4RNOA 4IQUA 5CWRA 1ZQKA 3OJSA 1ZETA 1N62A 5L1MA 4UAVA 4LJXA 5DBBA 4RPYA 4FBUA 2K4EA 2JGAA 2NRTA 1NJZA 4FS1A 7ICIA 5KG0A 2HHVA 2H3VA 4BDPA 2A19A 5K4LA 2WF9A 4ECSA 1DRGA 3Q8PB 4GLXA 1LB2B 1PZNA 4IQWA 1XNSA 3RH5A 4PHEA 1S0VA 2XCAA 3I1YA 2PFOA 2KP7A 5ALGA 1QSLA 2C2EA 1ZYQA 4GIBA 4NLCA 1COOA 3HWTA 3OHAA 1KL9A 5J2HA 5DQHA 2HSZA 4QZBA 3WK5A 1V38A 5HMLA 5KL8B 2W9AA 4EBCA 1IG6A 4Y2TA 4RQ3A 4J9PA 2HOIA 8ICJA 3H4BA 2B6GA 4M47A 5ALRA 4CNQA 4QJFB 4K4IA 1ZQNA 1OW5A 4AP9A 1FFUA 3QUQA 4JMUA 4GXKA 3WK6A 1S97A 1SKRA 2HVIA 4UB5A 2EQYA 4I2HA 1D9DA 1ZQOA 3ZDAA 2DPIA 4MHVA 1S5LU 3GDXA 4A8EA 1HUZA 4O5KA 1C20A 3NRWA 1NZPA 3QU5A 2F2AB 4ED7A 2QB1A 4DF8A 2QKQA 1LVHA 1XSNA 2HHXA 3RAXA 4BXOA 4KLOA 3IM1A 2EH9A 5TISU 2F8LA 8ICZA 4ECRA 2JH1A 1SV4A 3RJJA 4DSLA 1AQ6A 3ZI4A 7ICVA 1PUZA 4DSIA 2FLNA 1Z00B 4EBDA 2KJ9A 3O0FA 1ED1A 3Q8LA 4MEYA 2P66A 2QARA 2ZUDA 2XICA 3MABA 5J0TA 4J9RA 2AU0A 4B9MA 5DGBA 4P0PB 1ZJNA 2W3SA 2LYBA 4CRXA 1Q46A 1A0PA 4AYBF 2YY6A 1JRPA 3H0LB 3T5JA 2Q4TA 1UA0A 5L1IA 4O3QA 4M6WB 1L3SA 2VA2A 3F2DA 3BZCA 1UPHA 1WWVA 1KQQA 3JPPA 5KG7A 3TADA 5ALQA 1B22A 2RDIA 4TQSA 3ISDA 1U47A 7ICFA 3PSTA 3TQ1A 3BQ7A 4TQRA 3OGUA 3SYZA 3SV4A 4P2HA 4F93B 3IRUA 4J9QA 3PMLA 2E5SA 3WKEA 2FMPA 5KFKA 1S0MA 2XGQA 1SZPA 3HPOA 1F5SA 3R9KA 5AK5A 2HHSA 1XC9A 1ZQGA 1PVQA 4CF3A 5AKYA 1PK1B 1FIQA 3BDPA 5KT6A 2W8LA 2DKXA 2DBYA 4M9HA 2AH5A 2UVRA 2ISPA 1RQNA 3RAQA 4KX5A 2XCPA 1MN8A 1L7MA 4M9NA 4GFJA 3GQCA 9ICHA 4QZ8A 4EYIB 3HILA 5ALZA 1COKA 2W43A 2XY7A 4ED2A 1ZQMA 1ZXIA 4Q44A 4Y2RA 4AYBC 2ZIWB 3M8SA 1DK3A 3LVWA 4K4GA 3RR8A 3JPOA 1TAQA 9ICWA 2KE7A 1WCLA 4KN7A 4NV0A 2GWSA 4JWNA 2DF4B 5KFRA 1QSSA 4F71A 1NNLA 3OSNA 1KLNA 5AM1A 4RUAA 2A3VA 3E2EA 1V97A 1PK3A 2R18A 2W9BB 2UVWA 4KLFA 2R8GA 3SQIA 1SL2A 4DF4A 1NJYA 4M9JA 4CGZA 2H3ZA 4O5EA 4I2CA 4B6JA 9ICBA 5KFGA 2EAPA 5IILA 1Z1BA 2FLPA 3WK4A 3CNHA 3C5FA 4RT3A 1D8BA 1ZQTA 1SV0C 2HMXA 2KKVA 3TFRA 4F2RA 1UCVA 4IL6U 5CEHA 2ZXHA 2ZJAA 5J2GA 4EX7A 5ALTA 2I1QA 3VC8A 1QCKA 4UQGA 2J6TA 3I76A 3K1ZA 4FZMA 4IC9A 3ISCA 2WF5A 3GIKA 2BCUA 3D2NA 4R8UB 2YTUA 5ALUA 4PHPA 3TFSA 2BQ3A 3IV6A 5ALSA 1ZQQA 5BOLA 1ZQBA 4B9SA 2ZIUB 5T14A 5J2FA 4BUGA 2YMLA 3GILA 3DDHA 3SR6A 5EE0A 4UAUA 2F8KA 2JEIA 1NJXA 4K4HA 3ED5A 2EDUA 1XS9D 1RPLA 3SD7A 5KFJA 5HHIA 1UQVA 4Z6FA 5HP4A 3UMGA 3HJEA 3MGHA 4QW8A 1Z4NA 3H40A 2FMSA 2YMQA 4IR9A 3J81j 2ZTEA 2J6SA 4KLMA 4RQ7A 2YN4A 3QE9Y 3M6ZA 3MDCA 1B43A 2WFAA 4KX3A 9ICJA 2YX8A 4E0DA 1NK8A 5A0LA 2O6KA 2Q0ZX 5KG3A 3GV8B 3PX0A 4LVSA 2QB0A 2NRZA 4J9NA 5HMMA 2KFZA 4P4PA 5KG6A 1NK4A 5L1LA 3ZDDA 3ORYA 4C4TA 4B9NA 1WG8A 2BCQA 2DPJA 3NVWA 5IINA 4MEXA 4NJ8A 5F9NA 1N61A 2LM4A 2KMDA 3PZPA 4NLZA 4ACOA 4KITB 3JPSA 3KHHA 4UASA 3PR5B 2KJ8A 2ASDA 1F0MA 4UB8U 3PO5A 8ICVA 3RFAA 1K1SA 2K8BB 1KFSA 1K1QA 4DFJA 1KSPA 3RB6A 5AKZA 4JB3A 1U45A 3TAPA 1QQ7A 2KHVA 4F5PA 5AKLA 2JZBA 1U48A 2IOFK 3UPQA 4DL5A 2BZFA 1XSPA 2FE9A 2AXTU 2G06A 4NLGA 3ZD8A 3C2LA 2JRZA 3A0HU 1BPBA 7ICRA 3HW8A 1HUOA 3G6YA 2G08A 2DGZA 3FM9A 2HHQA 1NJWA 4MFFA 5KFUA 4UATA 1ZQDA 3GV7B 4DL2A 4M2YA 4I2FA 1WYGA 4NM1A 3D6JA 8ICAA 1MQ2A 4LZDA 2BPCA 4I2DA 2BKEA 3TADC 1XWLA 1X9MA 1ZQAA 1S0NA 2OEHA 4RNMA 5L1KA 2B21A 5DDYA 3DV9A 1FO4A 3SAFA 5TZVA 2G09A 4RQNA 5EWEA 4B9UA 2ZIVB 3BZKA 4P4OA 4KLJA 1LKYA 3RH4A 4ED3A 3KZXA 4MF8A 5CP2A 1S76D 3QU4A 1X9XA 4DOAA 5J0SA 4DL3A 2QLTA 2Y9TA 4RZRA 2BGWA 4DSKA 5B66U 3THVA 2OHFA 2P35A 2KZZA 