2K8EA

Solution nmr structure of protein of unknown function yegp from e. coli. ontario center for structural proteomics target ec0640_1_123 northeast structural genomics consortium target et102.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
116
structure length
116
Chain Sequence
GVIMAGWFELSKSSDNQFRFVLKAGNGETILTSELYTSKTSAEKGIASVRSNSPQEERYEKKTASNGKFYFNLKAANHQIIGSSQMYATAQSRETGIASVKANGTSQTVKDNTGSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0339 protein yegP
publication title Solution structure of protein yegP from Escherichia Coli.
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 31
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07411 DUF1508 Domain of unknown function (DUF1508)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.80 Mainly Beta Roll PH-domain like PH-domain like 2k8eA00
2K49A 2K8EA
chains in the Genus database with same CATH superfamily
3PVWA 2FJUB 1X1GA 4OSNA 2ZPYA 3QWMA 4B6HA 1ZSQA 1NU2A 1UNQA 4HDQA 2VRWB 2ADZA 1T77A 5D3WA 4HB0B 3T06A 2ELBA 3ULBA 4WSFA 2GCJA 4TKNA 4GNKB 3U8ZA 3ZDTA 1X05A 1V5MA 2D9VA 2KUQA 2X18A 1TXDA 1K5DB 1RRPB 3KRXA 1XODA 2I5FA 1ISNA 4ZRIA 1E5WA 2I1KA 2RGNB 4HAWB 2DHIA 2RRFA 5KQ1A 2YRYA 2K2UA 1B55A 2UZRA 2P0HA 5C79A 3FEHA 2KGXB 1OMWA 4YONA 2J59M 4WJ7A 4QJ3B 4F7GA 2MKRA 3UZTA 1EGXA 5D3VA 3HW2B 5FI0A 1U5FA 2COCA 1X1FA 3F0WA 1EF1A 5EFXA 2YF0A 4IAPA 1SGHA 4QXAB 5L81A 1M7EA 1U2BA 1MIXA 3G9WA 3MDBC 3PZDA 5CLLB 2YS1A 3CIKA 2W2XD 2P8VA 3U7DA 3NSUA 2M38A 1XX0A 3HK0A 2NZ8B 3B77A 2OTXA 4DX8A 2DKQA 2NMBA 2UVMA 4CHMA 1WJMA 2Y7BA 4HB2B 1QQGA 3V5WA 1FGYA 2D9WA 3A98B 2GS0A 5D27A 2R0DA 5DHFB 3NW8A 1W1GA 3GYPA 2I1JA 1V88A 1FGZA 3U12A 1DBHA 2RNRB 3A8QA 1GC7A 1PLSA 4TYZA 2RVBB 1MAIA 2P0FA 4D6WA 4DBBA 3DCXA 2W2WA 3DXEA 4Y94A 2YT2A 2CRFA 1U29A 2Z0QA 1ZM0A 2DX1A 4MY6A 1FOEA 3VOQA 1LB1A 1WI1A 1BWNA 4HAVB 5D3YA 3TO1A 5HE2A 4A6FB 1EVHA 3TVVA 5HE3A 1M7RA 3RCPA 4IOYX 3TFMA 1XR0B 1UPRA 2D2QA 4GMXB 2Z4DA 2Z0OA 1FHOA 4EMOA 2L1CA 2DTCA 1XCGA 2K2JA 2MDXA 1W1HA 2D10A 2G35A 2GCLA 2HE7A 1WGUA 