2K92A

Structural modification of acyl carrier protein by butyryl group
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGQQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural modification of acyl carrier protein by butyryl group.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
molecule keywords Acyl carrier protein
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k92A00
2N50A 2L9FA 2FVAA 3LMOA 4BPGA 4NEOA 2KGDA 2KOOA 2KGAA 2EHTA 2LIUA 2ROQA 5HV8A 2AF8A 2CG5B 1F80D 2FQ1A 2MF4A 2LTEA 1L0HA 4BPHA 2JU1A 2N98A 4CA3A 2KOQA 2FVFA 2L0QA 4H2YC 5CZDB 2LKIA 2FAEA 5KP6B 2GDXA 2K94A 3GZLA 1HY8A 3CE7A 2XZ1C 4DG9A 2MVVA 2FACA 2KR5A 2LIWA 2GDWA 2PNGA 2CGQA 2JU2A 2N6ZA 2CNRA 5EJDA 2FQ0A 2KORA 1HQBA 2GDYA 2AFEA 4H2XC 2KOSA 3GZMA 2K2QA 4PXHB 5KP7B 1NQ4A 1AF8A 2K93A 1ACPA 2EHSA 1L0IA 4PWVB 2XZ0D 2M5RA 2JGPA 2FQ2A 2MD9A 4BPFA 2N5IA 2FHSC 1T8KA 2FADA 5HVCA 2CQ8A 1OR5A 2VSQA 2DNWA 2MR7A 2QNWA 1VKUA 2KG9A 2KW2A 3EJDA 2KGEA 2LPKA 2KG8A 2L22A 2FVEA 4H2WC 1DNYA 1X3OA 2MR8A 2LL8A 5KP8B 2KGCA 2KWLA 2N5HA 2AVAA 1KLPA 2K92A 1DV5A 2N6YA 2MY5A 2KOPA 2LMLA 2MVUA 2LOLA 4IZ6A 4R0MA 4HKGA 2AFDA 3EJBA 3EJEA 2X2BA 3NY7B 2K0YA 2JQ4A 4MRTC 3RG2A 2KG6A 2K0XA 2L4BA
chains in the Genus database with same CATH superfamily
3GJNA 1QVGO 2VLNA 5EW5E 2KGDA 5F2KA 2KGAA 2ROQA 2K0DX 2AF8A 2CG5B 2CWOA 2K5XA 3DS4A 5JPAA 2GZGA 1Z6MA 3H0DA 3B4QA 3I55P 4CA3A 1VQPP 5I4TG 2KOQA 1M74A 1EMVA 1AUMA 1IMQA 2GZJA 2L0QA 2LKIA 2GDXA 1IMPA 1E0HA 1HY8A 3P05A 2XZ1C 3G28A 4XRQA 1A8OA 2M8NA 2PNGA 3CC4P 1VQLP 2FQ0A 2KORA 4U0DA 1HQBA 2GDYA 2PEOA 2VLOA 1S72P 1IUQA 4PXHB 2Z46A 1KQSO 2K93A 2PENA 3DS5A 1L0IA 3I56P 1ZNVA 4BPFA 2GYKA 2L6EA 1OR5A 5BS2A 2MR7A 1VQ7P 2QNWA 4M0IA 1GXGA 3DS3A 3HYBA 3EJDA 3NTEA 1BAJA 3CCUP 3CD6P 3CXCO 2LL8A 5HGMA 5KP8B 2KGCA 2KWLA 2AVAA 1DV5A 2LMLA 2MVUA 1K8AQ 4IZ6A 2P9XA 4R0MA 4U0CA 3CC2P 4QKOA 4IPYA 2K0YA 3DPHA 5F2NA 1KC8Q 2JQ4A 2L4BA 5BS1A 3LMOA 1EIAA 4WYMA 5HGLA 1VQ4P 3VRLC 2PEMA 2NO8A 1CEIA 1W2BO 4PH1A 2FQ1A 2JAZA 5F2OA 2MF4A 2LTEA 1M90Q 2M8PA 2XT1A 2JU1A 3CCRP 