2K92A

Structural modification of acyl carrier protein by butyryl group
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGQQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural modification of acyl carrier protein by butyryl group.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k92A00
2KORA 2VSQA 4R0MA 4BPGA 4MRTC 3EJDA 2K0XA 2GDXA 1T8KA 3CE7A 2FAEA 5EJDA 1AF8A 5KP8B 4PWVB 2EHTA 2AF8A 2KOOA 2JU2A 2N50A 1ACPA 2KG8A 2CG5B 2KWLA 2EHSA 2MVVA 2MD9A 2KGCA 1KLPA 2AFEA 2LTEA 2KOQA 4H2XC 3GZMA 4HKGA 5HVCA 2M5RA 3LMOA 2MR7A 2FVAA 4H2WC 2MR8A 1L0HA 2MF4A 2LL8A 1X3OA 3EJEA 2KOSA 3GZLA 1DNYA 1F80D 2MVUA 2PNGA 2KGDA 2GDWA 2LKIA 5HV8A 4BPHA 4PXHB 2N5HA 2XZ1C 3RG2A 1DV5A 4IZ6A 4CA3A 2LOLA 1HY8A 2FADA 2KGAA 2QNWA 2LMLA 2FVEA 2K93A 2L22A 2X2BA 1HQBA 2KOPA 2N6YA 2L0QA 4DG9A 2FVFA 2FACA 2JGPA 2JQ4A 4H2YC 2LIUA 2DNWA 2L4BA 2KG6A 2ROQA 2K2QA 2CNRA 2N5IA 1VKUA 2K92A 2N6ZA 3NY7B 5KP7B 5KP6B 2L9FA 2FHSC 2FQ1A 2KG9A 2KW2A 2N98A 2XZ0D 2LIWA 4BPFA 2JU1A 2GDYA 2MY5A 2FQ2A 1OR5A 2AFDA 2CGQA 2CQ8A 4NEOA 2AVAA 2KGEA 2K0YA 2LPKA 2FQ0A 1NQ4A 3EJBA 1L0IA 5CZDB 2K94A 2KR5A
chains in the Genus database with same CATH superfamily
1VQOP 4R0MA 4BPGA 2GZGA 1VQ7P 1BAJA 1VQ8P 1AF8A 5KP8B 4PWVB 2EHTA 2AF8A 3DS2A 2N50A 3CCQP 1ACPA 2EHSA 3I56P 2LTEA 4U0DA 2NO8A 3GZMA 4XFXA 4HKGA 3VRLC 5I4TG 2GYKA 2EIAA 1AUMA 3GZLA 1Q86Q 2JAZA 1S72P 2PEJA 2DGYA 5HGLA 3DTJA 4IZ6A 3HZQA 2BHVA 1HY8A 5EW5E 2FADA 1KQSO 2QNWA 1VQ4P 1GXGA 1HQBA 2KOPA 3CCVP 1YJNP 3WBHA 2JGPA 3E2DA 2ROQA 3P05A 2CNRA 4QKOA 1QRJA 3CCRP 2K92A 3NTEA 2L6EA 2CWOA 2PEMA 3CD6P 3OW2O 4U0BA 3DPHA 2JYLA 2L9FA 2GZEA 1K9MQ 1VQMP 3CPWO 2LIWA 2OTLP 4UHPB 1YHQP 2QEXP 2AFDA 3G26A 2CGQA 2JBGA 3CCLP 3MGEA 2KORA 3G1GA 4MRTC 2GDXA 1T8KA 4WYMA 1RO2A 2VLPA 2Z44A 1GXHA 2MVVA 1IMQA 1K8AQ 4XFZA 4QNBA 2WPTA 1Q81Q 2E1MA 2OTJP 2FVAA 5HGMA 2MR8A 2LL8A 2KOSA 3G29A 2PEIA 1DNYA 3RG6C 2KGDA 2GDWA 5HV8A 4BPHA 4PXHB 4U0FA 1YJ9P 3Q20A 3RG2A 3CCEP 1DV5A 4CA3A 4PH0A 2LOLA 1VQ9P 1D1DA 1GPJA 1UNKA 1RNIA 2L22A 5F2OA 3HYBA 2FACA 1Z6MA 