2K9AA

The solution structure of the arl2 effector, bart
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
b'MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 2-binding protein
publication title The Structure of Binder of Arl2 (BART) Reveals a Novel G Protein Binding Domain: IMPLICATIONS FOR FUNCTION.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 41
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2k9aA00
2K9AA 4ZI3C 4ZI3D 4ZI2C 4ZI2D
chains in the Genus database with same CATH superfamily
3PV0F 3K8PC 1HR0T 1YD8G 2VK9A 2LOPA 1NAFA 3OVUA 5LB7B 3U78A 1D1AA 3CX7B 2LRKA 4JI1T 4NUUA 3ETUA 4U33A 2D0TA 4X1IE 3RQWA 2VQET 5FXWA 4LMJA 3L3PA 3T8OA 4AKGA 4TWHA 3PUAA 5DABA 2CXFA 3FZMB 2NTXA 5EK4A 4CN4A 1H7CA 3ZC0A 1HNXT 3FZKB 2K24A 1G73A 3UU6A 4LF9T 3QB5A 4ZS2A 3LDQB 2JRKA 2LSIA 3Q9DA 5FXVA 5KMGP 3CVRA 2CPTA 5LBQB 3CX6B 4COFA 4L0RA 3EABA 2Q9QD 2FBWA 4ILUA 1LVKA 3ZSTA 5FXXA 2SPCA 2IW5B 4I43B 4ZI3D 2ZLYA 2VVNA 4JI3T 1J5ET 4U7IA 5F5WA 1X79A 2XQ3A 1HNWT 5AQIB 1KNRA 4CXYA 3HA4A 2I0MA 4NUVA 2LJLA 2KZ7B 3ZYKA 4OHFA 3UU8A 3KBTA 3ANWA 2LKGA 3P4WA 4U2ZA 5AQMB 5IHYA 2BZBA 3LK2B 3C98B 4IGUA 2ZM8A 5HXEA 3AA7B 2RPAA 3PU3A 1MNDA 3PTRB 5LGNB 4AKHA 2E5LT 4I50E 5J1GA 3E22E 4HWDA 4A56A 1I6ZA 1MNEA 3EI0A 3AECA 3PUQA 2H89A 1AJ3A 1HG5A 2YN6A 2CXDA 5JDFA 2WQYA 2X9HA 3K3QC 3N5LA 4HKAA 3RPUA 2XZEA 4YFSA 1XMOT 4TNVA 5AQGB 2NR4A 2OLTA 4HFHA 1SHZC 2M6BA 3P7IA 1GQEA 4DUZT 5EK3A 5L3EB 1BR4A 4IE7A 3FXDB 5C2TA 2YEVC 4B3RT 2YINA 4DV4T 3NRYA 3FZFB 2BG9C 2KSRA 1T8BA 4ZXLA 5JDMA 4UVBB 2ODVA 5HAXA 3PDYA 3CK6A 5JQGE 2WZHA 3VRBA 2CLYC 4E7ZA 3LK42 2X0LB 1E7PA 5JR9A 2G0UA 3LSVA 3HI2A 4EIWA 3M65A 1N34T 2QA7A 3PJAA 5AQLB 3IF8B 2XQ6A 4DV2T 3RF1A 1X9BA 4ADZA 4OX9T 4H9QC 4GOUA 1W0BA 2BS2A 