2E1MA 2OTJP 3E2DA 2BHVA 4XROA 4H2YC 5CZDB 3CMEP 3CCVP 3CE7A 4GR2A 5DCKA 4DG9A 1GXHA 2JU2A 3HZQA 1YHQP 3OW2O 4COCA 1Q86Q 5HGOA 2AFEA 1FR2A 4F37A 2K2QA 3DS0A 5KP7B 3G21A 2EIAA 1ACPA 1E6JP 4U0EA 3G1GA 2DGYA 1YIJP 4U0FA 2N5IA 3DS1A 1ZMBA 2FADA 5HVCA 2VSQA 3G1IA 2M8LA 1MZ8A 1VKUA 2KGEA 4GR6A 3U43A 3CCQP 4H2WC 2JYGA 1Q82Q 2MR8A 3G4SP 2N5HA 1VQ5P 2MY5A 3G6EP 2LOLA 1BXIA 1M1KQ 3CCMP 2PEJA 4XFZA 2X2BA 4XFXA 2Z44A 5HGNA 1QVFO 1RNIA 1QRJA 4MRTC 1RO0A 3CMAP 2FVAA 4NEOA 2KOOA 4PH0A 3CCJP 2XV6A 3GKLC 2QEXP 3CCEP 1N8RQ 2ERHA 2KODA 1L0HA 4BPHA 2LF4A 2JO0A 4QNBA 1VQOP 3MGEA 5KP6B 2FAEA 2K94A 3GZLA 3DS2A 2MVVA 2FACA 2KR5A 2GDWA 2CGQA 1M6EX 2CNRA 2PEIA 3RG6C 1M6NA 1YI2P 3B5IA 2WPTA 2GZIA 4UHPB 1NQ4A 1AF8A 2GZEA 1KD1Q 3CCSP 2M5RA 1VQ9P 2MD9A 2Z45A 1AYIA 2FHSC 1VQMP 2ONTA 2BUOA 2CQ8A 2KG9A 2LPKA 2OTLP 2L22A 2FVEA 1DNYA 1X3OA 4COPA 1VHNA 2OARA 1UNKA 2K92A 4U0AA 2N6YA 2VLQA 1VQKP 3WBHA 3G26A 1YJNP 4HKGA 2PEQA 1K73Q 1A43A 3NY7B 3RG2A 2K0XA 2N50A 2L9FA 4BPGA 1EOQA 4XFYA 1YJ9P 2GZFA 2EHTA 2LIUA 4U0BA 5HV8A 7CEIA 2JYLA 1F80D 3H47A 1RO2A 2N98A 1VQNP 2QA4P 1JJ2O 2FVFA 3CPWO 1K30A 3CCLP 2LIWA 2EG5A 2N6ZA 2XXMA 5EJDA 2JBGA 3M1MA 3G71P 2EFJA 3G0VA 1D1DA 4H2XC 2KOSA 3GZMA 3CC7P 2JB0A 2EHSA 4PWVB 3G29A 2XZ0D 2JGPA 2FQ2A 1VQ6P 1UJZA 1T8KA 1Q7YQ 2DNWA 2KW2A 3DTJA 2KG8A 3H4EA 2VLPA 3LRYA 1YJWP 1KLPA 3Q20A 1VQ8P 2KOPA 1K9MQ 1GPJA 2PEKA 1Q81Q 1YITP 2AFDA 3EJBA 3EJEA 1NJIQ 2KG6A 2PY8A
chains in the Genus database with same CATH topology
2N50A 2L9FA 2FVAA 3LMOA 4BPGA 4NEOA 2KGDA 2KOOA 2KGAA 2EHTA 2LIUA 2ROQA 5HV8A 2AF8A 2CG5B 1F80D 2FQ1A 2MF4A 2LTEA 1L0HA 4BPHA 2JU1A 2N98A 4CA3A 2KOQA 2FVFA 2L0QA 4H2YC 5CZDB 2LKIA 2FAEA 5KP6B 2GDXA 2K94A 3GZLA 1HY8A 3CE7A 2XZ1C 4DG9A 2MVVA 2FACA 2KR5A 2LIWA 2GDWA 2PNGA 2CGQA 2JU2A 2N6ZA 2CNRA 5EJDA 2FQ0A 2KORA 1HQBA 2GDYA 2AFEA 4H2XC 2KOSA 3GZMA 2K2QA 4PXHB 5KP7B 1NQ4A 1AF8A 2K93A 1ACPA 2EHSA 1L0IA 4PWVB 2XZ0D 2M5RA 2JGPA 2FQ2A 2MD9A 4BPFA 2N5IA 2FHSC 1T8KA 2FADA 5HVCA 2CQ8A 1OR5A 2VSQA 2DNWA 2MR7A 2QNWA 1VKUA 2KG9A 2KW2A 3EJDA 2KGEA 2LPKA 2KG8A 