1K73Q 2DNWA 2L4BA 2KG6A 2K2QA 4U0EA 5HGOA 2JO0A 4XROA 5BS2A 1A43A 2M8PA 2ERHA 2K0DX 3NY7B 5DCKA 5BS1A 5KP6B 2FHSC 1RO0A 1UJZA 1AYIA 4GR6A 3B4QA 4BPFA 2FQ2A 1IMPA 2CQ8A 2AVAA 3CCUP 2KGEA 2K0YA 3CMAP 1CEIA 2JYGA 1VQNP 3EJDA 2Z45A 3CE7A 1M1KQ 2PEQA 5EJDA 2M8NA 4PH1A 2JU2A 4U0AA 2KWLA 1A8OA 1VQPP 2KOQA 2PY8A 1M6EX 4H2XC 3LMOA 3DS5A 2MR7A 4H2WC 5JPAA 1L0HA 2MF4A 3DS4A 3G71P 1QVFO 1X3OA 3G0VA 3CC7P 2VLOA 4XRQA 3CC2P 1IUQA 2MVUA 2PNGA 2LF4A 1EIAA 2N5HA 3I55P 4GR2A 3CXCO 3DS3A 3DS0A 2PEKA 2KGAA 2GZFA 2LMLA 2FVEA 2K93A 2X2BA 2EFJA 1YITP 4DG9A 2JQ4A 2LIUA 2GZJA 1VHNA 4U0CA 1BXIA 1Q7YQ 1M90Q 4IPYA 1M74A 2KG9A 2KW2A 1E0HA 2PEOA 1ZMBA 2JU1A 2BUOA 1OR5A 3H4EA 3GKLC 2LPKA 1NQ4A 1VQLP 1VQKP 3EJBA 1L0IA 5F2KA 5CZDB 3M1MA 2N6YA 3G6EP 2VSQA 2K0XA 2FAEA 1VQ6P 3H0DA 3LRYA 2KOOA 2KG8A 2CG5B 3CCSP 2PENA 1YIJP 2MD9A 1NJIQ 2KGCA 1KLPA 2AFEA 2KODA 5HGNA 3CCMP 2M8LA 1KD1Q 5HVCA 2M5RA 1VQ5P 2XXMA 2OARA 3G28A 2P9XA 3CMEP 1EOQA 3EJEA 1YI2P 1MZ8A 2VLNA 2Z46A 2JB0A 1F80D 2K5XA 4M0IA 1N8RQ 2LKIA 7CEIA 1W2BO 4F37A 2XZ1C 4XFYA 1M6NA 1JJ2O 1E6JP 1ZNVA 3U43A 2GZIA 3H47A 4COCA 1QVGO 2L0QA 1Q82Q 2FVFA 1FR2A 4H2YC 2XV6A 4COPA 2N5IA 3GJNA 1VKUA 3G1IA 3G21A 2N6ZA 1YJWP 2VLQA 1EMVA 3DS1A 5KP7B 3G4SP 2FQ1A 2N98A 2ONTA 3CCJP 2XZ0D 2EG5A 5F2NA 2GDYA 2MY5A 1K30A 3CC4P 4NEOA 2XT1A 2FQ0A 1KC8Q 3B5IA 2QA4P 2K94A 2KR5A
chains in the Genus database with same CATH topology
2KORA 2VSQA 4R0MA 4BPGA 4MRTC 3EJDA 2K0XA 2GDXA 1T8KA 3CE7A 2FAEA 5EJDA 1AF8A 5KP8B 4PWVB 2EHTA 2AF8A 2KOOA 2JU2A 2N50A 1ACPA 2KG8A 2CG5B 2KWLA 2EHSA 2MVVA 2MD9A 2KGCA 1KLPA 2AFEA 2LTEA 2KOQA 4H2XC 3GZMA 4HKGA 5HVCA 2M5RA 3LMOA 2MR7A 2FVAA 4H2WC 2MR8A 1L0HA 2MF4A 2LL8A 1X3OA 3EJEA 2KOSA 3GZLA 1DNYA 1F80D 2MVUA 2PNGA 2KGDA 2GDWA 2LKIA 5HV8A 4BPHA 4PXHB 2N5HA 2XZ1C 3RG2A 1DV5A 4IZ6A 4CA3A 2LOLA 1HY8A 2FADA 2KGAA 2QNWA 2LMLA 2FVEA 2K93A 2L22A 2X2BA 1HQBA 2KOPA 2N6YA 2L0QA 4DG9A 2FVFA 2FACA 2JGPA 2JQ4A 4H2YC 2LIUA 2DNWA 2L4BA 2KG6A 2ROQA 2K2QA 2CNRA 2N5IA 1VKUA 2K92A 2N6ZA 3NY7B 5KP7B 5KP6B 2L9FA 2FHSC 