4ED0A 1ZQSA 5EE1A 2YB1A 3PY8A 4IQTA 3LWMA 2Y9UA 4J9MA 5ALHA 3RRHA 4QZEA 4PGXA 1ZQZA 4YMOA 3V6JA 5ALPA 5EWFA 8ICSA 2EZXA 3L5KA 5AIBA 5JU5A 4RQ2A 3V7KA 4XA5A 5AKJA 2JR5A 5AKHA 5J2BA 3RJGA 2MUTA 3HKZF 2PFQA 4OO1J 3LDAA 4QWDA 3AMZA 5ALFA 3UXPA 1OUQA 3SV3A 1L8OA 4J9KA 5J2DA 1PVRA 2CPRA 2P6UA 2DWQA 2RDJA 4R64A 4NM2A 3EW9A 3LK9A 4YR2A 3BS5A 2YMPA 1J2NA 1JMSA 4GXIA 4RU9A 4KLLA 9ICOA 3RTVA 2KSOB 2JZBB 4FZNA 4F5NA 3NS1A 2A1JA 2WB1C 5D46A 2I5HA 3N7SC 4WJ3B 5J2EA 1ZQIA 3UXNA 4NWIA 5AKKA 3UXOA 2XC9A 4USAA 1S8OA 4M04A 1BVSA 4G9BA 2K4HA 3MR6A 3L3FX 5CA7A 3F2CA 4ZOHC 3MR5A 4C7YA 4J9LA 3WKAA 4NY8A 1RG6A 4RQ8A 3PVXA 4CF5A 3CYMA 3QU9A 1Q3VA 1KDHA 4IQVA 3KZIU 9ICVA 3RJHA 5AHXA 2K89A 5ALDA 1KRPA 2HBJA 2EZYA 5AM4A 3WK8A 4U7CA 5DB8A 2LKYA 3JPRA 3IN5A 2IA6A 9ICXA 5AK3A 3RBEA 3M9NB 2KD1A 3Q8KA 2E1EA 1JUDA 2V9WA 4PGQA 2FLLA 4US9A 4O3PA 1B4FA 2LPEA 5KFAA 1XSLA 1X6IA 2JH7A 4UB3A 1QH9A 5H2FU 3KFUF 2G07A 3HKZC 2BPFA 4MFAA 3MDAA 4I2BA 4YP3A 1TAMA 7ICOA 1TK8A 2RP5A 4F4YA 5KFHA 2F3NA 5DQGA 4F5RA 1SKSA 2WAQC 1NKBA 1RYSA 4KLHA 2E8NA 2Y0SC 3QXGA 4RQ5A 2JMGA 3MGVA 4F4XA 3V72A 3JPTA 2BDUA 4P4MA 4ECYA 1NK6A 1RYUA 4UBBA 2BQUA 3F5AA 5KFQA 3N97B 4P0QA 3AM9A 4FO6A 4YVZA 5ALMA 4KLGA 3M9OB 1DGSA 5KNIA 1ZQYA 2W9CB 1T3NA 4DLEA 1SL1A 1T3QA 3LWLA 4JWMA 4KLQA 4O9MA 5KTQA 2MU2A 1C7YA 2ZUBA 2HHWA 4BX9C 2EAOA 3NGDA 2LYAA 3BS5B 1JXEA 2F44A 2WF8A 2A1JB 2WF6A 4FZLA 3ZDCA 4EELA 2ASLA 1BPEA 2NYVA 3C2KA 2K4IA 2ZJ8A 4F4WA 5DG7A 1L8LA 4Y2YA 2K8CB 1NI3A 3C2MA 1BPXA 4ED8A 1BNPA 3HX0A 2VJ5A 5KL1B 3K4GA 2JXJA 1N5WA 4O3RA 4DQPA 3WK9A 2FPKA 4OJOA 2IHNA 3EZ5A 2ZUCA 1PVPA 2XO7A 2P6RA 5GTHU 3IG8A 2G5IB 5EOZA 3ZDEA 3FYHA 3M8RA 7ICUA 4C4RA 2E1FA 5DB6A 1TK5A 1N2XA 3KHRA 3NTUA 7ICGA 1RQLA 2L5YA 1AROP 2HOQA 1RDFA 2CXYA 2W03A 1QSYA 3EUB2 4DSEA 3T79A 3PX6A 3ETLA 2RRDA 1SZHA 3EPGA 1QQ5A 4ECXA 3D2SA 2HOFA 2IBKA 3V6KA 1ZQEA 3B0YA 4QZDA 2HBKA 5ALNA 1VDVA 1X40A
chains in the Genus database with same CATH topology
1XNSA 4ICAA 3PSFA 1P7DA 4P0PB 2CRXA 3C28A 2OXOA 5C0YA 2LYBA 3OPXA 1MA7A 3D2QA 4CRXA 2OH2A 3N7SC 1A0PA 4WJ3B 2ZG6A 5HR7A 2MRLA 4AYBF 4NWIA 4NV0A 4NLCA 2DF4B 1CRXA 4OJ6A 3H0LB 3F2BA 1T94A 3DEEA 4BX9C 2Q4TA 2LYAA 2K4HA 2XI9A 2XIDA 4PL2A 2A3VA 2OYYA 3AL0B 2KEYA 2WAQF 3L3FX 2M0NA 3GZFA 3N7PD 3M6ZA 2KV2A 2RHFA 2GH1A 1IIPA 2Y0SF 3F2CA 2R18A 5KL8B 3F2DA 4KX3A 3AQFA 2KHQA 1UPHA 2PMZC 2YX8A 1XO0A 2MA1A 4FZLA 3SAFA 3SQIA 2H3FA 2G09A 2KOBA 5A0LA 2ZXIA 3ONNA 3CP8A 2DQNB 2ZIVB 3GU3A 2HOIA 2F77X 2N1RA 2ZIUA 3CYMA 1Q3VA 3SAHA 2HBMA 4CGZA 2H3ZA 3AQEA 3KZXA 3PSTA 2K4IA 1NZBA 3E0FA 4QIWC 2KVCA 2ZIXB 4QJFB 4OO1J 2K89A 1Z1BA 2VJ4A 2WB1F 2HBJA 4JMUA 2W7PA 3C29A 2K8CB 4U7CA 1D8BA 2W04A 2LKYA 2G0AA 3ICXA 4KMOB 4FE3A 4BJQA 3IN5A 4P0QB 2E5SA 2VKQA 2F76X 3PSIA 2KD1A 2ZIWA 2E1EA 2HMXA 2KIWA 2KKVA 4QIWF 2YB1A 3CRXA 2VJ5A 2W7OA 5KL1B 2ZXHA 3PZPA 4P0PA 4A8EA 4ACOA 1WUDA 5HR6A 2NV3A 1Z19A 3NUQA 3VC8A 4CDGA 3SMVA 1PVQA 3K1ZA 2KJ8A 4FZMA 3NRWA 1HIWA 2JH7A 2KKPA 2HBLA 4IC9A 2JHDA 4OJOA 3RFAA 2Z7JA 1PVPA 2GOLA 3KFUF 4C0ZA 2OM6A 3D2NA 2F2AB 2G07A 3IG8A 3HKZC 2K8BB 4OJLA 4QNLA 2PMZF 1F44A 3M7DA 4OJ5A 1YT3A 2G5IB 4O3MA 1A6SA 2KJ5A 1TAMA 4OJPA 3PSPA 2G5HB 2RP5A 2F8LA 2E1FA 3H0MB 2JH1A 2KHVA 2H3IA 2YB4A 2H3QA 3SAGA 3RF9A 2WAQC 3H0RB 4KX5A 4U6PA 3LYSA 2ZIVA 2Y0SC 3HKZF 2HOQA 3VCBA 2JMGA 3IG5A 1GO3F 4GFJA 2ZIUB 1URJA 2G06A 3LVWA 5T14A 3MGVA 4BUGA 1Q3UA 2W03A 5CRXA 2D6FC 1HEKA 2BDUA 2K4EA 3T79A 3F53A 1OUQA 2JGAA 2ZIXA 4NLBA 2KJ9A 3N7RC 2LBOA 1ECWA 1PVRA 2CPRA 2XVTA 3O0FA 4PL1A 2VIXA 1ED1A 2RRDA 1SZHA 2KICA 2K8AA 2G08A 3F5EA 3F5AA 3D2SA 2H3VA 2DGZA 3LVVA 2CN1A 2HOFA 4P0QA 2XICA 4AYBC 1L6NA 2HBKA 3ALRA 3IP4B 1DRGA 1ZQ1C 4FZNA 3M6KA 2ZIWB 2WB1C 1KBUA 2LHTA 2KNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8B B;  3PST A;  2K8A A;  2K8C B;  3L3F X;  2K89 A;  3PSP A; 