2R09A 4CHJA 3ODXA 2EMTA 2CY5A 3M1IB 3TCAA 1Y5OA 5C5BB 3FM8C 1ZC3B 1FHXA 2D9YA 4A5KA 4P7IA 1MI1A 3TW1A 5I2MA 4L1RA 4PQ0A 3PVUA 3FVCA 1EAZA 1UNRA 3A58A 2R2YA 1AQCA 2YS3A 4ZRJA 4GPTB 2HTHB 2XQNM 2EMSA 4GZUA 4DX90 5J3QA 2RSGA 1NTVA 5KQ4A 2D9XA 2NBVA 3QIJA 1NTYA 1PMSA 3SNHA 5DHAB 1X11A 2BCJA 1OY2A 3HSAA 3BJIA 5LG4B 1H4RA 2DLWA 2GUMA 2YSZA 2H7EA 2FJLA 3SYXA 2COAA 3PSCA 1P6SA 2MWNB 3NWAA 4HAUB 1V5PA 5CLQB 1Y19B 3WYFB 2UZSA 4CSQA 2M14A 1NI2A 5DI9B 5DIFB 3NWDA 2D11A 1PFJA 1I2HA 2LULA 1AWEA 1BAKA 2CODA 2QKLA 4KHOA 4IFSA 2QKMA 4D0NB 2CAYA 3KZ1A 1MIZB 4HATB 4HAXB 2LKOA 2Y8GA 2IFSA 2JP2A 2KCJA 3ODOA 4Z2NA 3D8FA 1MK7B 1GC6A 3SV1A 4NSWA 1U5DA 4K2PA 4A6HA 3PP2A 3DXDA 2EJ8A 1J19A 2LOZA 2N23A 5JHHA 4H8SA 3LJUX 5C6RA 3FSSA 4YL8A 1K5GB 2K49A 2ZKMX 1V5UA 5LONB 5JP4A 2EC1A 2Z59A 3GYOA 2VSZA 3AJ4A 3KSYA 2ROVA 2L2IA 4ZRKA 4MT7A 5I2SA 1DDMA 1N3HA 1P3RA 1H10A 3PG7A 4HAZB 2YVCA 2DHJA 1I7AA 1XD4A 4XWXA 3SO6A 2Q13A 5J3TA 3P6AA 1ZYIA 2KIGA 4HAYB 2KIEA 3KY9A 2DHKA 4DXAB 4Z2MB 5LOPB 4QJ5B 3A8PA 2AL6A 3AU5A 2Z0PA 3ULCA 1LW3A 1V61A 4EKUA 2I5CA 4GN1A 2LOXA 2N0YA 3VIAA 5KCVA 3ML4A 4K81A 4HHVA 5M4YB 1DROA 1ZC4B 3HIEA 5HE1A 4HSIA 1SHCA 3PVLA 4BBKA 2D4QA 2MFQA 4KVGB 4OT1A 1Z87A 2D9ZA 3P7ZA 1MPHA 2DA0A 1RJ2A 4KAXB 1MKEA 1J0WA 2Z14A 1DDVA 2E2XA 5FI1A 1W1DA 1XKEA 3D8EA 2COFA 2ELAA 2Y8FA 5JHGA 3SUZA 1UNPA 5J3YA 1WVHA 2DYNA 2DYQA 2YT1A 2YT0A 1U5EA 2DX5A 2RUKB 1BTKA 1KZGA 4A6KA 4EJNA 1P5TA 3X23A 2KUPA 3OHMB 1GG3A 4DIXA 1TJ6A 4F7HA 3BINA 2P0DA 4KHBA 2J0MA 4NY0A 5JLJB 4F7UP 1ZVRA 1DYNA 2GJYA 1IRSA 2KR0A 4MK0A 3HQCA 3N7CA 2AEHA 1KZ7A 4K17A 3F5RA 1FAOA 3QBVB 2J0JA 1BTNA 4HB3B 2LG1A 4KHBB 2DFKA 3DXCA 1QC6A 1FB8A 1WGQA 5GOWB 4WVFB 2ROZB 4GXBA 3O96A 4HB4B 2DKPA 4L6EA 5IRSA 4GOUA 3CXBB 4PNKA 2J0KA 1KI1B 3PEGA 2K00A 1FHWA 2DN6A 2YS5A 2RLOA 2LYDA 2PZ1A 4A6FA 1U27A 4HDOA 4K2OA 3IVFA 3MPXA 4GMVA 5DH9B 2VKIA 4QJ4B 1UEFA 1DDWA 3KRWA 3WA0A 2IYBA 1OQNA 3AU4A 1TQZA 1MK9B 2OQBA 1WJ1A 5HE0A 3ODWA 1Q67A 2W2XC 1V89A 3OANA 2Z13A 1UPQA 5C16A 2V76A 4KHAA 3D8DA 3NWFA 2H7DA 4C0AA 2CY4A 5C5BA 1U5GA 4CYEA 1WG7A 5D3XA 3ZVRA 2K8EA 1X86A