2FQ1A 2KG9A 2KW2A 2N98A 2XZ0D 2LIWA 4BPFA 2JU1A 2GDYA 2MY5A 2FQ2A 1OR5A 2AFDA 2CGQA 2CQ8A 4NEOA 2AVAA 2KGEA 2K0YA 2LPKA 2FQ0A 1NQ4A 3EJBA 1L0IA 5CZDB 2K94A 2KR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOR A;  2VSQ A;  4R0M A;  4BPG A;  4MRT C;  3EJD A;  2K0X A;  2GDX A;  1T8K A;  3CE7 A;  2FAE A;  5EJD A;  1AF8 A;  5KP8 B;  4PWV B;  2EHT A;  2AF8 A;  2KOO A;  2JU2 A;  2N50 A;  1ACP A;  2KG8 A;  2CG5 B;  2KWL A;  2EHS A;  2MVV A;  2MD9 A;  2KGC A;  1KLP A;  2AFE A;  2LTE A;  2KOQ A;  4H2X C;  3GZM A;  4HKG A;  5HVC A;  2M5R A;  3LMO A;  2MR7 A;  2FVA A;  4H2W C;  2MR8 A;  1L0H A;  2MF4 A;  2LL8 A;  1X3O A;  3EJE A;  2KOS A;  3GZL A;  1DNY A;  1F80 D;  2MVU A;  2PNG A;  2KGD A;  2GDW A;  2LKI A;  5HV8 A;  4BPH A;  4PXH B;  2N5H A;  2XZ1 C;  3RG2 A;  1DV5 A;  4IZ6 A;  4CA3 A;  2LOL A;  1HY8 A;  2FAD A;  2KGA A;  2QNW A;  2LML A;  2FVE A;  2K93 A;  2L22 A;  2X2B A;  1HQB A;  2KOP A;  2N6Y A;  2L0Q A;  4DG9 A;  2FVF A;  2FAC A;  2JGP A;  2JQ4 A;  4H2Y C;  2LIU A;  2DNW A;  2L4B A;  2KG6 A;  2ROQ A;  2K2Q A;  2CNR A;  2N5I A;  1VKU A;  2K92 A;  2N6Z A;  3NY7 B;  5KP7 B;  5KP6 B;  2L9F A;  2FHS C;  2FQ1 A;  2KG9 A;  2KW2 A;  2N98 A;  2XZ0 D;  2LIW A;  4BPF A;  2JU1 A;  2GDY A;  2MY5 A;  2FQ2 A;  1OR5 A;  2AFD A;  2CGQ A;  2CQ8 A;  4NEO A;  2AVA A;  2KGE A;  2K0Y A;  2LPK A;  2FQ0 A;  1NQ4 A;  3EJB A;  1L0I A;  5CZD B;  2K94 A;  2KR5 A; 
#chains in the Genus database with same CATH topology
 1VQO P;  4R0M A;  4BPG A;  2GZG A;  1VQ7 P;  1BAJ A;  1VQ8 P;  1AF8 A;  5KP8 B;  4PWV B;  2EHT A;  2AF8 A;  3DS2 A;  2N50 A;  3CCQ P;  1ACP A;  2EHS A;  3I56 P;  2LTE A;  4U0D A;  2NO8 A;  3GZM A;  4XFX A;  4HKG A;  3VRL C;  5I4T G;  2GYK A;  2EIA A;  1AUM A;  3GZL A;  1Q86 Q;  2JAZ A;  1S72 P;  2PEJ A;  2DGY A;  5HGL A;  3DTJ A;  4IZ6 A;  3HZQ A;  2BHV A;  1HY8 A;  5EW5 E;  2FAD A;  1KQS O;  2QNW A;  1VQ4 P;  1GXG A;  1HQB A;  2KOP A;  3CCV P;  1YJN P;  3WBH A;  2JGP A;  3E2D A;  2ROQ A;  3P05 A;  2CNR A;  4QKO A;  1QRJ A;  