#chains in the Genus database with same CATH topology
 4ECU A;  3QYP A;  3H8S A;  5DLG A;  1MA7 A;  3ETR A;  2M9N A;  5KFV A;  5ALY A;  4FS2 A;  1ZQC A;  2DUY A;  1S10 A;  4OJ6 A;  5AI4 A;  2RQ5 A;  3DEE A;  4UB6 U;  5J8Y A;  5KFL A;  4OD0 A;  4BXO B;  1HJP A;  1N63 A;  9ICR A;  1D9F A;  7ICE A;  2GH1 A;  4M9G A;  4DFD A;  5KAI U;  3GU3 A;  1MC8 A;  4C8K A;  2F77 X;  2PI4 A;  3SAH A;  1NZB A;  1BPY A;  4XRH A;  3WU2 U;  1S77 D;  1T8E A;  3IHQ B;  4Z6E A;  1XO1 A;  2QAR B;  2NO4 A;  4BJQ A;  4QZC A;  4F3O A;  2PKE A;  2KK0 A;  2DKZ A;  8ICC A;  3TAC B;  1N56 A;  4RQ0 A;  4YXM A;  3CRX A;  4ZH4 A;  2Y1I A;  2E8P A;  3GV5 B;  2W9M A;  8ICK A;  4UW9 A;  8ICR A;  3H4D A;  1UHU A;  2AGQ A;  1BPD A;  1ZD4 A;  4IS7 A;  5KFM A;  1YZ6 A;  2LI6 A;  4R66 A;  5B5E U;  2H3I A;  1V85 A;  2YB4 A;  5CJ7 A;  4QZF A;  4NL9 A;  3NAS A;  1SL0 A;  5HNK A;  1S9F A;  1CI4 A;  1CUK A;  3IG5 A;  1GO3 F;  1L3T A;  7ICK A;  3GIJ A;  4F91 B;  1N60 A;  2C2D A;  1UA1 A;  2XVT A;  4DQR A;  4IRD A;  3TAN A;  2LMR A;  2PI5 A;  3LVV A;  4OCZ A;  5ALJ A;  2GO7 A;  1KKX A;  3IP4 B;  4GC6 A;  4ICA A;  3PSF A;  1KFT A;  1UT8 A;  2CRX A;  3C28 A;  2OXO A;  5KFD A;  3OHB A;  1RXV A;  3KKA A;  7ICS A;  7ICJ A;  1U49 A;  3AU6 A;  5G5G A;  3RR7 A;  1X42 A;  3RB4 A;  4C8O A;  3N7P D;  2BCV A;  4RPZ A;  5DKW A;  1WWU A;  2IOH A;  9ICT A;  2XY5 A;  2N1R A;  5J0Y A;  4GC7 A;  1J97 A;  3KD3 A;  3MFH A;  2BPG A;  2D3D A;  4UB1 A;  2R8I A;  4I2J A;  5ALX A;  7ICN A;  3C21 A;  4J9S A;  5KFI A;  3PNC A;  4EEN A;  4FE3 A;  5KFP A;  2ZTC A;  1L3U A;  4DL6 A;  2AJQ A;  3UQ2 A;  2DFL A;  3KBB A;  4DCC A;  2KG5 A;  2HVH A;  5HR6 A;  3Q8M A;  1Z19 A;  2V4R A;  3EYZ A;  2HBL A;  4ECT A;  1YT3 A;  4XUS A;  4ELU A;  2G5H B;  1KFD A;  5KFF A;  8ICX A;  4YD1 A;  3Q8Q B;  4YMM A;  2H3Q A;  3SEN A;  1ZQV A;  3RF9 A;  1QTM A;  2I6X A;  4Z6C A;  3RB3 A;  4RT2 A;  4PJ0 U;  8ICI A;  7ICQ A;  4Q43 A;  1HEK A;  2ZIX A;  3UM9 A;  2B0C A;  1NK9 A;  1MQ3 A;  3F5E A;  1U9L A;  3ALR A;  3MGI A;  2OWO A;  5BOM A;  4DWI A;  4QZI A;  3U26 A;  5ALI A;  3QU7 A;  1LV5 A;  1NKE A;  9ICM A;  2NRX A;  3A0B U;  4PZO A;  4KLI A;  2XGP A;  5KT3 A;  8ICE A;  4RPX A;  4JV2 A;  1Y88 A;  3K75 D;  1RZT A;  1MSW D;  4KLE A;  2KEY A;  5AI6 A;  3KTQ A;  4ELV A;  3GZF A;  4KLU A;  2KV2 A;  3WKC A;  4I2E A;  2PMZ C;  5KFY A;  4C8N A;  5HHH A;  2BHN A;  1TKD A;  4IRK A;  2R8H A;  5D49 A;  4UBC A;  4Q8F A;  2WB1 F;  5KFC A;  3C1Z A;  2F76 X;  3SI8 A;  5J29 A;  2ASJ A;  4QIW F;  3AU2 A;  3KOO A;  4C4S A;  4R65 A;  3MR2 A;  2DL0 A;  3AUO A;  2JV3 A;  4C80 A;  1EXN A;  1TV9 A;  9ICS A;  3NVZ A;  2KFN A;  1Z1V A;  2NRW A;  5E79 U;  2OM6 A;  5DB7 A;  4QNL A;  4OJL A;  5C5J A;  1DK2 A;  5DB9 A;  5AIC A;  3IDW A;  2A1A A;  4US8 A;  3GIM A;  3RBD A;  3H0R B;  4DO9 A;  7ICT A;  1ZQR A;  3RJK A;  3PMN A;  4O3S A;  2KVS A;  2QB0 B;  2W55 A;  