4JV5T 3ONJA 4P0BA 2ACXA 3Q2MA 4YJ3E 4EV6A 4A5XA 3N9QA 4O4LE 2XAGB 2XSAA 1N32T 4X1YE 4ANJA 5L3DB 2KINB 4NXMT 3UTKA 5KDMC 5L3CB 2PBIA 4LFBT 1HNZT 3KV9A 3GWHA 3KVBA 4B3ST 4HGAA 1DU2A 3IBPA 2N1GA 3FZHB 3W15B 3AEAA 4YY3T 3D0TA 4QXHB 2X9WA 3SFDA 3ZLIA 4PJLA 3QK6A 4DV3T 2L8KA 4QH4A 4MBQA 4LFAT 3I0QA 4LF8T 2VQFT 4HTEA 2V7MA 1U5PA 3J7Yq 3NBXX 3UUBA 2E9XA 2V7KA 1VRBA 4DUYT 2QRXA 3B13A 3PUZF 4AKLA 3CQCB 1HX8A 2DCFA 1MIVA 2IMLA 5HWXA 2WBLA 3LK3B 3RQUA 2XQ4A 3NVOA 2DL1A 1KNZA 2WMNA 4QHOA 2X68A 4QXCB 1FMVA 2UXNB 2OV9A 3VU7H 3RIUC 4ZZCA 5FL1A 3UQ7A 4EEDA 3OKQA 3OPCA 2BKOA 1YQ4A 2K3WA 3ZKRA 3JC6C 2WDRA 4H9PC 3K3OA 4UIGA 1MMAA 3AEGA 3AXJA 2CHNA 2PFVA 3L8RA 1IBMT 2XJ7A 2BS3A 3KFWX 5JR9C 3ANWB 4AI6A 4ISSA 3O1IA 3I1AA 2W0GA 2MTQA 1US7B 2V26A 4O8SA 3ZJ1A 4YJ2E 3SFEA 1XNQT 1OXZA 2MAWA 2CMRA 1EZ3A 2WM9A 3UQ4A 4K0KT 4AQYT 2LSKA 3AE1A 5L3GB 5ABFA 5EZYE 3PUWF 3N2OA 5TAOA 5IWAT 1MMDA 5AQPB 3ZMSB 3AEDA 4B3MT 3PURA 3GN5B 3N9NA 1I94T 5AQHB 2BS4A 1M7KA 3SOLA 2LKHA 4H63H 1J5WA 2VB6A 4N78D 2Y48B 1Y64B 2KMFA 3FHNA 4JBWF 5FYMA 4H9SE 4WBOA 2MBGA 2AXDS 1W09A 3O9XA 5HXSA 2Y6XA 1BR0A 5DQVA 2VKOA 3CMLA 1NWMX 5FY7A 2XY8B 2DNXA 4V1Av 1WR0A 4UV8B 3MA9A 3RIAA 5L2LA 2E9XC 3CPZA 1M62A 4PJNA 4HWIB 1W9RA 3ZN0B 2CCQA 5ABGA 4EZ4A 1CHUA 2WU2A 2QGSA 2V5DA 4IL4A 2WAUA 4ERRA 5LJMA 5JDHA 3PUGA 5JR9B 2JMKA 2D5UA 3P8CD 4IHJE 2BVLA 4KI0F 3TLUA 3KV5A 4LF5T 4PK6A 5IYZE 4GKKT 4UV9B 2UUBT 4Z91A 4ZHQE 4AKIA 5LOVE 1MIYA 3A5XA 4X1KE 4PJMA 3I9WA 2VKDA 2K9AA 5AQJB 1UX5A 5LMUT 2EHOA 5HWYA 3ZN1B 5FMNA 5C3JA 3SS1A 2YDSA 3P4RA 4UXNB 3C51A 5AQQB 4IDNA 3AE4A 2W66A 5FNVE 4BA9A 3UULA 3C50A 5JDNA 1D0ZA 3AA0B 3L09A 3UU3A 4MLKA 2KLQA 4X66T 3UUNA 4ZI2C 4L5GA 3ZYLA 3CIRA 3AEBA 4X65T 5J2UE 4LMLA 1S94A 3ZMZB 2VWAA 3FBZA 4UVAB 1IBKT 