2K92A

Structural modification of acyl carrier protein by butyryl group
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
b'STIEERVKKIIGQQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural modification of acyl carrier protein by butyryl group.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k92A00
2KG9A 1T8KA 2K93A 2FVFA 2XZ1C 4IZ6A 5KP6B 5EJDA 2MY5A 2AFEA 2CGQA 1L0HA 1KLPA 2GDYA 4PWVB 2FHSC 2EHSA 5HVCA 2KOSA 3EJDA 4H2XC 3EJEA 5KP7B 2AF8A 5CZDB 2KR5A 5HV8A 2N6YA 2FQ0A 2MVUA 2KGCA 2LKIA 2EHTA 2CG5B 4MRTC 5KP8B 2K94A 2KOPA 2KOQA 2N5IA 3GZMA 4BPGA 4H2YC 2JQ4A 2GDXA 2L4BA 4R0MA 3LMOA 4BPFA 2CNRA 2N5HA 2QNWA 2KGEA 2XZ0D 1AF8A 2FAEA 2PNGA 2LIUA 2MF4A 2KGAA 3RG2A 1F80D 2KWLA 2M5RA 1X3OA 2LMLA 1DNYA 2KG8A 2JU1A 2KW2A 3NY7B 4BPHA 2FADA 2KORA 2LPKA 2K2QA 2GDWA 2MR8A 2JGPA 1ACPA 2L9FA 2VSQA 2K92A 3CE7A 1HY8A 3GZLA 1HQBA 4PXHB 2LL8A 1OR5A 2FVEA 2N50A 2KGDA 2CQ8A 1NQ4A 2FVAA 2ROQA 2N98A 2X2BA 4CA3A 2AFDA 2K0XA 2FQ2A 2FQ1A 4NEOA 2LIWA 4HKGA 2L0QA 2JU2A 2MVVA 2L22A 2AVAA 2N6ZA 2LTEA 4H2WC 2KG6A 1VKUA 2K0YA 2MD9A 1L0IA 2DNWA 2KOOA 4DG9A 2MR7A 2LOLA 1DV5A 2FACA 3EJBA
chains in the Genus database with same CATH superfamily
1T8KA 1VQMP 2XZ1C 1GXGA 2BUOA 1YJNP 2JO0A 2CWOA 1QVFO 1KLPA 2GYKA 2KODA 1M90Q 3CC7P 5CZDB 2GZEA 2MVUA 2LKIA 2CG5B 4QKOA 3G1GA 1EMVA 3DS1A 2QEXP 5KP8B 3VRLC 3CPWO 3G28A 4WYMA 2JQ4A 2L4BA 1M74A 2QNWA 2KGEA 2PNGA 3RG2A 1E6JP 3P05A 1X3OA 3CCRP 2PEMA 3DS4A 3CCUP 4XFYA 5HGNA 1YI2P 1YJWP 3H4EA 1D1DA 2ERHA 3G4SP 2K2QA 2GDWA 2JGPA 3Q20A 1HY8A 2GZFA 3HYBA 2LL8A 2N50A 4XRQA 4QNBA 1VQKP 1A8OA 2ONTA 1E0HA 2PY8A 1M6NA 2X2BA 2AFDA 2K0XA 2FQ1A 1BXIA 2K5XA 4HKGA 2L22A 4IPYA 1VQ6P 1L0IA 2GZIA 2LOLA 2PEJA 3RG6C 2KG9A 2K93A 2FVFA 3E2DA 4IZ6A 1NJIQ 3CCEP 5F2NA 1YIJP 1M6EX 2MY5A 1YJ9P 1EIAA 2Z44A 1S72P 2EHSA 3DS0A 5HVCA 2KOSA 1AUMA 2AF8A 4U0BA 1GXHA 1RO2A 2PEIA 2EIAA 1KQSO 2JBGA 1W2BO 2KGCA 1Q82Q 3LRYA 5HGMA 2XT1A 3CMAP 2OTLP 2VLNA 4UHPB 1VQNP 1QRJA 1Q7YQ 4R0MA 3G71P 1VQ7P 1IMPA 2LIUA 2KGAA 3G0VA 1F80D 2M5RA 2LMLA 2JU1A 3NY7B 