3F53 A;  3PW0 A;  2VIX A;  3PR4 A;  9ICU A;  3WKB A;  4LZG A;  2FI1 A;  5KAF U;  2FJ6 A;  5IIJ A;  2LHT A;  3PW2 A;  1TVA A;  1SXD A;  1XU4 A;  3M1Y A;  3D2Q A;  7ICH A;  4RQ4 A;  3H7I A;  2AGP A;  3M9M B;  2MRL A;  3SEI A;  8ICO A;  2ALZ A;  5AIA A;  2JEF A;  1T94 A;  5DBC A;  2XID A;  1H38 A;  4M9L A;  1QLN A;  4PH5 A;  2WAQ F;  4F5O A;  3QZ8 A;  2Y0S F;  3JPQ A;  1ZQW A;  1SGG A;  4KLT A;  2KHQ A;  3HP6 A;  2H5X A;  4DFP A;  2H3F A;  1YZ7 A;  3CP8 A;  3QUT A;  5AM0 A;  5AM5 A;  3N4M B;  5J2A A;  1L7N A;  4I28 A;  1Z00 A;  4O0I A;  4QIW C;  3HT3 A;  1SV0 A;  1X9S A;  4PHA A;  4EEY A;  4ECV A;  2D8C A;  4JUZ A;  5KFW A;  2W04 A;  5J2J A;  1S0O A;  2EAM A;  3PSI A;  3PV8 A;  2KIW A;  2FPM A;  4QWA A;  1V9P A;  4DFM A;  4P0P A;  4RUC A;  5ALE A;  3EWA A;  1ZOL A;  3K1R B;  3UMB A;  3NUQ A;  4MF2 A;  4CDG A;  2ZJ5 A;  5G5H A;  2W8K A;  4NL9 C;  5KG1 A;  3WKD A;  5III A;  1SWV A;  1ZD5 A;  4F4Z A;  5IIO A;  2NRV A;  4OJP A;  4M6W A;  5KT4 A;  3H8W A;  4DS5 A;  3RJI A;  5D4B A;  2PXI A;  4YR3 A;  4QW9 A;  3T5H A;  1D8L A;  3VCB A;  1CEZ A;  1LKY B;  2J6U A;  4TUQ A;  5IIK A;  5ALW A;  3KHG A;  4YQW A;  4B9T A;  4I27 A;  3KKA C;  8ICL A;  9ICE A;  2CN1 A;  5KG2 A;  1A76 A;  3JPN A;  2YQE A;  1NKC A;  1ZQ1 C;  3GFK B;  5KFS A;  3L4P A;  4I2G A;  2C22 A;  3E58 A;  3MBY A;  8ICY A;  4UAZ A;  4UAR A;  4CCH A;  4GXJ A;  4Q8E A;  2ATL A;  4EEK A;  5IIM A;  1PK1 A;  5KFO A;  4EX6 A;  1CRX A;  1KEJ A;  5CHG A;  1N48 A;  3H8J A;  1JN3 A;  2M0N A;  3TAQ A;  2HHT A;  1KN5 A;  4Y2J A;  9ICG A;  2ZXI A;  2MUT B;  4Z6D A;  3B9J A;  1JAL A;  5KFZ A;  3AQE A;  3E0F A;  4F2S A;  1JXL A;  4J9O A;  3QNM A;  2KN7 A;  2VJ4 A;  1VLB A;  3ICX A;  4TUP A;  3PX4 A;  2ZIW A;  1ZRM A;  3C1Y A;  2W7O A;  1O08 A;  1DOQ A;  3PW4 A;  2FDR A;  5GTI U;  5J0R A;  4DQQ A;  1BNO A;  4I2I A;  3V6H A;  1RYR A;  1HIW A;  2E3T A;  5KG4 A;  1ZQP A;  2V4Q A;  4Y2U A;  3TAR A;  4C0Z A;  2OCE A;  7ICP A;  3QUB A;  5AK6 A;  1SXE A;  3M7D A;  4DL4 A;  1A6S A;  4CE6 A;  1OXJ A;  9ICK A;  2VA8 A;  4HAI A;  1VJ5 A;  3H0M B;  3RJE A;  4F5Q A;  4O3N A;  4NLN A;  2W9B A;  1X9W A;  2R8K A;  5AI8 A;  4TUS A;  1T4G A;  4O5C A;  4I29 A;  3GII A;  2WTF A;  3T5K A;  2BDP A;  1TK0 A;  5AI0 A;  4KN4 A;  5AKE A;  1IM4 A;  5EWG A;  1FEZ A;  5KT2 A;  5DLF A;  4DSF A;  2EAN A;  2W11 A;  2HCF A;  3EPI A;  1X6J A;  2KNJ A;  2F1H A;  3OPX A;  3T3F A;  3G6V A;  4JK1 A;  2HW3 A;  2RLT A;  1IXR A;  4R8U A;  1Q8K A;  5AKI A;  1SKW A;  2XI9 A;  1NK0 A;  3QU2 A;  4XQ8 A;  4F50 A;  2C2R A;  1A77 A;  1IIP A;  1ZD3 A;  4EYH B;  1WCN A;  2EZZ A;  2MA1 A;  4DL7 A;  1ZQX A;  4QZH A;  3BS7 A;  5KFX A;  2ZIU A;  5FP0 A;  8ICM A;  3SZ2 A;  3PO4 A;  4UAY A;  3QEA Z;  4QZG A;  1NK7 A;  5DGA A;  5KT5 A;  1TFR A;  4P0Q B;  4YN4 A;  3MC1 A;  2PFP A;  2W3R A;  2YMM A;  4JV0 A;  4ED1 A;  1SWW A;  2IOF A;  4Y2P A;  1X66 A;  3ZD9 A;  2HHU A;  4ED6 A;  4NXZ A;  1L5U A;  2KZM A;  4BWJ A;  3BQ2 A;  1WUD A;  5ALK A;  1KBU A;  2KKP A;  4RQ6 A;  4JV1 A;  2GOL A;  1F44 A;  1BPZ A;  4CF4 A;  3BJY A;  2LYH A;  4KLS A;  3B0X A;  4U6P A;  2WF7 A;  3LYS A;  1URJ A;  4Y2S A;  2D6F C;  9ICQ A;  4NLB A;  3C5G A;  3N7R C;  2LBO A;  1ECW A;  2KZ3 A;  4PL1 A;  5J0O A;  2FPL A;  3FC4 A;  2AHO B;  3FDS A;  1N5X A;  3OSP A;  2VA3 A;  1P7D A;  5AKX A;  8ICB