3PE0A 5C8YE 3Q5XA 4PK5A 1IJ6A 3JC6D 5ABHA 3N2GE 3GA8A 2MOZA 3P4QA 4BJMA 5AQVB 4BJNA 2VL8A 1HX1B 2X9XA 5CJ5A 2E9XB 3HL6A 1LKXA 4KHZF 2V8SV 4JI7T 2BG9A 4M1PA 2PG8A 5LNKA 2LT3A 2V6XA 3ZYMA 4QX8B 4X62T 5AQRB 3N9LA 5FL0A 1UX4A 1VCTA 3HKCE 2PTFA 5JRCB 5HEUA 2JPFA 4IE5A 4CI1B 3RI5A 3RHWA 4HFCA 3U3IA 2UXXB 1KNPA 2V7LA 2CM0A 4P1NA 2W62A 3AXJB 4QX7B 3ZT6A 4OK0A 5CGMA 1WYBA 2UXCT 2LSGA 5E0OA 3MK7C 1R8IA 5IUXA 3T1YT 4I4TE 5L4HA 1W0AA 3V5SA 2A3DA 3UT5E 2YDRA 3G06A 2ZM0A 3O4XE 4JI8T 4TX5A 3AE8A 2D9DA 3C64A 1FJGT 4NPPA 5AFUL 4CI3B 5LHGB 5HXCA 2VVSA 5FVLA 1HF8A 5LYJE 3UFEA 4I55E 2EHOC 5HEOA 5ABFB 4ZZBA 2FJDA 3V5UA 3JAEA 2I59A 5L47A 5FXZA 2D0UA 2E9XD 2XQ9A 3AE9A 4YSZA 5LGUB 3TLWA 4CZZB 4U72A 4IDPA 3GN5A 3AA1B 1WCRA 5KX5E 2UXDT 2FJEA 4U31A 4DIDB 4UF0A 4O4JE 2W00A 3NZQA 2LHNA 2J47A 2MPKA 4ISTA 4AXPA 3RRWA 4IDZA 5L4EA 3MKDA 2BBHA 4WBNE 2UUAT 1D1CA 4EOZB 5HEHA 4PW8A 4GIWA 2Y8DA 4DMVA 3RIUA 2XAFB 3MACA 3UUMA 3PU8A 4K0UA 2H7OA 3P4PA 1QUUA 3VKGA 2DLRA 4IL9A 4DO0A 3EAMA 2VASA 3KDSE 5JH7E 2JMHA 2BDEA 3IA3A 4QWNB 2CBIA 3CWZB 4H9RC 3RX6A 4LF6T 5H6QB 2WMOA 4ZI2D 3H37A 1ZEEA 4DR7T 2XQ5A 1YXRA 4FI5A 3MXZA 4KX6A 3E08A 4XBFB 2WDQA 4EZHA 3MJXA 5FVKA 5LXTE 5LP6E 1VOMA 2CWOA 2EHOB 5AQUB 4EEBA 4C90A 1SA0E 4FJOA 5DJQC 3UU5A 4H9NC 1IZNB 4G2AA 4IE6A 5AQSB 1KEYA 5ABEA 1HCIA 3BQLA 4DV5T 3S4UA 2LSYA 3RLFF 3IEEA 1T72A 3DP7A 4X5TA 4KP3C 2ZM6T 2J62A 3QUJA 4AQGA 4AIUA 2RA1A 1OEDA 3LFMA 2BKNA 3R6NA 2OA5A 1FEWA 3JAFA 4DBQA 4DVDA 3F57A 2HPLA 2L9QA 2BG9B 5FKYA 5LGTB 2CLYB 2WY2A 1G8XA 3VHLA 1S35A 4GYSA 2CE7A 3NZPA 2BG9E 2WCAA 3ZCJA 2KXPB 2EHOD 5JRCA 3PUXF 4HWFA 3AE3A 5FY1A 2HPJA 4A97A 2CWYA 2V1DB 4QKNA 2HN2A 2VURA 2LSJA 4PAGA 5GONE 2JQHA 2LM9A 3LJCA 4HWCA 3AE6A 1SE7A 4DR1T 3EUHA 4DNDA 3UFGA 3C4XA 4XAXB 