4BPHA 1Z6MA 1K30A 1CEIA 2KORA 3M1MA 4U0CA 2VSQA 5HGOA 3CE7A 1HQBA 3DPHA 2FVEA 2KGDA 1UJZA 4COPA 2CQ8A 2LF4A 1VQ4P 1MZ8A 1IUQA 4XFZA 2JB0A 2LIWA 2MVVA 1KD1Q 2N6ZA 3GKLC 2KG6A 1VKUA 2MD9A 5F2KA 2KOOA 3DS2A 2MR7A 3MGEA 1DV5A 2FACA 3EJBA 1FR2A 3CC4P 4XROA 1RO0A 1RNIA 4U0EA 2P9XA 2VLOA 2AFEA 5EW5E 2CGQA 4M0IA 1L0HA 7CEIA 1ZMBA 2GZGA 4PWVB 1YITP 4H2XC 3EJEA 5KP7B 3U43A 3I55P 2KR5A 5HV8A 2N6YA 5I4TG 4U0FA 1JJ2O 2FQ0A 5JPAA 2EHTA 4GR2A 4MRTC 3G1IA 4COCA 2KOPA 2N5IA 2JYLA 1Q86Q 3H47A 3DS3A 2PENA 1VQ9P 3LMOA 2XV6A 4BPFA 1AF8A 2MF4A 3CD6P 1K8AQ 2JAZA 2KWLA 3B5IA 3DTJA 1DNYA 3CC2P 2OARA 1VQ5P 2WPTA 4PH0A 4GR6A 1VQPP 4F37A 2NO8A 2MR8A 2VLPA 2L9FA 2K92A 1EOQA 3GZLA 1ZNVA 2PEKA 2E1MA 4PXHB 3OW2O 1QVGO 3DS5A 1NQ4A 2GZJA 2M8PA 1VQ8P 4XFXA 2N98A 4CA3A 2FQ2A 3CCMP 1K73Q 4NEOA 3NTEA 2JU2A 2AVAA 5HGLA 2BHVA 2K0YA 2DNWA 2M8NA 4DG9A 1K9MQ 1VQOP 3CMEP 4U0AA 2Z45A 5KP6B 5EJDA 2Z46A 3CCQP 2GDYA 1VHNA 2FHSC 3G29A 3EJDA 4U0DA 5BS1A 2XXMA 2M8LA 3I56P 1M1KQ 1Q81Q 1IMQA 2QA4P 3B4QA 5BS2A 2K94A 3GZMA 2KOQA 1YHQP 4BPGA 4H2YC 2GDXA 4PH1A 3GJNA 2EG5A 2CNRA 2N5HA 2XZ0D 2FAEA 3CCJP 2K0DX 3H0DA 2KG8A 1AYIA 2KW2A 2PEOA 3G26A 3CXCO 2FADA 2L6EA 2LPKA 3CCSP 1ACPA 2PEQA 1OR5A 2JYGA 1VQLP 2VLQA 3G6EP 5DCKA 2FVAA 3G21A 3CCVP 2OTJP 1N8RQ 2ROQA 3CCLP 1A43A 3WBHA 1UNKA 2L0QA 2LTEA 4H2WC 1KC8Q 2DGYA 1GPJA 3HZQA 5F2OA 1BAJA 2EFJA
chains in the Genus database with same CATH topology
2KG9A 1T8KA 2K93A 2FVFA 2XZ1C 4IZ6A 5KP6B 5EJDA 2MY5A 2AFEA 2CGQA 1L0HA 1KLPA 2GDYA 4PWVB 2FHSC 2EHSA 5HVCA 2KOSA 3EJDA 4H2XC 3EJEA 5KP7B 2AF8A 5CZDB 2KR5A 5HV8A 2N6YA 2FQ0A 2MVUA 2KGCA 2LKIA 2EHTA 2CG5B 4MRTC 5KP8B 2K94A 2KOPA 2KOQA 2N5IA 3GZMA 4BPGA 4H2YC 2JQ4A 2GDXA 2L4BA 4R0MA 3LMOA 4BPFA 2CNRA 2N5HA 2QNWA 2KGEA 2XZ0D 1AF8A 2FAEA 2PNGA 2LIUA 2MF4A 2KGAA 3RG2A 1F80D 2KWLA 2M5RA 1X3OA 2LMLA 1DNYA 2KG8A 2JU1A 2KW2A 3NY7B 4BPHA 2FADA 2KORA 2LPKA 2K2QA 2GDWA 2MR8A 2JGPA 1ACPA 2L9FA 2VSQA 2K92A 3CE7A 1HY8A 3GZLA 1HQBA 4PXHB 2LL8A 1OR5A 2FVEA 2N50A 2KGDA 2CQ8A 1NQ4A 2FVAA 2ROQA 2N98A 2X2BA 4CA3A 