A;  2BR0 A;  2ES6 A;  4J03 A;  2IHM A;  3CW2 C;  2MSN A;  4Y2V A;  2ZG6 A;  5HR7 A;  4DOC A;  1ZQF A;  4DEZ A;  2HDO A;  4QWB A;  5KT7 A;  2BQR A;  2KTQ A;  8ICN A;  4YXJ A;  8ICH A;  5DG9 A;  8ICU A;  1T7P A;  4PL2 A;  5J0Q A;  5J0U A;  3Q8S B;  3QX7 A;  3PW7 A;  5JUM A;  4PGY A;  3BQ1 A;  2BCS A;  4C7Z A;  3AQF A;  4DQI A;  4FFD A;  2VAN A;  2KOB A;  2ZTD A;  4IR1 A;  2DQN B;  8ICT A;  4DS4 A;  1Z4O A;  5AI5 A;  4QWE A;  1RM6 C;  4TUR A;  2KVC A;  5KFN A;  9ICL A;  4PHD A;  3C29 A;  2ODG A;  4RQM A;  1JI7 A;  4IRC A;  5JRT A;  1U4B A;  4UB2 A;  4NLK A;  4O3O A;  3NRZ A;  8ICG A;  3OJU A;  1TAU A;  3V7L A;  5KFT A;  8ICF A;  5AK4 A;  3SMV A;  8ICP A;  2JHD A;  4Y2Q A;  9ICF A;  2F1J A;  1ZRN A;  5DG8 A;  4UAW A;  2PMZ F;  1X2I A;  7ICM A;  2KJ5 A;  4QWC A;  4ECW A;  5J0P A;  2NO5 A;  4Y2X A;  3H8M A;  4RQ1 A;  2ESE A;  3SAG A;  4C8M A;  2ZIV A;  4ECQ A;  5CRX A;  2K4P A;  5ALV A;  4EZ6 A;  4FBT A;  3S6J A;  1B0X A;  2IMW P;  4DFK A;  9ICC A;  2AGO A;  2KIC A;  2AQ0 A;  4DLG A;  5ALO A;  2W54 A;  3UQ0 A;  4F4K A;  3T5L A;  1SIJ A;  5L1J A;  2LM1 A;  4F72 A;  2KIV A;  4ECZ A;  5J2C A;  4B9L A;  4UB4 A;  2PFN A;  2FMQ A;  3QEB Z;  4PZN A;  5BPC A;  4MFC A;  2F1I A;  1ZQH A;  5DQI A;  1TE2 A;  3F2B A;  2I9G A;  3G6X A;  3AN1 A;  4EBE A;  4YMN A;  5F3X B;  5EE3 A;  3N28 A;  3BQ0 A;  1L7O A;  2RHF A;  5J0W A;  5AM3 A;  1XO0 A;  2UVV A;  4QZA A;  3RJF A;  4RNN A;  3HRD D;  3PW5 A;  5KFB A;  2HBM A;  5KG5 A;  3UMC A;  8ICQ A;  2HI0 A;  2XY6 A;  4ELT A;  1D8Y A;  2W7P A;  4HYK A;  4DQS A;  4X5V A;  1NOM A;  2G0A A;  1JRO A;  2KSO A;  1FFV A;  1L3V A;  5CB1 A;  9ICI A;  5DDM A;  4C8L A;  5JTI A;  1RXW A;  3QUC A;  2Y1J A;  1O03 A;  3WK7 A;  2Z7J A;  1JIH A;  4DOB A;  4OJ5 A;  4YG2 A;  4O3M A;  5J2I A;  3BQT A;  2WHE A;  3KHL A;  1KTQ A;  1IV8 A;  1DXS A;  3C23 A;  5AM2 A;  4QZ9 A;  1DGJ A;  4F8R A;  1Q3U A;  1JX4 A;  5L9X A;  4M0A A;  3TI0 A;  5AI9 A;  4YD2 A;  2K8A A;  4KTQ A;  4PPX A;  2E8M A;  4DSJ A;  3OTQ A;  4I2A A;  4BWM A;  1L6N A;  4YFK A;  1SB3 C;  3M6K A;  4YCX A;  3NVY A;  5C0Y A;  3TKA A;  2OH2 A;  7ICL A;  3FAH A;  4G3I A;  3ISB A;  9ICA A;  5DBA A;  1QQ6 A;  5ALL A;  2JEG A;  1NK5 A;  3AL0 B;  5J0X A;  2OYY A;  1ZD2 P;  4F92 B;  3MR3 A;  3Q8R B;  4R63 A;  4KLD A;  5J8Y C;  3ONN A;  4Q45 A;  3RRG A;  1ZQU A;  2AQ4 A;  1BGX T;  2ZIX B;  1UT5 A;  3NVV A;  2GLE A;  5F9L A;  3I28 A;  4KMO B;  4KMU A;  2VKQ A;  2C28 A;  1ZQJ A;  1KW4 A;  1Z3E B;  3QZ7 A;  1ZQL A;  2BCR A;  9ICP A;  2W9C A;  8ICW A;  2E8O A;  5KFE A;  2K60 A;  2NV3 A;  9ICN A;  2MAX A;  1K5O A;  1J2M A;  3RB0 A;  4YR0 A;  3ZDB A;  4B9V A;  3V7J A;  5J2K A;  1ZJM A;  2UVU A;  4BGD A;  1L7P A;  5EE9 A;  3RH6 A;  3PSP A;  3AEV A;  3MFI A;  2JEJ A;  5CR0 A;  2ISO A;  4EZ9 A;  2R8J A;  5AKG A;  1M6Y A;  4RNO A;  4IQU A;  5CWR A;  1ZQK A;  3OJS A;  1ZET A;  1N62 A;  5L1M A;  4UAV A;  4LJX A;  5DBB A;  4RPY A;  4FBU A;  2K4E A;  2JGA A;  2NRT A;  1NJZ A;  4FS1 A;  7ICI A;  5KG0 A;  2HHV A;  2H3V A;  4BDP A;  2A19 A;  5K4L A;  2WF9 A;  4ECS A;  1DRG A;  3Q8P B;  4GLX A;  1LB2 B;  1PZN A;  4IQW A;  1XNS A;  3RH5 A;  4PHE A;  1S0V A;  2XCA A;  3I1Y A;  2PFO A;  2KP7 A;  5ALG A;  1QSL A;  2C2E A;  1ZYQ A;  4GIB A;  4NLC A;  1COO A;  3HWT A;  3OHA A;  1KL9 A;  5J2H A;  5DQH A;  2HSZ A;  