2K92A

Structural modification of acyl carrier protein by butyryl group
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGQQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural modification of acyl carrier protein by butyryl group.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
molecule keywords Acyl carrier protein
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k92A00
2K92A 2MVUA 2XZ1C 2LIUA 2CGQA 2FQ1A 1OR5A 5KP8B 4CA3A 3EJBA 2MD9A 2LOLA 4NEOA 2N6YA 2AF8A 2FVFA 2MY5A 2FQ2A 2K0YA 4PWVB 2GDYA 2KOOA 4R0MA 2KW2A 3GZMA 4H2YC 2QNWA 5EJDA 2EHSA 2L9FA 2JU1A 3LMOA 2K94A 2K2QA 2MVVA 2VSQA 1T8KA 2FHSC 1VKUA 4PXHB 2JU2A 2LL8A 2KOSA 4BPFA 1DV5A 2FACA 2FVAA 2MR7A 2MR8A 2KG9A 3CE7A 2FADA 5HV8A 1NQ4A 1HY8A 2L0QA 2L4BA 4H2XC 2M5RA 2K0XA 3EJDA 4HKGA 2FAEA 2KG8A 2KWLA 2LMLA 2KGDA 2FVEA 2CQ8A 2DNWA 2KGAA 2JQ4A 2KGEA 4DG9A 2AFEA 2X2BA 2EHTA 2N5HA 3EJEA 2AVAA 5CZDB 1HQBA 5KP7B 2CG5B 2CNRA 2K93A 2MF4A 5KP6B 2LTEA 2KOQA 4H2WC 2KGCA 4BPGA 1ACPA 1AF8A 3RG2A 2LKIA 2N6ZA 1DNYA 2FQ0A 2AFDA 2LIWA 2L22A 2ROQA 1KLPA 1X3OA 2JGPA 4MRTC 2GDWA 2N50A 2LPKA 1L0HA 2KG6A 2N98A 4BPHA 3GZLA 2KR5A 2KORA 1L0IA 2GDXA 3NY7B 4IZ6A 1F80D 2XZ0D 2PNGA 2N5IA 5HVCA 2KOPA
chains in the Genus database with same CATH superfamily
3DPHA 3Q20A 2K92A 3HZQA 3DS5A 2GZGA 2M8LA 4U0BA 3DS0A 3GJNA 3EJBA 1KD1Q 3G26A 4NEOA 2MY5A 5I4TG 5DCKA 1VHNA 2GDYA 1IMQA 3LRYA 5HVCA 4H2YC 5EJDA 2JU1A 3I56P 4COCA 1T8KA 2JU2A 2KOSA 1Q81Q 2ERHA 2JYGA 2XV6A 2MR7A 4XFXA 3CCSP 5HV8A 2L4BA 1YHQP 1IUQA 4HKGA 2KGDA 2PY8A 3CCQP 4F37A 2VLNA 4U0AA 1YI2P 1RNIA 2X2BA 4M0IA 2N5HA 3EJEA 5CZDB 2CNRA 2K93A 2MF4A 4WYMA 2JAZA 2XT1A 2LTEA 2KOQA 4H2WC 1FR2A 3CCMP 2AFDA 1BXIA 3CPWO 1A43A 3CCUP 5HGNA 1ZNVA 4MRTC 2LPKA 2N98A 2KR5A 3G6EP 3B4QA 1L0IA 2Z45A 1F80D 1K8AQ 3CXCO 1AUMA 2PENA 2E1MA 2WPTA 4PH1A 3CC7P 2GYKA 2OARA 1ZMBA 1BAJA 2FQ1A 1OR5A 4XROA 5KP8B 2VLQA 7CEIA 2MD9A 1E0HA 1GXGA 2K0YA 4PWVB 1YJWP 1KC8Q 3OW2O 2EHSA 3P05A 1VQ7P 1UNKA 4XRQA 2K94A 1VQ9P 2K2QA 2MVVA 3H47A 5F2OA 4COPA 4U0DA 2FACA 1YJ9P 3H0DA 1M90Q 