2AFDA 2K0XA 2FQ2A 2FQ1A 4NEOA 2LIWA 4HKGA 2L0QA 2JU2A 2MVVA 2L22A 2AVAA 2N6ZA 2LTEA 4H2WC 2KG6A 1VKUA 2K0YA 2MD9A 1L0IA 2DNWA 2KOOA 4DG9A 2MR7A 2LOLA 1DV5A 2FACA 3EJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG9 A;  1T8K A;  2K93 A;  2FVF A;  2XZ1 C;  4IZ6 A;  5KP6 B;  5EJD A;  2MY5 A;  2AFE A;  2CGQ A;  1L0H A;  1KLP A;  2GDY A;  4PWV B;  2FHS C;  2EHS A;  5HVC A;  2KOS A;  3EJD A;  4H2X C;  3EJE A;  5KP7 B;  2AF8 A;  5CZD B;  2KR5 A;  5HV8 A;  2N6Y A;  2FQ0 A;  2MVU A;  2KGC A;  2LKI A;  2EHT A;  2CG5 B;  4MRT C;  5KP8 B;  2K94 A;  2KOP A;  2KOQ A;  2N5I A;  3GZM A;  4BPG A;  4H2Y C;  2JQ4 A;  2GDX A;  2L4B A;  4R0M A;  3LMO A;  4BPF A;  2CNR A;  2N5H A;  2QNW A;  2KGE A;  2XZ0 D;  1AF8 A;  2FAE A;  2PNG A;  2LIU A;  2MF4 A;  2KGA A;  3RG2 A;  1F80 D;  2KWL A;  2M5R A;  1X3O A;  2LML A;  1DNY A;  2KG8 A;  2JU1 A;  2KW2 A;  3NY7 B;  4BPH A;  2FAD A;  2KOR A;  2LPK A;  2K2Q A;  2GDW A;  2MR8 A;  2JGP A;  1ACP A;  2L9F A;  2VSQ A;  2K92 A;  3CE7 A;  1HY8 A;  3GZL A;  1HQB A;  4PXH B;  2LL8 A;  1OR5 A;  2FVE A;  2N50 A;  2KGD A;  2CQ8 A;  1NQ4 A;  2FVA A;  2ROQ A;  2N98 A;  2X2B A;  4CA3 A;  2AFD A;  2K0X A;  2FQ2 A;  2FQ1 A;  4NEO A;  2LIW A;  4HKG A;  2L0Q A;  2JU2 A;  2MVV A;  2L22 A;  2AVA A;  2N6Z A;  2LTE A;  4H2W C;  2KG6 A;  1VKU A;  2K0Y A;  2MD9 A;  1L0I A;  2DNW A;  2KOO A;  4DG9 A;  2MR7 A;  2LOL A;  1DV5 A;  2FAC A;  3EJB A; 
#chains in the Genus database with same CATH topology
 1T8K A;  1VQM P;  2XZ1 C;  1GXG A;  2BUO A;  1YJN P;  2JO0 A;  2CWO A;  1QVF O;  1KLP A;  2GYK A;  2KOD A;  1M90 Q;  3CC7 P;  5CZD B;  2GZE A;  2MVU A;  2LKI A;  2CG5 B;  4QKO A;  3G1G A;  1EMV A;  3DS1 A;  2QEX P;  5KP8 B;  3VRL C;  3CPW O;  3G28 A;  4WYM A;  2JQ4 A;  2L4B A;  1M74 A;  2QNW A;  2KGE A;  2PNG A;  3RG2 A;  1E6J P;  3P05 A;  1X3O A;  3CCR P;  2PEM A;  3DS4 A;  3CCU P;  4XFY A;  5HGN A;  1YI2 P;  1YJW P;  3H4E A;  1D1D A;  2ERH A;  3G4S P;  2K2Q A;  2GDW A;  2JGP A;  3Q20 A;  1HY8 A;  2GZF A;  3HYB A;  2LL8 