4QZB A;  3WK5 A;  1V38 A;  5HML A;  5KL8 B;  2W9A A;  4EBC A;  1IG6 A;  4Y2T A;  4RQ3 A;  4J9P A;  2HOI A;  8ICJ A;  3H4B A;  2B6G A;  4M47 A;  5ALR A;  4CNQ A;  4QJF B;  4K4I A;  1ZQN A;  1OW5 A;  4AP9 A;  1FFU A;  3QUQ A;  4JMU A;  4GXK A;  3WK6 A;  1S97 A;  1SKR A;  2HVI A;  4UB5 A;  2EQY A;  4I2H A;  1D9D A;  1ZQO A;  3ZDA A;  2DPI A;  4MHV A;  1S5L U;  3GDX A;  4A8E A;  1HUZ A;  4O5K A;  1C20 A;  3NRW A;  1NZP A;  3QU5 A;  2F2A B;  4ED7 A;  2QB1 A;  4DF8 A;  2QKQ A;  1LVH A;  1XSN A;  2HHX A;  3RAX A;  4BXO A;  4KLO A;  3IM1 A;  2EH9 A;  5TIS U;  2F8L A;  8ICZ A;  4ECR A;  2JH1 A;  1SV4 A;  3RJJ A;  4DSL A;  1AQ6 A;  3ZI4 A;  7ICV A;  1PUZ A;  4DSI A;  2FLN A;  1Z00 B;  4EBD A;  2KJ9 A;  3O0F A;  1ED1 A;  3Q8L A;  4MEY A;  2P66 A;  2QAR A;  2ZUD A;  2XIC A;  3MAB A;  5J0T A;  4J9R A;  2AU0 A;  4B9M A;  5DGB A;  4P0P B;  1ZJN A;  2W3S A;  2LYB A;  4CRX A;  1Q46 A;  1A0P A;  4AYB F;  2YY6 A;  1JRP A;  3H0L B;  3T5J A;  2Q4T A;  1UA0 A;  5L1I A;  4O3Q A;  4M6W B;  1L3S A;  2VA2 A;  3F2D A;  3BZC A;  1UPH A;  1WWV A;  1KQQ A;  3JPP A;  5KG7 A;  3TAD A;  5ALQ A;  1B22 A;  2RDI A;  4TQS A;  3ISD A;  1U47 A;  7ICF A;  3PST A;  3TQ1 A;  3BQ7 A;  4TQR A;  3OGU A;  3SYZ A;  3SV4 A;  4P2H A;  4F93 B;  3IRU A;  4J9Q A;  3PML A;  2E5S A;  3WKE A;  2FMP A;  5KFK A;  1S0M A;  2XGQ A;  1SZP A;  3HPO A;  1F5S A;  3R9K A;  5AK5 A;  2HHS A;  1XC9 A;  1ZQG A;  1PVQ A;  4CF3 A;  5AKY A;  1PK1 B;  1FIQ A;  3BDP A;  5KT6 A;  2W8L A;  2DKX A;  2DBY A;  4M9H A;  2AH5 A;  2UVR A;  2ISP A;  1RQN A;  3RAQ A;  4KX5 A;  2XCP A;  1MN8 A;  1L7M A;  4M9N A;  4GFJ A;  3GQC A;  9ICH A;  4QZ8 A;  4EYI B;  3HIL A;  5ALZ A;  1COK A;  2W43 A;  2XY7 A;  4ED2 A;  1ZQM A;  1ZXI A;  4Q44 A;  4Y2R A;  4AYB C;  2ZIW B;  3M8S A;  1DK3 A;  3LVW A;  4K4G A;  3RR8 A;  3JPO A;  1TAQ A;  9ICW A;  2KE7 A;  1WCL A;  4KN7 A;  4NV0 A;  2GWS A;  4JWN A;  2DF4 B;  5KFR A;  1QSS A;  4F71 A;  1NNL A;  3OSN A;  1KLN A;  5AM1 A;  4RUA A;  2A3V A;  3E2E A;  1V97 A;  1PK3 A;  2R18 A;  2W9B B;  2UVW A;  4KLF A;  2R8G A;  3SQI A;  1SL2 A;  4DF4 A;  1NJY A;  4M9J A;  4CGZ A;  2H3Z A;  4O5E A;  4I2C A;  4B6J A;  9ICB A;  5KFG A;  2EAP A;  5IIL A;  1Z1B A;  2FLP A;  3WK4 A;  3CNH A;  3C5F A;  4RT3 A;  1D8B A;  1ZQT A;  1SV0 C;  2HMX A;  2KKV A;  3TFR A;  4F2R A;  1UCV A;  4IL6 U;  5CEH A;  2ZXH A;  2ZJA A;  5J2G A;  4EX7 A;  5ALT A;  2I1Q A;  3VC8 A;  1QCK A;  4UQG A;  2J6T A;  3I76 A;  3K1Z A;  4FZM A;  4IC9 A;  3ISC A;  2WF5 A;  3GIK A;  2BCU A;  3D2N A;  4R8U B;  2YTU A;  5ALU A;  4PHP A;  3TFS A;  2BQ3 A;  3IV6 A;  5ALS A;  1ZQQ A;  5BOL A;  1ZQB A;  4B9S A;  2ZIU B;  5T14 A;  5J2F A;  4BUG A;  2YML A;  3GIL A;  3DDH A;  3SR6 A;  5EE0 A;  4UAU A;  2F8K A;  2JEI A;  1NJX A;  4K4H A;  3ED5 A;  2EDU A;  1XS9 D;  1RPL A;  3SD7 A;  5KFJ A;  5HHI A;  1UQV A;  4Z6F A;  5HP4 A;  3UMG A;  3HJE A;  3MGH A;  4QW8 A;  1Z4N A;  3H40 A;  2FMS A;  2YMQ A;  4IR9 A;  3J81 j;  2ZTE A;  2J6S A;  4KLM A;  4RQ7 A;  2YN4 A;  3QE9 Y;  3M6Z A;  3MDC A;  1B43 A;  2WFA A;  4KX3 A;  9ICJ A;  2YX8 A;  4E0D A;  1NK8 A;  5A0L A;  2O6K A;  2Q0Z X;  5KG3 A;  3GV8 B;  3PX0 A;  4LVS A;  2QB0 A;  2NRZ A;  4J9N A;  5HMM A;  2KFZ A;  4P4P A;  5KG6 A;  1NK4 A;  5L1L A;  3ZDD A;  3ORY A;  4C4T A;  4B9N A;  1WG8 A;  2BCQ A;  2DPJ A;  3NVW