3CCR P;  2K92 A;  3NTE A;  2L6E A;  2CWO A;  2PEM A;  3CD6 P;  3OW2 O;  4U0B A;  3DPH A;  2JYL A;  2L9F A;  2GZE A;  1K9M Q;  1VQM P;  3CPW O;  2LIW A;  2OTL P;  4UHP B;  1YHQ P;  2QEX P;  2AFD A;  3G26 A;  2CGQ A;  2JBG A;  3CCL P;  3MGE A;  2KOR A;  3G1G A;  4MRT C;  2GDX A;  1T8K A;  4WYM A;  1RO2 A;  2VLP A;  2Z44 A;  1GXH A;  2MVV A;  1IMQ A;  1K8A Q;  4XFZ A;  4QNB A;  2WPT A;  1Q81 Q;  2E1M A;  2OTJ P;  2FVA A;  5HGM A;  2MR8 A;  2LL8 A;  2KOS A;  3G29 A;  2PEI A;  1DNY A;  3RG6 C;  2KGD A;  2GDW A;  5HV8 A;  4BPH A;  4PXH B;  4U0F A;  1YJ9 P;  3Q20 A;  3RG2 A;  3CCE P;  1DV5 A;  4CA3 A;  4PH0 A;  2LOL A;  1VQ9 P;  1D1D A;  1GPJ A;  1UNK A;  1RNI A;  2L22 A;  5F2O A;  3HYB A;  2FAC A;  1Z6M A;  1K73 Q;  2DNW A;  2L4B A;  2KG6 A;  2K2Q A;  4U0E A;  5HGO A;  2JO0 A;  4XRO A;  5BS2 A;  1A43 A;  2M8P A;  2ERH A;  2K0D X;  3NY7 B;  5DCK A;  5BS1 A;  5KP6 B;  2FHS C;  1RO0 A;  1UJZ A;  1AYI A;  4GR6 A;  3B4Q A;  4BPF A;  2FQ2 A;  1IMP A;  2CQ8 A;  2AVA A;  3CCU P;  2KGE A;  2K0Y A;  3CMA P;  1CEI A;  2JYG A;  1VQN P;  3EJD A;  2Z45 A;  3CE7 A;  1M1K Q;  2PEQ A;  5EJD A;  2M8N A;  4PH1 A;  2JU2 A;  4U0A A;  2KWL A;  1A8O A;  1VQP P;  2KOQ A;  2PY8 A;  1M6E X;  4H2X C;  3LMO A;  3DS5 A;  2MR7 A;  4H2W C;  5JPA A;  1L0H A;  2MF4 A;  3DS4 A;  3G71 P;  1QVF O;  1X3O A;  3G0V A;  3CC7 P;  2VLO A;  4XRQ A;  3CC2 P;  1IUQ A;  2MVU A;  2PNG A;  2LF4 A;  1EIA A;  2N5H A;  3I55 P;  4GR2 A;  3CXC O;  3DS3 A;  3DS0 A;  2PEK A;  2KGA A;  2GZF A;  2LML A;  2FVE A;  2K93 A;  2X2B A;  2EFJ A;  1YIT P;  4DG9 A;  2JQ4 A;  2LIU A;  2GZJ A;  1VHN A;  4U0C A;  1BXI A;  1Q7Y Q;  1M90 Q;  4IPY A;  1M74 A;  2KG9 A;  2KW2 A;  1E0H A;  2PEO A;  1ZMB A;  2JU1 A;  2BUO A;  1OR5 A;  3H4E A;  3GKL C;  2LPK A;  1NQ4 A;  1VQL P;  1VQK P;  3EJB A;  1L0I A;  5F2K A;  5CZD B;  3M1M A;  2N6Y A;  3G6E P;  2VSQ A;  2K0X A;  2FAE A;  1VQ6 P;  3H0D A;  3LRY A;  2KOO A;  2KG8 A;  2CG5 B;  3CCS P;  2PEN A;  1YIJ P;  2MD9 A;  1NJI Q;  2KGC A;  1KLP A;  2AFE A;  