A;  2N50 A;  4XRQ A;  4QNB A;  1VQK P;  1A8O A;  2ONT A;  1E0H A;  2PY8 A;  1M6N A;  2X2B A;  2AFD A;  2K0X A;  2FQ1 A;  1BXI A;  2K5X A;  4HKG A;  2L22 A;  4IPY A;  1VQ6 P;  1L0I A;  2GZI A;  2LOL A;  2PEJ A;  3RG6 C;  2KG9 A;  2K93 A;  2FVF A;  3E2D A;  4IZ6 A;  1NJI Q;  3CCE P;  5F2N A;  1YIJ P;  1M6E X;  2MY5 A;  1YJ9 P;  1EIA A;  2Z44 A;  1S72 P;  2EHS A;  3DS0 A;  5HVC A;  2KOS A;  1AUM A;  2AF8 A;  4U0B A;  1GXH A;  1RO2 A;  2PEI A;  2EIA A;  1KQS O;  2JBG A;  1W2B O;  2KGC A;  1Q82 Q;  3LRY A;  5HGM A;  2XT1 A;  3CMA P;  2OTL P;  2VLN A;  4UHP B;  1VQN P;  1QRJ A;  1Q7Y Q;  4R0M A;  3G71 P;  1VQ7 P;  1IMP A;  2LIU A;  2KGA A;  3G0V A;  1F80 D;  2M5R A;  2LML A;  2JU1 A;  3NY7 B;  4BPH A;  1Z6M A;  1K30 A;  1CEI A;  2KOR A;  3M1M A;  4U0C A;  2VSQ A;  5HGO A;  3CE7 A;  1HQB A;  3DPH A;  2FVE A;  2KGD A;  1UJZ A;  4COP A;  2CQ8 A;  2LF4 A;  1VQ4 P;  1MZ8 A;  1IUQ A;  4XFZ A;  2JB0 A;  2LIW A;  2MVV A;  1KD1 Q;  2N6Z A;  3GKL C;  2KG6 A;  1VKU A;  2MD9 A;  5F2K A;  2KOO A;  3DS2 A;  2MR7 A;  3MGE A;  1DV5 A;  2FAC A;  3EJB A;  1FR2 A;  3CC4 P;  4XRO A;  1RO0 A;  1RNI A;  4U0E A;  2P9X A;  2VLO A;  2AFE A;  5EW5 E;  2CGQ A;  4M0I A;  1L0H A;  7CEI A;  1ZMB A;  2GZG A;  4PWV B;  1YIT P;  4H2X C;  3EJE A;  5KP7 B;  3U43 A;  3I55 P;  2KR5 A;  5HV8 A;  2N6Y A;  5I4T G;  4U0F A;  1JJ2 O;  2FQ0 A;  5JPA A;  2EHT A;  4GR2 A;  4MRT C;  3G1I A;  4COC A;  2KOP A;  2N5I A;  2JYL A;  1Q86 Q;  3H47 A;  3DS3 A;  2PEN A;  1VQ9 P;  3LMO A;  2XV6 A;  4BPF A;  1AF8 A;  2MF4 A;  3CD6 P;  1K8A Q;  2JAZ A;  2KWL A;  3B5I A;  3DTJ A;  1DNY A;  3CC2 P;  2OAR A;  1VQ5 P;  2WPT A;  4PH0 A;  4GR6 A;  1VQP P;  4F37 A;  2NO8 A;  2MR8 A;  2VLP A;  2L9F A;  2K92 A;  1EOQ A;  3GZL A;  1ZNV A;  2PEK A;  2E1M A;  4PXH B;  3OW2 O;  1QVG O;  3DS5 A;  1NQ4 A;  2GZJ A;  2M8P A;  1VQ8 P;  4XFX A;  2N98 A;  4CA3 A;  2FQ2 A;  3CCM P;  1K73 Q;  4NEO A;  3NTE A;  2JU2 A;  2AVA A;  5HGL A;  2BHV A;  2K0Y A;  2DNW A;  2M8N A;  4DG9 A;  1K9M Q;  1VQO P;  3CME