chains in the Genus database with same CATH topology
4KHOA 4HSIA 2FJUB 1ZYIA 2KIGA 3NW8A 4IFSA 2K49A 2GCLA 2ZKMX 3GYPA 2KIEA 4OSNA 4KHBA 2Z59A 3GYOA 4OT1A 3U12A 5IRSA 2RRFA 4GOUA 4Z2MB 4QJ5B 3NWAA 2KR0A 4Z2NA 2NBVA 3TO1A 3TVVA 2Z13A 4CSQA 5I2SA 4IOYX 4KHAA 4QJ3B 3NWFA 4D6WA 2Z14A 3NWDA 3TW1A 2Z4DA 5I2MA 2GCJA 4GNKB 4L1RA 4PQ0A 4QJ4B 3FVCA 2YT2A 3OHMB 4KHBB 4DIXA 5M4YB 2KUQA 2R2YA 3A58A 5LG4B 2GUMA 3HIEA 4QXAB 2K8EA 3FSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K49 A;  2K8E A; 
#chains in the Genus database with same CATH topology
 3PVW A;  2FJU B;  1X1G A;  4OSN A;  2ZPY A;  3QWM A;  4B6H A;  1ZSQ A;  1NU2 A;  1UNQ A;  4HDQ A;  2VRW B;  2ADZ A;  1T77 A;  5D3W A;  4HB0 B;  3T06 A;  2ELB A;  3ULB A;  4WSF A;  2GCJ A;  4TKN A;  4GNK B;  3U8Z A;  3ZDT A;  1X05 A;  1V5M A;  2D9V A;  2KUQ A;  2X18 A;  1TXD A;  1K5D B;  1RRP B;  3KRX A;  1XOD A;  2I5F A;  1ISN A;  4ZRI A;  1E5W A;  2I1K A;  2RGN B;  4HAW B;  2DHI A;  2RRF A;  5KQ1 A;  2YRY A;  2K2U A;  1B55 A;  2UZR A;  2P0H A;  5C79 A;  3FEH A;  2KGX B;  1OMW A;  4YON A;  2J59 M;  4WJ7 A;  4QJ3 B;  4F7G A;  2MKR A;  3UZT A;  1EGX A;  5D3V A;  3HW2 B;  5FI0 A;  1U5F A;  2COC A;  1X1F A;  3F0W A;  1EF1 A;  5EFX A;  2YF0 A;  4IAP A;  1SGH A;  4QXA B;  5L81 A;  1M7E A;  1U2B A;  1MIX A;  3G9W A;  3MDB C;  3PZD A;  5CLL B;  2YS1 A;  3CIK A;  2W2X D;  2P8V A;  3U7D A;  3NSU A;  2M38 A;  1XX0 A;  3HK0 A;  2NZ8 B;  3B77 A;  2OTX A;  4DX8 A;  2DKQ A;  2NMB A;  2UVM A;  4CHM A;  1WJM A;  2Y7B A;  4HB2 B;  1QQG A;  3V5W A;  1FGY A;  2D9W A;  3A98 B;  2GS0 A;  5D27 A;  2R0D A;  5DHF B;  3NW8 A;  1W1G A;  3GYP A;  2I1J A;  1V88 A;  1FGZ A;  3U12 A;  1DBH A;  2RNR B;  3A8Q A;  1GC7 A;  1PLS A;  4TYZ A;  2RVB B;  1MAI A;  2P0F A;  4D6W A;  4DBB A;  3DCX A;  2W2W A;  3DXE A;  4Y94 A;  2YT2 A;  2CRF A;  1U29 A;  2Z0Q A;  1ZM0 A;  2DX1 A;  4MY6 A;  1FOE A;  3VOQ A;  1LB1 A;  1WI1 A;  1BWN A;  4HAV B;  5D3Y A;  3TO1 A;  5HE2 A;  4A6F