3CKDA 4TWDA 2A9UA 1JNRA 2CBJA 1WRDA 3AE5A 4YXDA 3HKEE 2HN1A 4ZS3A 4DV1T 4UVCB 1XDOA 4GYRA 2IC6A 5CB4E 4EYYR 3FZLB 2XASB 2B76A 5FP3A 4DR2T 4WZXA 1B7TA 2FJAA 4YSXA 3MZKB 3E0ZA 1UCUA 3QC9A 1YKEB 3RYFE 4UF0B 2W4XA 3NRXA 2XAJB 4PK4A 4YSYA 3N9OA 3RYHE 1LRZA 2IDOB 2M6IA 5HYAA 4HN9A 2A72A 1OEDC 5AQTB 2LLYA 4DR3T 3Q5DA 2XAQB 2NW7A 3HKDE 4L9IA 3L39A 5LA6E 3ZEFB 3TLSA 5CA0E 3QB5K 2H7VC 4HFIA 4NXNT 1UGOA 4Q25A 1WLXA 3ZT7A 4U3CA 4YTNA 3ZT5A 4JI6T 2VKJA 3ABVA 2PJQA 4DR5T 4JUYA 1OWAA 3EHZA 2C5IT 4YLHA 3RYCE 1UK5A 2J4GA 3ESLA 4YHJA 1QLBA 2FJBA 2A2FX 1IBLT 1XWMA 3X1DA 1KFYA 3KV4A 3ZMTB 4ILBA 3AAIA 4EXTA 4IE0A 5JDGA 4NIQA 3ZSSA 2C0SA 2JJ9A 4X64T 1ZOYA 5HXRA 5L3FB 2ODUA 5ADXL 2X0YA 2YOEA 3C4ZA 3ZMVB 2V7IA 3EDUA 4B6XA 4U2YA 4P09A 4EGWA 5EK2A 1UUSA 2NP9A 4TN7B 3OBVE 4AQFC 4HE8A 3LBXA 1OEDB 1WYCA 4J2CA 4MALA 2WSSV 3ZCIA 3RYIE 1FMWA 3BQKA 3C4WA 1D0YA 2N2NA 2X51A 2BVMA 1OEDE 3KINB 1ZKEA 5JDQA 2W63A 3ETVA 1U4QA 4JLEA 3TLTA 4IDQA 3UU4A 2XQAA 3VRAA 5AQNB 2NOXA 2YDQA 3PUVF 5A1LA 2MYSA 4CQIA 2LEHA 3K1SA 1ZP0A 4DR6T 2H88A 3PJAJ 2NWBA 4KHPT 5LBMA 4EYUA 2M67A 3T1HT 3P50A 2X67A 4HFVA 2X9YA 3RGLA 3DJBA 3GMIA 4IE4A 4ILAA 4O2BE 3FXEB 4H63V 2JIWA 2KWHA 1E1HB 3N9PA 4LMKA 3NKZA 2NW8A 3AEEA 2WS3A 5BR8T 4GKJT 2DWGA 4EAHA 3AB3B 4UELA 4DR4T 4IREA 5BMVE 3SWHA 2D2SA 2LRLA 1KK7A 1JNZA 4HWHA 3RIFA 3J9X1 2DI4A 2YU2A 3RC8A 2E8IA 4MHCA 5JTGA 4MFRA 4YTPA 4OFZA 2DWKA 2WZIA 2XQYA 4JI2T 4QH5A 1IJ5A 5CFBA 4C91A 3RRCA 1J1JA 2WWVA 1T7SA 4YTMA 3WI3A 5H6RB 4E7SA 2XM2A 5FY0A 3DTOA 5AQKB 4GK5E 2CXLA 2W61A 2ZMAA 3ONXA 3AA6B 2VL0A 2YK0A 3IHRA 3M3ZB 3BQIA 4I0UA 5DQWA 4TNWA 2HH7A 4IT4A 5LHIB 3WAKA 4G63A 4U7YA 2CA5A 4ZOLE 2X66A 3AVRA 4TV8E 5M4YA 4ZEYA 2QVAA 3Q5WA 5LCYA 2C5JA 4TV9E 3O1JA 1ZV4X 4JEUB 2GK9A 2V6YA 2YU1A 