2L22A 2FVEA 4H2WC 1DNYA 1X3OA 2MR8A 2LL8A 5KP8B 2KGCA 2KWLA 2N5HA 2AVAA 1KLPA 2K92A 1DV5A 2N6YA 2MY5A 2KOPA 2LMLA 2MVUA 2LOLA 4IZ6A 4R0MA 4HKGA 2AFDA 3EJBA 3EJEA 2X2BA 3NY7B 2K0YA 2JQ4A 4MRTC 3RG2A 2KG6A 2K0XA 2L4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N50 A;  2L9F A;  2FVA A;  3LMO A;  4BPG A;  4NEO A;  2KGD A;  2KOO A;  2KGA A;  2EHT A;  2LIU A;  2ROQ A;  5HV8 A;  2AF8 A;  2CG5 B;  1F80 D;  2FQ1 A;  2MF4 A;  2LTE A;  1L0H A;  4BPH A;  2JU1 A;  2N98 A;  4CA3 A;  2KOQ A;  2FVF A;  2L0Q A;  4H2Y C;  5CZD B;  2LKI A;  2FAE A;  5KP6 B;  2GDX A;  2K94 A;  3GZL A;  1HY8 A;  3CE7 A;  2XZ1 C;  4DG9 A;  2MVV A;  2FAC A;  2KR5 A;  2LIW A;  2GDW A;  2PNG A;  2CGQ A;  2JU2 A;  2N6Z A;  2CNR A;  5EJD A;  2FQ0 A;  2KOR A;  1HQB A;  2GDY A;  2AFE A;  4H2X C;  2KOS A;  3GZM A;  2K2Q A;  4PXH B;  5KP7 B;  1NQ4 A;  1AF8 A;  2K93 A;  1ACP A;  2EHS A;  1L0I A;  4PWV B;  2XZ0 D;  2M5R A;  2JGP A;  2FQ2 A;  2MD9 A;  4BPF A;  2N5I A;  2FHS C;  1T8K A;  2FAD A;  5HVC A;  2CQ8 A;  1OR5 A;  2VSQ A;  2DNW A;  2MR7 A;  2QNW A;  1VKU A;  2KG9 A;  2KW2 A;  3EJD A;  2KGE A;  2LPK A;  2KG8 A;  2L22 A;  2FVE A;  4H2W C;  1DNY A;  1X3O A;  2MR8 A;  2LL8 A;  5KP8 B;  2KGC A;  2KWL A;  2N5H A;  2AVA A;  1KLP A;  2K92 A;  1DV5 A;  2N6Y A;  2MY5 A;  2KOP A;  2LML A;  2MVU A;  2LOL A;  4IZ6 A;  4R0M A;  4HKG A;  2AFD A;  3EJB A;  3EJE A;  2X2B A;  3NY7 B;  2K0Y A;  2JQ4 A;  4MRT C;  3RG2 A;  2KG6 A;  2K0X A;  2L4B A; 
#chains in the Genus database with same CATH topology
 3GJN A;  1QVG O;  2VLN A;  5EW5 E;  2KGD A;  5F2K A;  2KGA A;  2ROQ A;  2K0D X;  2AF8 A;  2CG5 B;  2CWO A;  2K5X A;  3DS4 A;  5JPA A;  2GZG A;  1Z6M A;  3H0D A;  3B4Q A;  3I55 P;  4CA3 A;  1VQP P;  5I4T G;  2KOQ A;  1M74 A;  1EMV A;  1AUM A;  1IMQ A;  2GZJ A;  2L0Q A;  2LKI A;  2GDX A;  1IMP A;  1E0H A;  1HY8 A;  3P05 A;  2XZ1 C;  3G28 A;  4XRQ A;  1A8O A;  2M8N A;  2PNG A;  3CC4 P;  1VQL P;  2FQ0 A;  2KOR A;  4U0D A;  1HQB A;  2GDY A;  2PEO A;  2VLO A;  1S72 P;  1IUQ A;  4PXH B;  2Z46 A;  