A;  5IIN A;  4MEX A;  4NJ8 A;  5F9N A;  1N61 A;  2LM4 A;  2KMD A;  3PZP A;  4NLZ A;  4ACO A;  4KIT B;  3JPS A;  3KHH A;  4UAS A;  3PR5 B;  2KJ8 A;  2ASD A;  1F0M A;  4UB8 U;  3PO5 A;  8ICV A;  3RFA A;  1K1S A;  2K8B B;  1KFS A;  1K1Q A;  4DFJ A;  1KSP A;  3RB6 A;  5AKZ A;  4JB3 A;  1U45 A;  3TAP A;  1QQ7 A;  2KHV A;  4F5P A;  5AKL A;  2JZB A;  1U48 A;  2IOF K;  3UPQ A;  4DL5 A;  2BZF A;  1XSP A;  2FE9 A;  2AXT U;  2G06 A;  4NLG A;  3ZD8 A;  3C2L A;  2JRZ A;  3A0H U;  1BPB A;  7ICR A;  3HW8 A;  1HUO A;  3G6Y A;  2G08 A;  2DGZ A;  3FM9 A;  2HHQ A;  1NJW A;  4MFF A;  5KFU A;  4UAT A;  1ZQD A;  3GV7 B;  4DL2 A;  4M2Y A;  4I2F A;  1WYG A;  4NM1 A;  3D6J A;  8ICA A;  1MQ2 A;  4LZD A;  2BPC A;  4I2D A;  2BKE A;  3TAD C;  1XWL A;  1X9M A;  1ZQA A;  1S0N A;  2OEH A;  4RNM A;  5L1K A;  2B21 A;  5DDY A;  3DV9 A;  1FO4 A;  3SAF A;  5TZV A;  2G09 A;  4RQN A;  5EWE A;  4B9U A;  2ZIV B;  3BZK A;  4P4O A;  4KLJ A;  1LKY A;  3RH4 A;  4ED3 A;  3KZX A;  4MF8 A;  5CP2 A;  1S76 D;  3QU4 A;  1X9X A;  4DOA A;  5J0S A;  4DL3 A;  2QLT A;  2Y9T A;  4RZR A;  2BGW A;  4DSK A;  5B66 U;  3THV A;  2OHF A;  2P35 A;  2KZZ A;  4ED0 A;  1ZQS A;  5EE1 A;  2YB1 A;  3PY8 A;  4IQT A;  3LWM A;  2Y9U A;  4J9M A;  5ALH A;  3RRH A;  4QZE A;  4PGX A;  1ZQZ A;  4YMO A;  3V6J A;  5ALP A;  5EWF A;  8ICS A;  2EZX A;  3L5K A;  5AIB A;  5JU5 A;  4RQ2 A;  3V7K A;  4XA5 A;  5AKJ A;  2JR5 A;  5AKH A;  5J2B A;  3RJG A;  2MUT A;  3HKZ F;  2PFQ A;  4OO1 J;  3LDA A;  4QWD A;  3AMZ A;  5ALF A;  3UXP A;  1OUQ A;  3SV3 A;  1L8O A;  4J9K A;  5J2D A;  1PVR A;  2CPR A;  2P6U A;  2DWQ A;  2RDJ A;  4R64 A;  4NM2 A;  3EW9 A;  3LK9 A;  4YR2 A;  3BS5 A;  2YMP A;  1J2N A;  1JMS A;  4GXI A;  4RU9 A;  4KLL A;  9ICO A;  3RTV A;  2KSO B;  2JZB B;  4FZN A;  4F5N A;  3NS1 A;  2A1J A;  2WB1 C;  5D46 A;  2I5H A;  3N7S C;  4WJ3 B;  5J2E A;  1ZQI A;  3UXN A;  4NWI A;  5AKK A;  3UXO A;  2XC9 A;  4USA A;  1S8O A;  4M04 A;  1BVS A;  4G9B A;  2K4H A;  3MR6 A;  3L3F X;  5CA7 A;  3F2C A;  4ZOH C;  3MR5 A;  4C7Y A;  4J9L A;  3WKA A;  4NY8 A;  1RG6 A;  4RQ8 A;  3PVX A;  4CF5 A;  3CYM A;  3QU9 A;  1Q3V A;  1KDH A;  4IQV A;  3KZI U;  9ICV A;  3RJH A;  5AHX A;  2K89 A;  5ALD A;  1KRP A;  2HBJ A;  2EZY A;  5AM4 A;  3WK8 A;  4U7C A;  5DB8 A;  2LKY A;  3JPR A;  3IN5 A;  2IA6 A;  9ICX A;  5AK3 A;  3RBE A;  3M9N B;  2KD1 A;  3Q8K A;  2E1E A;  1JUD A;  2V9W A;  4PGQ A;  2FLL A;  4US9 A;  4O3P A;  1B4F A;  2LPE A;  5KFA A;  1XSL A;  1X6I A;  2JH7 A;  4UB3 A;  1QH9 A;  5H2F U;  3KFU F;  2G07 A;  3HKZ C;  2BPF A;  4MFA A;  3MDA A;  4I2B A;  4YP3 A;  1TAM A;  7ICO A;  1TK8 A;  2RP5 A;  4F4Y A;  5KFH A;  2F3N A;  5DQG A;  4F5R A;  1SKS A;  2WAQ C;  1NKB A;  1RYS A;  4KLH A;  2E8N A;  2Y0S C;  3QXG A;  4RQ5 A;  2JMG A;  3MGV A;  4F4X A;  3V72 A;  3JPT A;  2BDU A;  4P4M A;  4ECY A;  1NK6 A;  1RYU A;  4UBB A;  2BQU A;  3F5A A;  5KFQ A;  3N97 B;  4P0Q A;  3AM9 A;  4FO6 A;  4YVZ A;  5ALM A;  4KLG A;  3M9O B;  1DGS A;  5KNI A;  1ZQY A;  2W9C B;  1T3N A;  4DLE A;  1SL1 A;  1T3Q A;  3LWL A;  4JWM A;  4KLQ A;  4O9M A;  5KTQ A;  2MU2 A;  1C7Y A;  2ZUB A;  2HHW A;  4BX9 C;  2EAO A;  3NGD A;  2LYA A;  3BS5 B;  1JXE A;  2F44 A;  2WF8 A;  2A1J B;  2WF6 A;  4FZL A;  3ZDC A;  4EEL A;  2ASL A;  1BPE A;  2NYV A;  3C2K A;  2K4I A;  2ZJ8 A;  4F4W A;  5DG7 A;  