2JQ9A 3F31A 2NTYA 4JI0T 4OYJA 1D0XA 3KV6A 4UEMA 1D1BA 4HFEA 2CHOA 4IDOA 1XMQT 1O3XA 5CA1E 3O1HA 1XNRT 4HFDA 3B5MA 3CQXC 3B57A 2KWIB 1YKHB 2BKPA 3AVSA 4XZCA 1CUNA 5L3BB 2Z6EA 5JDLA 2AE9A 5ETWA 2E2AA 2V7JA 1XDPA 4HEAA 3N2KE 3SRZA 2XUEA 3JADA 1IAPA 4LFCT 2L3LA 2ACZA 3EVYA 4LF7T 3RKOA 1YQ3A 4YHHT 5LMNT 2W2UA 2W67A 2UXBT 1NENA 4F6RC 3QOFA 5KXJA 2R6GF 1N36T 4O4HE 2Q9QA 3RH3A 1N33T 2B1EA 4X20E 2XAHB 4A98A 1UURA 4DV0T 4WYVA 3LBXB 4QXBB 3KVAA 1Y01A 3AE2A 3ZPOA 5J0ZA 5HXHA 3FBLA 4PFPA 5LJNA 2BBJA 1HFAA 2HHHT 2VKHA 3PUYF 4DV6T 4CN6A 4PNIA 3N9MA 4DV7T 2ZM2A 3BK9A 4ZI7E 3CX8B 2E5VA 4TUYE 3WAJA 2H3RA 2NW9A 5F8PA 5LG3A 4P0AA 3RKGA 5HCMA 1FIOA 1HTJF 2I6HA 4ILCA 4QH1A 2IC9A 3ONLC 3TLVA 2DHRA 3Q5EA 4CXWA 2RP4A 1T98A 1BR1A 3OYXA 4IIJE 2JQKA 2XQ8A 5JVDE 3UUXB 2IIUA 3HR0A 4B3TT 3NWIA 2LE8A 3KBUA 4DMWA 2F4VT 4KBMB 3HKBE 2IHR1 4CN1A 4KMCA 2XM1A 2CEAA 4U74A 2QYWA 3H3MA 3VKHA 1QSDA 3CQGB 3VR9A 5J2TE 2UUCT 2XQ7A 3QNUA 3RC3A 1KF6A 2WWUA 4CXXA 4UR9A 4YT0A 3PUSA 3LG7A 4Z8XA 4O2AE 3AAEB 4WNKA 1ZHCA 1V9DA 5HEJA 5HCJA 1L0VA 5LHHB 2XPKA 4F8HA 3EDVA 4AQFA 2K48A 3A8YC 2CRBA 2WP9A 2Q9QC 1WFDA 3I9YA 3P4SA 1HG2A 3ZJ2A 2N9DA 4WW0A 4ZI3C 2KNDA 2IAKA 5JREA 2XHEB 2K5BB 1YW0A 5HEGA 3JCFA 3OJAA 2P9BA 3A7MA 4ASKA 4OYKA 3VR8A 1LVFA 3TKLB 2KT9A 5AQOB 4JEHB 3AE7A 4JYAT 2WDVA 2V6YB 4Z90A 2X0HA 3OYZA 2FUPA 4AKRB 1BR2A 2WB5A 1HS7A 1VCSA 3AEFA 5AQFB 2LM2A 4JI4T 3AAAB 2YKSA 4PFOA 4LF4T 4CI2B 3ZC1A 4EB6E 1SUMB 1MMNA 4TWFA 4HFBA 4BAYB 4DBRA 4GK0E 2LOSA 3ZMUB 2LHRA 2V5CA 1NEKA 2XSBA 3F2EA 2XTLA 3FB2A 3H3AA 4PJJA 4AISA 5LG4A 2IUBA 2ES0A 4O4IE 2J1DG 4KUMB 1Z0PA 2C5KT 2JQQA 3R84B 2WU5A 1XZYA 3K3NA 1Z8UA 3I0OA 4H9OC 1E2AA 1MMGA 3OTOT 2Q9QB 2UU9T 5F3JA 1WR6A 1MIWA 4TZ4C 4JI5T
chains in the Genus database with same CATH topology