1KQS O;  2K93 A;  2PEN A;  3DS5 A;  1L0I A;  3I56 P;  1ZNV A;  4BPF A;  2GYK A;  2L6E A;  1OR5 A;  5BS2 A;  2MR7 A;  1VQ7 P;  2QNW A;  4M0I A;  1GXG A;  3DS3 A;  3HYB A;  3EJD A;  3NTE A;  1BAJ A;  3CCU P;  3CD6 P;  3CXC O;  2LL8 A;  5HGM A;  5KP8 B;  2KGC A;  2KWL A;  2AVA A;  1DV5 A;  2LML A;  2MVU A;  1K8A Q;  4IZ6 A;  2P9X A;  4R0M A;  4U0C A;  3CC2 P;  4QKO A;  4IPY A;  2K0Y A;  3DPH A;  5F2N A;  1KC8 Q;  2JQ4 A;  2L4B A;  5BS1 A;  3LMO A;  1EIA A;  4WYM A;  5HGL A;  1VQ4 P;  3VRL C;  2PEM A;  2NO8 A;  1CEI A;  1W2B O;  4PH1 A;  2FQ1 A;  2JAZ A;  5F2O A;  2MF4 A;  2LTE A;  1M90 Q;  2M8P A;  2XT1 A;  2JU1 A;  3CCR P;  2E1M A;  2OTJ P;  3E2D A;  2BHV A;  4XRO A;  4H2Y C;  5CZD B;  3CME P;  3CCV P;  3CE7 A;  4GR2 A;  5DCK A;  4DG9 A;  1GXH A;  2JU2 A;  3HZQ A;  1YHQ P;  3OW2 O;  4COC A;  1Q86 Q;  5HGO A;  2AFE A;  1FR2 A;  4F37 A;  2K2Q A;  3DS0 A;  5KP7 B;  3G21 A;  2EIA A;  1ACP A;  1E6J P;  4U0E A;  3G1G A;  2DGY A;  1YIJ P;  4U0F A;  2N5I A;  3DS1 A;  1ZMB A;  2FAD A;  5HVC A;  2VSQ A;  3G1I A;  2M8L A;  1MZ8 A;  1VKU A;  2KGE A;  4GR6 A;  3U43 A;  3CCQ P;  4H2W C;  2JYG A;  1Q82 Q;  2MR8 A;  3G4S P;  2N5H A;  1VQ5 P;  2MY5 A;  3G6E P;  2LOL A;  1BXI A;  1M1K Q;  3CCM P;  2PEJ A;  4XFZ A;  2X2B A;  4XFX A;  2Z44 A;  5HGN A;  1QVF O;  1RNI A;  1QRJ A;  4MRT C;  1RO0 A;  3CMA P;  2FVA A;  4NEO A;  2KOO A;  4PH0 A;  3CCJ P;  2XV6 A;  3GKL C;  2QEX P;  3CCE P;  1N8R Q;  2ERH A;  2KOD A;  1L0H A;  4BPH A;  2LF4 A;  2JO0 A;  4QNB A;  1VQO P;  3MGE A;  5KP6 B;  2FAE A;  2K94 A;  3GZL A;  3DS2 A;  2MVV A;  2FAC A;  2KR5 A;  2GDW A;  2CGQ A;  1M6E X;  2CNR A;  2PEI A;  3RG6 C;  1M6N A;  1YI2 P;  3B5I A;  2WPT A;  2GZI A;  4UHP B;  1NQ4 A;  1AF8 A;  2GZE A;  1KD1 Q;  3CCS P;  2M5R A;  1VQ9 P;  2MD9 A;  2Z45 A;  1AYI A;  2FHS C;  1VQM P;  2ONT A;  2BUO A;  2CQ8 A;  2KG9 A;  2LPK A;  2OTL P;  2L22 A;  2FVE A;  1DNY A;  1X3O A;  4COP A;  1VHN A;  2OAR A;  1UNK A;  2K92 A;  4U0A A;  2N6Y A;  2VLQ A;  1VQK P;  3WBH A;  3G26 A;  1YJN P;  4HKG A;  