1NQ4A 4UHPB 2L0QA 1EIAA 2M5RA 2K0XA 2K5XA 3G0VA 2KODA 2CQ8A 1W2BO 2ONTA 1VQ6P 2JQ4A 2KGEA 3DS3A 4DG9A 3I55P 5KP7B 2OTJP 3G28A 2VLPA 5KP6B 2KGCA 4BPGA 1ACPA 1MZ8A 5JPAA 2FQ0A 1YITP 1VQ5P 3DS4A 3CMEP 3CC2P 2JGPA 1VQMP 1Q82Q 4XFYA 1KQSO 1VQLP 4BPHA 2M8NA 1VQNP 4U0FA 2KORA 3M1MA 2L6EA 4IZ6A 2JB0A 3G21A 3G71P 5F2KA 5BS2A 1QRJA 4GR6A 5F2NA 5BS1A 2XZ1C 2CGQA 1E6JP 4CA3A 3DS1A 3CMAP 4GR2A 3U43A 1VQKP 2N6YA 1K30A 2KOOA 1RO2A 4R0MA 1VQ4P 2M8PA 5EW5E 3CD6P 3LMOA 1S72P 5HGLA 2VSQA 4PXHB 1EMVA 1NJIQ 2MR8A 3CE7A 2PEIA 1HY8A 3G29A 3DS2A 3WBHA 3CCEP 2QA4P 2JO0A 1EOQA 2VLOA 1Q7YQ 3B5IA 2JBGA 5HGOA 3CCRP 1QVFO 2GZIA 1JJ2O 3GKLC 2EHTA 3E2DA 2AVAA 2CG5B 3HYBA 2JYLA 1K9MQ 1M1KQ 3G1IA 1RO0A 2PEQA 2LKIA 1DNYA 2EFJA 2PEMA 1M74A 2ROQA 1M6NA 1K73Q 2PEJA 2DGYA 2N50A 2NO8A 2GZJA 2GDXA 2OTLP 2EIAA 4QNBA 1Q86Q 2XZ0D 1GXHA 2N5IA 2PEKA 2BUOA 2MVUA 1QVGO 3CCVP 1M6EX 4PH0A 3MGEA 3G1GA 2LIUA 1VQ8P 2LOLA 1IMPA 2AF8A 2FVFA 1VQPP 2FQ2A 4XFZA 2KW2A 3GZMA 5HGMA 2QNWA 2L9FA 2Z46A 1CEIA 2P9XA 2QEXP 3G4SP 2XXMA 2FHSC 1VKUA 2LL8A 3VRLC 4BPFA 1DV5A 1D1DA 2FVAA 1Z6MA 1A8OA 2KG9A 2FADA 1AYIA 4H2XC 3H4EA 1N8RQ 3EJDA 3RG6C 2Z44A 2FAEA 2KG8A 2KWLA 2LMLA 2BHVA 2FVEA 2K0DX 3CC4P 2DNWA 2KGAA 3CCLP 2PEOA 2AFEA 4U0CA 2EG5A 1HQBA 2GZFA 1AF8A 4IPYA 3RG2A 2N6ZA 1UJZA 2LIWA 4QKOA 2L22A 2LF4A 1GPJA 3NTEA 1KLPA 1X3OA 2GDWA 1L0HA 2KG6A 3GZLA 1YJNP 2CWOA 3CCJP 1VQOP 3NY7B 4U0EA 2PNGA 2GZEA 3DTJA 1YIJP 2KOPA
chains in the Genus database with same CATH topology
2K92A 2MVUA 2XZ1C 2LIUA 2CGQA 2FQ1A 1OR5A 5KP8B 4CA3A 3EJBA 2MD9A 2LOLA 4NEOA 2N6YA 2AF8A 2FVFA 2MY5A 2FQ2A 2K0YA 4PWVB 2GDYA 2KOOA 4R0MA 2KW2A 3GZMA 4H2YC 2QNWA 5EJDA 2EHSA 2L9FA 2JU1A 3LMOA 2K94A 2K2QA 2MVVA 2VSQA 1T8KA 2FHSC 1VKUA 4PXHB 2JU2A 2LL8A 2KOSA 4BPFA 1DV5A 2FACA 2FVAA 2MR7A 2MR8A 2KG9A 3CE7A 2FADA 5HV8A 1NQ4A 1HY8A 2L0QA 2L4BA 4H2XC 2M5RA 2K0XA 3EJDA 4HKGA 2FAEA 2KG8A 2KWLA 2LMLA 2KGDA 2FVEA 2CQ8A 2DNWA 2KGAA 2JQ4A 2KGEA 4DG9A 2AFEA 2X2BA 2EHTA 2N5HA 3EJEA 2AVAA 5CZDB 1HQBA 5KP7B 2CG5B 2CNRA 2K93A 2MF4A 5KP6B 2LTEA 2KOQA 4H2WC 2KGCA 