2LSYA 4MFRA 2LSKA 4OFZA 5L3GB 2DWKA 2XQYA 3IEEA 5EZYE 1IJ5A 3K8PC 4C91A 3N2OA 5TAOA 1MMDA 1YD8G 3RRCA 3ZMSB 2VK9A 3DP7A 2LOPA 1NAFA 4KP3C 3WI3A 5H6RB 4E7SA 3PURA 3GN5B 3N9NA 5FY0A 3QUJA 3SOLA 4AQGA 3U78A 1D1AA 3CX7B 3DTOA 4NUUA 4GK5E 2CXLA 2W61A 4H63H 2VB6A 2ZMAA 3ETUA 3ONXA 2RA1A 2D0TA 3LFMA 3AA6B 2YK0A 4N78D 4X1IE 2Y48B 1Y64B 2KMFA 3IHRA 5FXWA 3BQIA 3FHNA 5DQWA 5FYMA 3R6NA 2OA5A 3L3PA 4H9SE 2HH7A 4WBOA 1FEWA 3T8OA 2MBGA 4DBQA 4DVDA 3F57A 5HXSA 2Y6XA 3O9XA 2HPLA 1BR0A 4AKGA 5LHIB 2L9QA 5DQVA 3WAKA 4G63A 3PUAA 5DABA 2CA5A 2CXFA 2VKOA 4ZOLE 2NTXA 2X66A 3AVRA 3CMLA 4TV8E 5EK4A 5M4YA 1H7CA 3Q5WA 3ZC0A 1NWMX 5LCYA 2C5JA 5FY7A 2K24A 5LGTB 4TV9E 1G73A 2CLYB 3O1JA 1ZV4X 2DNXA 1G8XA 4V1Av 4JEUB 2GK9A 3VHLA 1S35A 4UV8B 2YU1A 3F31A 3MA9A 4ZS2A 4GYSA 2CE7A 5L2LA 2NTYA 2JRKA 2LSIA 3NZPA 3Q9DA 5FXVA 2E9XC 5KMGP 3CPZA 3CVRA 3ZCJA 4OYJA 4PJNA 3S4UA 1D0XA 2KXPB 2EHOD 2CCQA 3ZN0B 3KV6A 5JRCA 5LBQB 4UEMA 1D1BA 3CX6B 4L0RA 5FY1A 1O3XA 2HPJA 5CA1E 4EZ4A 3O1HA 2CWYA 2Q9QD 2QGSA 4ILUA 1LVKA 2V1DB 2WAUA 4QKNA 5FXXA 4ERRA 5LJMA 3CQXC 5JDHA 3B57A 2KWIB 1YKHB 3PUGA 5JR9B 2JMKA 2SPCA 2D5UA 3P8CD 2IW5B 4I43B 2LSJA 4IHJE 4ZI3D 4PAGA 2ZLYA 2BVLA 3AVSA 4XZCA 1CUNA 5GONE 5L3BB 2LM9A 3KV5A 4PK6A 3LJCA 5IYZE 2Z6EA 4UV9B 1X79A 5JDLA 4ZHQE 5ETWA 4AKIA 4CXYA 3HA4A 5LOVE 1MIYA 2V7JA 4HEAA 3N2KE 3SRZA 3A5XA 4X1KE 3EUHA 2XUEA 4PJMA 3I9WA 1IAPA 4NUVA 4DNDA 2LJLA 2KZ7B 3ZYKA 4OHFA 2L3LA 2VKDA 2K9AA 3C4XA 4XAXB 3EVYA 1UX5A 3CKDA 3KBTA 3ANWA 3RKOA 2EHOA 5HWYA 3ZN1B 1WRDA 5IHYA 5FMNA 3SS1A 3HKEE 4F6RC 2BZBA 4UXNB 4ZS3A 3C51A 4O4HE 2Q9QA 3LK2B 3C98B 4IGUA 2ZM8A 4UVCB 3RH3A 5HXEA 3AA7B 4GYRA 2IC6A 3PU3A 1MNDA 5FNVE 5CB4E 3PTRB 3C50A 3UULA 4BA9A 4EYYR 5JDNA 5LGNB 2XASB 2B1EA 4X20E 1D0ZA 