2PEQ A;  1K73 Q;  1A43 A;  3NY7 B;  3RG2 A;  2K0X A;  2N50 A;  2L9F A;  4BPG A;  1EOQ A;  4XFY A;  1YJ9 P;  2GZF A;  2EHT A;  2LIU A;  4U0B A;  5HV8 A;  7CEI A;  2JYL A;  1F80 D;  3H47 A;  1RO2 A;  2N98 A;  1VQN P;  2QA4 P;  1JJ2 O;  2FVF A;  3CPW O;  1K30 A;  3CCL P;  2LIW A;  2EG5 A;  2N6Z A;  2XXM A;  5EJD A;  2JBG A;  3M1M A;  3G71 P;  2EFJ A;  3G0V A;  1D1D A;  4H2X C;  2KOS A;  3GZM A;  3CC7 P;  2JB0 A;  2EHS A;  4PWV B;  3G29 A;  2XZ0 D;  2JGP A;  2FQ2 A;  1VQ6 P;  1UJZ A;  1T8K A;  1Q7Y Q;  2DNW A;  2KW2 A;  3DTJ A;  2KG8 A;  3H4E A;  2VLP A;  3LRY A;  1YJW P;  1KLP A;  3Q20 A;  1VQ8 P;  2KOP A;  1K9M Q;  1GPJ A;  2PEK A;  1Q81 Q;  1YIT P;  2AFD A;  3EJB A;  3EJE A;  1NJI Q;  2KG6 A;  2PY8 A; 
#chains in the Genus database with same CATH homology
 2N50 A;  2L9F A;  2FVA A;  3LMO A;  4BPG A;  4NEO A;  2KGD A;  2KOO A;  2KGA A;  2EHT A;  2LIU A;  2ROQ A;  5HV8 A;  2AF8 A;  2CG5 B;  1F80 D;  2FQ1 A;  2MF4 A;  2LTE A;  1L0H A;  4BPH A;  2JU1 A;  2N98 A;  4CA3 A;  2KOQ A;  2FVF A;  2L0Q A;  4H2Y C;  5CZD B;  2LKI A;  2FAE A;  5KP6 B;  2GDX A;  2K94 A;  3GZL A;  1HY8 A;  3CE7 A;  2XZ1 C;  4DG9 A;  2MVV A;  2FAC A;  2KR5 A;  2LIW A;  2GDW A;  2PNG A;  2CGQ A;  2JU2 A;  2N6Z A;  2CNR A;  5EJD A;  2FQ0 A;  2KOR A;  1HQB A;  2GDY A;  2AFE A;  4H2X C;  2KOS A;  3GZM A;  2K2Q A;  4PXH B;  5KP7 B;  1NQ4 A;  1AF8 A;  2K93 A;  1ACP A;  2EHS A;  1L0I A;  4PWV B;  2XZ0 D;  2M5R A;  2JGP A;  2FQ2 A;  2MD9 A;  4BPF A;  2N5I A;  2FHS C;  1T8K A;  2FAD A;  5HVC A;  2CQ8 A;  1OR5 A;  2VSQ A;  2DNW A;  2MR7 A;  2QNW A;  1VKU A;  2KG9 A;  2KW2 A;  3EJD A;  2KGE A;  2LPK A;  2KG8 A;  2L22 A;  2FVE A;  4H2W C;  1DNY A;  1X3O A;  2MR8 A;  2LL8 A;  5KP8 B;  2KGC A;  2KWL A;  2N5H A;  2AVA A;  1KLP A;  2K92 A;  1DV5 A;  2N6Y A;  2MY5 A;  2KOP A;  2LML A;  2MVU A;  2LOL A;  4IZ6 A;  4R0M A;  4HKG A;  2AFD A;  3EJB A;  3EJE A;  2X2B A;  3NY7 B;  2K0Y A;  2JQ4 A;  4MRT C;  3RG2 A;  2KG6 A;  2K0X A;  2L4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...