4BPGA 1ACPA 1AF8A 3RG2A 2LKIA 2N6ZA 1DNYA 2FQ0A 2AFDA 2LIWA 2L22A 2ROQA 1KLPA 1X3OA 2JGPA 4MRTC 2GDWA 2N50A 2LPKA 1L0HA 2KG6A 2N98A 4BPHA 3GZLA 2KR5A 2KORA 1L0IA 2GDXA 3NY7B 4IZ6A 1F80D 2XZ0D 2PNGA 2N5IA 5HVCA 2KOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K92 A;  2MVU A;  2XZ1 C;  2LIU A;  2CGQ A;  2FQ1 A;  1OR5 A;  5KP8 B;  4CA3 A;  3EJB A;  2MD9 A;  2LOL A;  4NEO A;  2N6Y A;  2AF8 A;  2FVF A;  2MY5 A;  2FQ2 A;  2K0Y A;  4PWV B;  2GDY A;  2KOO A;  4R0M A;  2KW2 A;  3GZM A;  4H2Y C;  2QNW A;  5EJD A;  2EHS A;  2L9F A;  2JU1 A;  3LMO A;  2K94 A;  2K2Q A;  2MVV A;  2VSQ A;  1T8K A;  2FHS C;  1VKU A;  4PXH B;  2JU2 A;  2LL8 A;  2KOS A;  4BPF A;  1DV5 A;  2FAC A;  2FVA A;  2MR7 A;  2MR8 A;  2KG9 A;  3CE7 A;  2FAD A;  5HV8 A;  1NQ4 A;  1HY8 A;  2L0Q A;  2L4B A;  4H2X C;  2M5R A;  2K0X A;  3EJD A;  4HKG A;  2FAE A;  2KG8 A;  2KWL A;  2LML A;  2KGD A;  2FVE A;  2CQ8 A;  2DNW A;  2KGA A;  2JQ4 A;  2KGE A;  4DG9 A;  2AFE A;  2X2B A;  2EHT A;  2N5H A;  3EJE A;  2AVA A;  5CZD B;  1HQB A;  5KP7 B;  2CG5 B;  2CNR A;  2K93 A;  2MF4 A;  5KP6 B;  2LTE A;  2KOQ A;  4H2W C;  2KGC A;  4BPG A;  1ACP A;  1AF8 A;  3RG2 A;  2LKI A;  2N6Z A;  1DNY A;  2FQ0 A;  2AFD A;  2LIW A;  2L22 A;  2ROQ A;  1KLP A;  1X3O A;  2JGP A;  4MRT C;  2GDW A;  2N50 A;  2LPK A;  1L0H A;  2KG6 A;  2N98 A;  4BPH A;  3GZL A;  2KR5 A;  2KOR A;  1L0I A;  2GDX A;  3NY7 B;  4IZ6 A;  1F80 D;  2XZ0 D;  2PNG A;  2N5I A;  5HVC A;  2KOP A; 
#chains in the Genus database with same CATH topology
 3DPH A;  3Q20 A;  2K92 A;  3HZQ A;  3DS5 A;  2GZG A;  2M8L A;  4U0B A;  3DS0 A;  3GJN A;  3EJB A;  1KD1 Q;  3G26 A;  4NEO A;  2MY5 A;  5I4T G;  5DCK A;  1VHN A;  2GDY A;  1IMQ A;  3LRY A;  5HVC A;  4H2Y C;  5EJD A;  2JU1 A;  3I56 P;  4COC A;  1T8K A;  2JU2 A;  2KOS A;  1Q81 Q;  2ERH A;  2JYG A;  2XV6 A;  2MR7 A;  4XFX A;  3CCS P;  5HV8 A;  2L4B A;  1YHQ P;  1IUQ A;  4HKG A;  2KGD A;  2PY8 A;  3CCQ P;  4F37 A;  2VLN A;  4U0A A;  1YI2 P;  1RNI A;  2X2B A;  4M0I A;  2N5H A;  3EJE A;  5CZD B;  