2XAHB 5FP3A 4AKHA 4I50E 5J1GA 1B7TA 3AA0B 3E22E 3L09A 3LBXB 3MZKB 4MLKA 3E0ZA 1UCUA 2KLQA 4QXBB 3KVAA 3QC9A 3UUNA 4ZI2C 4A56A 4L5GA 3ZYLA 1YKEB 3RYFE 4UF0B 3ZPOA 5J2UE 5HXHA 3FBLA 1MNEA 3NRXA 1S94A 4PFPA 4EAHA 2XAJB 5LJNA 3ZMZB 2VWAA 4PK4A 1HFAA 3FBZA 2VKHA 4UVAB 3PE0A 5C8YE 3Q5XA 3N9OA 4PK5A 1IJ6A 3RYHE 3PUQA 3N9MA 3JC6D 1LRZA 4PNIA 5HYAA 4HN9A 3N2GE 2ZM2A 2A72A 3BK9A 4ZI7E 3GA8A 1AJ3A 2MOZA 3CX8B 4BJMA 4TUYE 3WAJA 1HG5A 4BJNA 2H3RA 2CXDA 2VL8A 5JDFA 5F8PA 2NW9A 2X9HA 3K3QC 3N5LA 4HKAA 2X9XA 3RPUA 4P0AA 2E9XB 4YFSA 3HL6A 1FIOA 1HTJF 1LKXA 2IC9A 2DHRA 4CXWA 4M1PA 2PG8A 2RP4A 5LNKA 2LT3A 1SHZC 2XAQB 1T98A 3ZYMA 1BR1A 2NW7A 3OYXA 3P7IA 4QX8B 4IIJE 3N9LA 3HKDE 1UX4A 4L9IA 5EK3A 5L3EB 5JVDE 5LA6E 1BR4A 3UUXB 4IE7A 3ZEFB 3FXDB 2YEVC 3HR0A 2YINA 5CA0E 3HKCE 5JRCB 3NRYA 2H7VC 5JDMA 2LE8A 3KBUA 4DMWA 2JPFA 4KBMB 2ODVA 4UVBB 4IE5A 5HAXA 4CI1B 3PDYA 3HKBE 5JQGE 1WLXA 2CLYC 4E7ZA 3U3IA 2UXXB 4KMCA 2CEAA 4U74A 2V7LA 2CM0A 3LK42 2W62A 2VKJA 4QX7B 2X0LB 3VKHA 4OK0A 5JR9A 1QSDA 2G0UA 3CQGB 1WYBA 2PJQA 3HI2A 5J2TE 4EIWA 2LSGA 3M65A 4JUYA 2QA7A 5E0OA 3MK7C 1OWAA 4I4TE 3RC3A 2WWUA 2C5IT 3V5SA 2A3DA 3IF8B 4YLHA 3RYCE 4CXXA 3UT5E 3ESLA 3PUSA 4YHJA 4ADZA 2ZM0A 3O4XE 3LG7A 4H9QC 4Z8XA 2A2FX 4GOUA 4TX5A 4O2AE 3AAEB 4WNKA 3C64A 1ZHCA 4P0BA 1V9DA 2ACXA 3KV4A 5AFUL 3Q2MA 3ZMTB 4YJ3E 3AAIA 4CI3B 4EXTA 4IE0A 5JDGA 5LHGB 5HXCA 5LHHB 1HF8A 2C0SA 2JJ9A 3N9QA 5LYJE 3UFEA 4I55E 4O4LE 2EHOC 5HXRA 5L3FB 2XAGB 3EDVA 2ODUA 4AQFA 3V5UA 5ADXL 4X1YE 2K48A 4ANJA 5L3DB 3C4ZA 2I59A 3ZMVB 5FXZA 2D0UA 2E9XD 2KINB 2V7IA 2Q9QC 3EDUA 4B6XA 3UTKA 5KDMC 3I9YA 5L3CB 2PBIA 4P09A 5LGUB 1HG2A 3KV9A 5EK2A 4CZZB 3GWHA 4U72A 3KVBA 3ZJ2A 2NP9A 3AA1B 2N9DA 3GN5A 4TN7B 4WW0A 4ZI3C 2KNDA 3OBVE 4AQFC 5KX5E 4HE8A 