P;  4U0A A;  2Z45 A;  5KP6 B;  5EJD A;  2Z46 A;  3CCQ P;  2GDY A;  1VHN A;  2FHS C;  3G29 A;  3EJD A;  4U0D A;  5BS1 A;  2XXM A;  2M8L A;  3I56 P;  1M1K Q;  1Q81 Q;  1IMQ A;  2QA4 P;  3B4Q A;  5BS2 A;  2K94 A;  3GZM A;  2KOQ A;  1YHQ P;  4BPG A;  4H2Y C;  2GDX A;  4PH1 A;  3GJN A;  2EG5 A;  2CNR A;  2N5H A;  2XZ0 D;  2FAE A;  3CCJ P;  2K0D X;  3H0D A;  2KG8 A;  1AYI A;  2KW2 A;  2PEO A;  3G26 A;  3CXC O;  2FAD A;  2L6E A;  2LPK A;  3CCS P;  1ACP A;  2PEQ A;  1OR5 A;  2JYG A;  1VQL P;  2VLQ A;  3G6E P;  5DCK A;  2FVA A;  3G21 A;  3CCV P;  2OTJ P;  1N8R Q;  2ROQ A;  3CCL P;  1A43 A;  3WBH A;  1UNK A;  2L0Q A;  2LTE A;  4H2W C;  1KC8 Q;  2DGY A;  1GPJ A;  3HZQ A;  5F2O A;  1BAJ A;  2EFJ A; 
#chains in the Genus database with same CATH homology
 2KG9 A;  1T8K A;  2K93 A;  2FVF A;  2XZ1 C;  4IZ6 A;  5KP6 B;  5EJD A;  2MY5 A;  2AFE A;  2CGQ A;  1L0H A;  1KLP A;  2GDY A;  4PWV B;  2FHS C;  2EHS A;  5HVC A;  2KOS A;  3EJD A;  4H2X C;  3EJE A;  5KP7 B;  2AF8 A;  5CZD B;  2KR5 A;  5HV8 A;  2N6Y A;  2FQ0 A;  2MVU A;  2KGC A;  2LKI A;  2EHT A;  2CG5 B;  4MRT C;  5KP8 B;  2K94 A;  2KOP A;  2KOQ A;  2N5I A;  3GZM A;  4BPG A;  4H2Y C;  2JQ4 A;  2GDX A;  2L4B A;  4R0M A;  3LMO A;  4BPF A;  2CNR A;  2N5H A;  2QNW A;  2KGE A;  2XZ0 D;  1AF8 A;  2FAE A;  2PNG A;  2LIU A;  2MF4 A;  2KGA A;  3RG2 A;  1F80 D;  2KWL A;  2M5R A;  1X3O A;  2LML A;  1DNY A;  2KG8 A;  2JU1 A;  2KW2 A;  3NY7 B;  4BPH A;  2FAD A;  2KOR A;  2LPK A;  2K2Q A;  2GDW A;  2MR8 A;  2JGP A;  1ACP A;  2L9F A;  2VSQ A;  2K92 A;  3CE7 A;  1HY8 A;  3GZL A;  1HQB A;  4PXH B;  2LL8 A;  1OR5 A;  2FVE A;  2N50 A;  2KGD A;  2CQ8 A;  1NQ4 A;  2FVA A;  2ROQ A;  2N98 A;  2X2B A;  4CA3 A;  2AFD A;  2K0X A;  2FQ2 A;  2FQ1 A;  4NEO A;  2LIW A;  4HKG A;  2L0Q A;  2JU2 A;  2MVV A;  2L22 A;  2AVA A;  2N6Z A;  2LTE A;  4H2W C;  2KG6 A;  1VKU A;  2K0Y A;  2MD9 A;  1L0I A;  2DNW A;  2KOO A;  4DG9 A;  2MR7 A;  2LOL A;  1DV5 A;  2FAC A;  3EJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...