2CNR A;  2K93 A;  2MF4 A;  4WYM A;  2JAZ A;  2XT1 A;  2LTE A;  2KOQ A;  4H2W C;  1FR2 A;  3CCM P;  2AFD A;  1BXI A;  3CPW O;  1A43 A;  3CCU P;  5HGN A;  1ZNV A;  4MRT C;  2LPK A;  2N98 A;  2KR5 A;  3G6E P;  3B4Q A;  1L0I A;  2Z45 A;  1F80 D;  1K8A Q;  3CXC O;  1AUM A;  2PEN A;  2E1M A;  2WPT A;  4PH1 A;  3CC7 P;  2GYK A;  2OAR A;  1ZMB A;  1BAJ A;  2FQ1 A;  1OR5 A;  4XRO A;  5KP8 B;  2VLQ A;  7CEI A;  2MD9 A;  1E0H A;  1GXG A;  2K0Y A;  4PWV B;  1YJW P;  1KC8 Q;  3OW2 O;  2EHS A;  3P05 A;  1VQ7 P;  1UNK A;  4XRQ A;  2K94 A;  1VQ9 P;  2K2Q A;  2MVV A;  3H47 A;  5F2O A;  4COP A;  4U0D A;  2FAC A;  1YJ9 P;  3H0D A;  1M90 Q;  1NQ4 A;  4UHP B;  2L0Q A;  1EIA A;  2M5R A;  2K0X A;  2K5X A;  3G0V A;  2KOD A;  2CQ8 A;  1W2B O;  2ONT A;  1VQ6 P;  2JQ4 A;  2KGE A;  3DS3 A;  4DG9 A;  3I55 P;  5KP7 B;  2OTJ P;  3G28 A;  2VLP A;  5KP6 B;  2KGC A;  4BPG A;  1ACP A;  1MZ8 A;  5JPA A;  2FQ0 A;  1YIT P;  1VQ5 P;  3DS4 A;  3CME P;  3CC2 P;  2JGP A;  1VQM P;  1Q82 Q;  4XFY A;  1KQS O;  1VQL P;  4BPH A;  2M8N A;  1VQN P;  4U0F A;  2KOR A;  3M1M A;  2L6E A;  4IZ6 A;  2JB0 A;  3G21 A;  3G71 P;  5F2K A;  5BS2 A;  1QRJ A;  4GR6 A;  5F2N A;  5BS1 A;  2XZ1 C;  2CGQ A;  1E6J P;  4CA3 A;  3DS1 A;  3CMA P;  4GR2 A;  3U43 A;  1VQK P;  2N6Y A;  1K30 A;  2KOO A;  1RO2 A;  4R0M A;  1VQ4 P;  2M8P A;  5EW5 E;  3CD6 P;  3LMO A;  1S72 P;  5HGL A;  2VSQ A;  4PXH B;  1EMV A;  1NJI Q;  2MR8 A;  3CE7 A;  2PEI A;  1HY8 A;  3G29 A;  3DS2 A;  3WBH A;  3CCE P;  2QA4 P;  2JO0 A;  1EOQ A;  2VLO A;  1Q7Y Q;  3B5I A;  2JBG A;  5HGO A;  3CCR P;  1QVF O;  2GZI A;  1JJ2 O;  3GKL C;  2EHT A;  3E2D A;  2AVA A;  2CG5 B;  3HYB A;  2JYL A;  1K9M Q;  1M1K Q;  3G1I A;  1RO0 A;  2PEQ A;  2LKI A;  1DNY A;  2EFJ A;  2PEM A;  1M74 A;  2ROQ A;  1M6N A;  1K73 Q;  2PEJ A;  2DGY A;  2N50 A;  2NO8 A;  2GZJ A;  2GDX A;  2OTL P;  2EIA A;  4QNB A;  1Q86 Q;  2XZ0 D;  1GXH A;  2N5I A;  2PEK A;  2BUO A;  2MVU A;  1QVG O;  3CCV P;  1M6E X;  4PH0 A;  3MGE A;  3G1G A;  2LIU A;  1VQ8 P;  2LOL A;  1IMP A;  2AF8 A;  