B;  1EVH A;  3TVV A;  5HE3 A;  1M7R A;  3RCP A;  4IOY X;  3TFM A;  1XR0 B;  1UPR A;  2D2Q A;  4GMX B;  2Z4D A;  2Z0O A;  1FHO A;  4EMO A;  2L1C A;  2DTC A;  1XCG A;  2K2J A;  2MDX A;  1W1H A;  2D10 A;  2G35 A;  2GCL A;  2HE7 A;  1WGU A;  2R09 A;  4CHJ A;  3ODX A;  2EMT A;  2CY5 A;  3M1I B;  3TCA A;  1Y5O A;  5C5B B;  3FM8 C;  1ZC3 B;  1FHX A;  2D9Y A;  4A5K A;  4P7I A;  1MI1 A;  3TW1 A;  5I2M A;  4L1R A;  4PQ0 A;  3PVU A;  3FVC A;  1EAZ A;  1UNR A;  3A58 A;  2R2Y A;  1AQC A;  2YS3 A;  4ZRJ A;  4GPT B;  2HTH B;  2XQN M;  2EMS A;  4GZU A;  4DX9 0;  5J3Q A;  2RSG A;  1NTV A;  5KQ4 A;  2D9X A;  2NBV A;  3QIJ A;  1NTY A;  1PMS A;  3SNH A;  5DHA B;  1X11 A;  2BCJ A;  1OY2 A;  3HSA A;  3BJI A;  5LG4 B;  1H4R A;  2DLW A;  2GUM A;  2YSZ A;  2H7E A;  2FJL A;  3SYX A;  2COA A;  3PSC A;  1P6S A;  2MWN B;  3NWA A;  4HAU B;  1V5P A;  5CLQ B;  1Y19 B;  3WYF B;  2UZS A;  4CSQ A;  2M14 A;  1NI2 A;  5DI9 B;  5DIF B;  3NWD A;  2D11 A;  1PFJ A;  1I2H A;  2LUL A;  1AWE A;  1BAK A;  2COD A;  2QKL A;  4KHO A;  4IFS A;  2QKM A;  4D0N B;  2CAY A;  3KZ1 A;  1MIZ B;  4HAT B;  4HAX B;  2LKO A;  2Y8G A;  2IFS A;  2JP2 A;  2KCJ A;  3ODO A;  4Z2N A;  3D8F A;  1MK7 B;  1GC6 A;  3SV1 A;  4NSW A;  1U5D A;  4K2P A;  4A6H A;  3PP2 A;  3DXD A;  2EJ8 A;  1J19 A;  2LOZ A;  2N23 A;  5JHH A;  4H8S A;  3LJU X;  5C6R A;  3FSS A;  4YL8 A;  1K5G B;  2K49 A;  2ZKM X;  1V5U A;  5LON B;  5JP4 A;  2EC1 A;  2Z59 A;  3GYO A;  2VSZ A;  3AJ4 A;  3KSY A;  2ROV A;  2L2I A;  4ZRK A;  4MT7 A;  5I2S A;  1DDM A;  1N3H A;  1P3R A;  1H10 A;  3PG7 A;  4HAZ B;  2YVC A;  2DHJ A;  1I7A A;  1XD4 A;  4XWX A;  3SO6 A;  2Q13 A;  5J3T A;  3P6A A;  1ZYI A;  2KIG A;  4HAY B;  2KIE A;  3KY9 A;  2DHK A;  4DXA B;  4Z2M B;  5LOP B;  4QJ5 B;  3A8P A;  2AL6 A;  3AU5 A;  2Z0P A;  3ULC A;  1LW3 A;  1V61 A;  4EKU A;  2I5C A;  4GN1 A;  2LOX A;  2N0Y A;  3VIA A;  5KCV A;  3ML4 A;  4K81 A;  4HHV A;  5M4Y B;  1DRO A;  1ZC4 B;  3HIE A;  5HE1 A;  4HSI A;  1SHC A;  3PVL A;  4BBK A;  2D4Q A;  2MFQ A;  