2KOD A;  5HGN A;  3CCM P;  2M8L A;  1KD1 Q;  5HVC A;  2M5R A;  1VQ5 P;  2XXM A;  2OAR A;  3G28 A;  2P9X A;  3CME P;  1EOQ A;  3EJE A;  1YI2 P;  1MZ8 A;  2VLN A;  2Z46 A;  2JB0 A;  1F80 D;  2K5X A;  4M0I A;  1N8R Q;  2LKI A;  7CEI A;  1W2B O;  4F37 A;  2XZ1 C;  4XFY A;  1M6N A;  1JJ2 O;  1E6J P;  1ZNV A;  3U43 A;  2GZI A;  3H47 A;  4COC A;  1QVG O;  2L0Q A;  1Q82 Q;  2FVF A;  1FR2 A;  4H2Y C;  2XV6 A;  4COP A;  2N5I A;  3GJN A;  1VKU A;  3G1I A;  3G21 A;  2N6Z A;  1YJW P;  2VLQ A;  1EMV A;  3DS1 A;  5KP7 B;  3G4S P;  2FQ1 A;  2N98 A;  2ONT A;  3CCJ P;  2XZ0 D;  2EG5 A;  5F2N A;  2GDY A;  2MY5 A;  1K30 A;  3CC4 P;  4NEO A;  2XT1 A;  2FQ0 A;  1KC8 Q;  3B5I A;  2QA4 P;  2K94 A;  2KR5 A; 
#chains in the Genus database with same CATH homology
 2KOR A;  2VSQ A;  4R0M A;  4BPG A;  4MRT C;  3EJD A;  2K0X A;  2GDX A;  1T8K A;  3CE7 A;  2FAE A;  5EJD A;  1AF8 A;  5KP8 B;  4PWV B;  2EHT A;  2AF8 A;  2KOO A;  2JU2 A;  2N50 A;  1ACP A;  2KG8 A;  2CG5 B;  2KWL A;  2EHS A;  2MVV A;  2MD9 A;  2KGC A;  1KLP A;  2AFE A;  2LTE A;  2KOQ A;  4H2X C;  3GZM A;  4HKG A;  5HVC A;  2M5R A;  3LMO A;  2MR7 A;  2FVA A;  4H2W C;  2MR8 A;  1L0H A;  2MF4 A;  2LL8 A;  1X3O A;  3EJE A;  2KOS A;  3GZL A;  1DNY A;  1F80 D;  2MVU A;  2PNG A;  2KGD A;  2GDW A;  2LKI A;  5HV8 A;  4BPH A;  4PXH B;  2N5H A;  2XZ1 C;  3RG2 A;  1DV5 A;  4IZ6 A;  4CA3 A;  2LOL A;  1HY8 A;  2FAD A;  2KGA A;  2QNW A;  2LML A;  2FVE A;  2K93 A;  2L22 A;  2X2B A;  1HQB A;  2KOP A;  2N6Y A;  2L0Q A;  4DG9 A;  2FVF A;  2FAC A;  2JGP A;  2JQ4 A;  4H2Y C;  2LIU A;  2DNW A;  2L4B A;  2KG6 A;  2ROQ A;  2K2Q A;  2CNR A;  2N5I A;  1VKU A;  2K92 A;  2N6Z A;  3NY7 B;  5KP7 B;  5KP6 B;  2L9F A;  2FHS C;  2FQ1 A;  2KG9 A;  2KW2 A;  2N98 A;  2XZ0 D;  2LIW A;  4BPF A;  2JU1 A;  2GDY A;  2MY5 A;  2FQ2 A;  1OR5 A;  2AFD A;  2CGQ A;  2CQ8 A;  4NEO A;  2AVA A;  2KGE A;  2K0Y A;  2LPK A;  2FQ0 A;  1NQ4 A;  3EJB A;  1L0I A;  5CZD B;  2K94 A;  2KR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...