2FVF A;  1VQP P;  2FQ2 A;  4XFZ A;  2KW2 A;  3GZM A;  5HGM A;  2QNW A;  2L9F A;  2Z46 A;  1CEI A;  2P9X A;  2QEX P;  3G4S P;  2XXM A;  2FHS C;  1VKU A;  2LL8 A;  3VRL C;  4BPF A;  1DV5 A;  1D1D A;  2FVA A;  1Z6M A;  1A8O A;  2KG9 A;  2FAD A;  1AYI A;  4H2X C;  3H4E A;  1N8R Q;  3EJD A;  3RG6 C;  2Z44 A;  2FAE A;  2KG8 A;  2KWL A;  2LML A;  2BHV A;  2FVE A;  2K0D X;  3CC4 P;  2DNW A;  2KGA A;  3CCL P;  2PEO A;  2AFE A;  4U0C A;  2EG5 A;  1HQB A;  2GZF A;  1AF8 A;  4IPY A;  3RG2 A;  2N6Z A;  1UJZ A;  2LIW A;  4QKO A;  2L22 A;  2LF4 A;  1GPJ A;  3NTE A;  1KLP A;  1X3O A;  2GDW A;  1L0H A;  2KG6 A;  3GZL A;  1YJN P;  2CWO A;  3CCJ P;  1VQO P;  3NY7 B;  4U0E A;  2PNG A;  2GZE A;  3DTJ A;  1YIJ P;  2KOP A; 
#chains in the Genus database with same CATH homology
 2K92 A;  2MVU A;  2XZ1 C;  2LIU A;  2CGQ A;  2FQ1 A;  1OR5 A;  5KP8 B;  4CA3 A;  3EJB A;  2MD9 A;  2LOL A;  4NEO A;  2N6Y A;  2AF8 A;  2FVF A;  2MY5 A;  2FQ2 A;  2K0Y A;  4PWV B;  2GDY A;  2KOO A;  4R0M A;  2KW2 A;  3GZM A;  4H2Y C;  2QNW A;  5EJD A;  2EHS A;  2L9F A;  2JU1 A;  3LMO A;  2K94 A;  2K2Q A;  2MVV A;  2VSQ A;  1T8K A;  2FHS C;  1VKU A;  4PXH B;  2JU2 A;  2LL8 A;  2KOS A;  4BPF A;  1DV5 A;  2FAC A;  2FVA A;  2MR7 A;  2MR8 A;  2KG9 A;  3CE7 A;  2FAD A;  5HV8 A;  1NQ4 A;  1HY8 A;  2L0Q A;  2L4B A;  4H2X C;  2M5R A;  2K0X A;  3EJD A;  4HKG A;  2FAE A;  2KG8 A;  2KWL A;  2LML A;  2KGD A;  2FVE A;  2CQ8 A;  2DNW A;  2KGA A;  2JQ4 A;  2KGE A;  4DG9 A;  2AFE A;  2X2B A;  2EHT A;  2N5H A;  3EJE A;  2AVA A;  5CZD B;  1HQB A;  5KP7 B;  2CG5 B;  2CNR A;  2K93 A;  2MF4 A;  5KP6 B;  2LTE A;  2KOQ A;  4H2W C;  2KGC A;  4BPG A;  1ACP A;  1AF8 A;  3RG2 A;  2LKI A;  2N6Z A;  1DNY A;  2FQ0 A;  2AFD A;  2LIW A;  2L22 A;  2ROQ A;  1KLP A;  1X3O A;  2JGP A;  4MRT C;  2GDW A;  2N50 A;  2LPK A;  1L0H A;  2KG6 A;  2N98 A;  4BPH A;  3GZL A;  2KR5 A;  2KOR A;  1L0I A;  2GDX A;  3NY7 B;  4IZ6 A;  1F80 D;  2XZ0 D;  2PNG A;  2N5I A;  5HVC A;  2KOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...