4KVG B;  4OT1 A;  1Z87 A;  2D9Z A;  3P7Z A;  1MPH A;  2DA0 A;  1RJ2 A;  4KAX B;  1MKE A;  1J0W A;  2Z14 A;  1DDV A;  2E2X A;  5FI1 A;  1W1D A;  1XKE A;  3D8E A;  2COF A;  2ELA A;  2Y8F A;  5JHG A;  3SUZ A;  1UNP A;  5J3Y A;  1WVH A;  2DYN A;  2DYQ A;  2YT1 A;  2YT0 A;  1U5E A;  2DX5 A;  2RUK B;  1BTK A;  1KZG A;  4A6K A;  4EJN A;  1P5T A;  3X23 A;  2KUP A;  3OHM B;  1GG3 A;  4DIX A;  1TJ6 A;  4F7H A;  3BIN A;  2P0D A;  4KHB A;  2J0M A;  4NY0 A;  5JLJ B;  4F7U P;  1ZVR A;  1DYN A;  2GJY A;  1IRS A;  2KR0 A;  4MK0 A;  3HQC A;  3N7C A;  2AEH A;  1KZ7 A;  4K17 A;  3F5R A;  1FAO A;  3QBV B;  2J0J A;  1BTN A;  4HB3 B;  2LG1 A;  4KHB B;  2DFK A;  3DXC A;  1QC6 A;  1FB8 A;  1WGQ A;  5GOW B;  4WVF B;  2ROZ B;  4GXB A;  3O96 A;  4HB4 B;  2DKP A;  4L6E A;  5IRS A;  4GOU A;  3CXB B;  4PNK A;  2J0K A;  1KI1 B;  3PEG A;  2K00 A;  1FHW A;  2DN6 A;  2YS5 A;  2RLO A;  2LYD A;  2PZ1 A;  4A6F A;  1U27 A;  4HDO A;  4K2O A;  3IVF A;  3MPX A;  4GMV A;  5DH9 B;  2VKI A;  4QJ4 B;  1UEF A;  1DDW A;  3KRW A;  3WA0 A;  2IYB A;  1OQN A;  3AU4 A;  1TQZ A;  1MK9 B;  2OQB A;  1WJ1 A;  5HE0 A;  3ODW A;  1Q67 A;  2W2X C;  1V89 A;  3OAN A;  2Z13 A;  1UPQ A;  5C16 A;  2V76 A;  4KHA A;  3D8D A;  3NWF A;  2H7D A;  4C0A A;  2CY4 A;  5C5B A;  1U5G A;  4CYE A;  1WG7 A;  5D3X A;  3ZVR A;  2K8E A;  1X86 A; 
#chains in the Genus database with same CATH homology
 4KHO A;  4HSI A;  2FJU B;  1ZYI A;  2KIG A;  3NW8 A;  4IFS A;  2K49 A;  2GCL A;  2ZKM X;  3GYP A;  2KIE A;  4OSN A;  4KHB A;  2Z59 A;  3GYO A;  4OT1 A;  3U12 A;  5IRS A;  2RRF A;  4GOU A;  4Z2M B;  4QJ5 B;  3NWA A;  2KR0 A;  4Z2N A;  2NBV A;  3TO1 A;  3TVV A;  2Z13 A;  4CSQ A;  5I2S A;  4IOY X;  4KHA A;  4QJ3 B;  3NWF A;  4D6W A;  2Z14 A;  3NWD A;  3TW1 A;  2Z4D A;  5I2M A;  2GCJ A;  4GNK B;  4L1R A;  4PQ0 A;  4QJ4 B;  3FVC A;  2YT2 A;  3OHM B;  4KHB B;  4DIX A;  5M4Y B;  2KUQ A;  2R2Y A;  3A58 A;  5LG4 B;  2GUM A;  3HIE A;  4QXA B;  2K8E A;  3FSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...