1L8L A;  4Y2Y A;  2K8C B;  1NI3 A;  3C2M A;  1BPX A;  4ED8 A;  1BNP A;  3HX0 A;  2VJ5 A;  5KL1 B;  3K4G A;  2JXJ A;  1N5W A;  4O3R A;  4DQP A;  3WK9 A;  2FPK A;  4OJO A;  2IHN A;  3EZ5 A;  2ZUC A;  1PVP A;  2XO7 A;  2P6R A;  5GTH U;  3IG8 A;  2G5I B;  5EOZ A;  3ZDE A;  3FYH A;  3M8R A;  7ICU A;  4C4R A;  2E1F A;  5DB6 A;  1TK5 A;  1N2X A;  3KHR A;  3NTU A;  7ICG A;  1RQL A;  2L5Y A;  1ARO P;  2HOQ A;  1RDF A;  2CXY A;  2W03 A;  1QSY A;  3EUB 2;  4DSE A;  3T79 A;  3PX6 A;  3ETL A;  2RRD A;  1SZH A;  3EPG A;  1QQ5 A;  4ECX A;  3D2S A;  2HOF A;  2IBK A;  3V6K A;  1ZQE A;  3B0Y A;  4QZD A;  2HBK A;  5ALN A;  1VDV A;  1X40 A; 
#chains in the Genus database with same CATH homology
 1XNS A;  4ICA A;  3PSF A;  1P7D A;  4P0P B;  2CRX A;  3C28 A;  2OXO A;  5C0Y A;  2LYB A;  3OPX A;  1MA7 A;  3D2Q A;  4CRX A;  2OH2 A;  3N7S C;  1A0P A;  4WJ3 B;  2ZG6 A;  5HR7 A;  2MRL A;  4AYB F;  4NWI A;  4NV0 A;  4NLC A;  2DF4 B;  1CRX A;  4OJ6 A;  3H0L B;  3F2B A;  1T94 A;  3DEE A;  4BX9 C;  2Q4T A;  2LYA A;  2K4H A;  2XI9 A;  2XID A;  4PL2 A;  2A3V A;  2OYY A;  3AL0 B;  2KEY A;  2WAQ F;  3L3F X;  2M0N A;  3GZF A;  3N7P D;  3M6Z A;  2KV2 A;  2RHF A;  2GH1 A;  1IIP A;  2Y0S F;  3F2C A;  2R18 A;  5KL8 B;  3F2D A;  4KX3 A;  3AQF A;  2KHQ A;  1UPH A;  2PMZ C;  2YX8 A;  1XO0 A;  2MA1 A;  4FZL A;  3SAF A;  3SQI A;  2H3F A;  2G09 A;  2KOB A;  5A0L A;  2ZXI A;  3ONN A;  3CP8 A;  2DQN B;  2ZIV B;  3GU3 A;  2HOI A;  2F77 X;  2N1R A;  2ZIU A;  3CYM A;  1Q3V A;  3SAH A;  2HBM A;  4CGZ A;  2H3Z A;  3AQE A;  3KZX A;  3PST A;  2K4I A;  1NZB A;  3E0F A;  4QIW C;  2KVC A;  2ZIX B;  4QJF B;  4OO1 J;  2K89 A;  1Z1B A;  2VJ4 A;  2WB1 F;  2HBJ A;  4JMU A;  2W7P A;  3C29 A;  2K8C B;  4U7C A;  1D8B A;  2W04 A;  2LKY A;  2G0A A;  3ICX A;  4KMO B;  4FE3 A;  4BJQ A;  3IN5 A;  4P0Q B;  2E5S A;  2VKQ A;  2F76 X;  3PSI A;  2KD1 A;  2ZIW A;  2E1E A;  2HMX A;  2KIW A;  2KKV A;  4QIW F;  2YB1 A;  3CRX A;  2VJ5 A;  2W7O A;  5KL1 B;  2ZXH A;  3PZP A;  4P0P A;  4A8E A;  4ACO A;  1WUD A;  5HR6 A;  2NV3 A;  1Z19 A;  3NUQ A;  3VC8 A;  4CDG A;  3SMV A;  1PVQ A;  3K1Z A;  2KJ8 A;  4FZM A;  3NRW A;  1HIW A;  2JH7 A;  2KKP A;  2HBL A;  4IC9 A;  2JHD A;  4OJO A;  3RFA A;  2Z7J A;  1PVP A;  2GOL A;  3KFU F;  4C0Z A;  2OM6 A;  3D2N A;  2F2A B;  2G07 A;  3IG8 A;  3HKZ C;  2K8B B;  4OJL A;  4QNL A;  2PMZ F;  1F44 A;  3M7D A;  4OJ5 A;  1YT3 A;  2G5I B;  4O3M A;  1A6S A;  2KJ5 A;  1TAM A;  4OJP A;  3PSP A;  2G5H B;  2RP5 A;  2F8L A;  2E1F A;  3H0M B;  2JH1 A;  2KHV A;  2H3I A;  2YB4 A;  2H3Q A;  3SAG A;  3RF9 A;  2WAQ C;  3H0R B;  4KX5 A;  4U6P A;  3LYS A;  2ZIV A;  2Y0S C;  3HKZ F;  2HOQ A;  3VCB A;  2JMG A;  3IG5 A;  1GO3 F;  4GFJ A;  2ZIU B;  1URJ A;  2G06 A;  3LVW A;  5T14 A;  3MGV A;  4BUG A;  1Q3U A;  2W03 A;  5CRX A;  2D6F C;  1HEK A;  2BDU A;  2K4E A;  3T79 A;  3F53 A;  1OUQ A;  2JGA A;  2ZIX A;  4NLB A;  2KJ9 A;  3N7R C;  2LBO A;  1ECW A;  1PVR A;  2CPR A;  2XVT A;  3O0F A;  4PL1 A;  2VIX A;  1ED1 A;  2RRD A;  1SZH A;  2KIC A;  2K8A A;  2G08 A;  3F5E A;  3F5A A;  3D2S A;  2H3V A;  2DGZ A;  3LVV A;  2CN1 A;  2HOF A;  4P0Q A;  2XIC A;  4AYB C;  1L6N A;  2HBK A;  3ALR A;  3IP4 B;  1DRG A;  1ZQ1 C;  4FZN A;  3M6K A;  2ZIW B;  2WB1 C;  1KBU A;  2LHT A;  2KNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...