3LBXA 2IAKA 4HGAA 5JREA 1WYCA 3IBPA 2N1GA 3W15B 4J2CA 2XHEB 4MALA 2K5BB 1YW0A 3D0TA 4UF0A 4O4JE 4QXHB 2W00A 2X9WA 2WSSV 3ZCIA 3ZLIA 3RYIE 1FMWA 3OJAA 2P9BA 3BQKA 3C4WA 4PJLA 3QK6A 1D0YA 4ASKA 4OYKA 3NZQA 1LVFA 2N2NA 2LHNA 2L8KA 2X51A 3TKLB 2BVMA 2KT9A 4ISTA 4AXPA 5JDQA 3KINB 1ZKEA 4JEHB 4MBQA 4IDZA 2W63A 3RRWA 3ETVA 3MKDA 3I0QA 1U4QA 4JLEA 4HTEA 4WBNE 2NOXA 2V7MA 1U5PA 3J7Yq 3NBXX 1D1CA 4EOZB 4PW8A 4GIWA 2E9XA 2Y8DA 5A1LA 2MYSA 4CQIA 4DMVA 2V7KA 1VRBA 3OYZA 2XAFB 3MACA 3UUMA 3B13A 3PU8A 2LEHA 4K0UA 2H7OA 4AKLA 3CQCB 1HX8A 2DCFA 1QUUA 3VKGA 4AKRB 1BR2A 1MIVA 1HS7A 5HWXA 2DLRA 2WBLA 3LK3B 4DO0A 2NWBA 1KNZA 2WMNA 4QHOA 2X68A 2VASA 3AAAB 4QXCB 5LBMA 3KDSE 4EYUA 5JH7E 1FMVA 2M67A 2JMHA 2UXNB 3VU7H 2BDEA 4PFOA 4CI2B 5LP6E 3ZC1A 2X67A 4HFVA 4EB6E 3OKQA 2X9YA 4QWNB 1MMNA 3CWZB 4H9RC 3RX6A 4BAYB 3DJBA 3GMIA 4DBRA 4IE4A 4GK0E 4O2BE 3FXEB 5H6QB 2LOSA 2WMOA 4H63V 3H37A 4ZI2D 3ZMUB 2LHRA 3JC6C 4H9PC 2KWHA 1E1HB 1ZEEA 2XTLA 3F2EA 3FB2A 3K3OA 3H3AA 3N9PA 4PJJA 4FI5A 3MXZA 4UIGA 1MMAA 5LG4A 2PFVA 2NW8A 3E08A 2ES0A 4O4IE 4XBFB 3KFWX 2J1DG 4EZHA 2DWGA 4KUMB 3MJXA 5JR9C 5LXTE 1Z0PA 3ANWB 1VOMA 2CWOA 3AB3B 2C5KT 4ISSA 2JQQA 2EHOB 4UELA 4AI6A 3R84B 3O1IA 4C90A 1SA0E 3I1AA 3K3NA 2W0GA 2MTQA 1US7B 2V26A 3I0OA 4H9OC 4FJOA 5DJQC 1MMGA 4O8SA 3ZJ1A 4YJ2E 2Q9QB 4H9NC 1OXZA 5BMVE 1IZNB 4G2AA 4IE6A 3SWHA 5F3JA 2D2SA 2CMRA 1EZ3A 1KK7A 2WM9A 3J9X1 1WR6A 2DI4A 1HCIA 3BQLA 1MIWA 2YU2A 3RC8A 4TZ4C 2E8IA 4MHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9A A;  4ZI3 C;  4ZI3 D;  4ZI2 C;  4ZI2 D; 
#chains in the Genus database with same CATH topology
 3PV0 F;  3K8P C;  1HR0 T;  1YD8 G;  2VK9 A;  2LOP A;  1NAF A;  3OVU A;  5LB7 B;  3U78 A;  1D1A A;  3CX7 B;  2LRK A;  4JI1 T;  4NUU A;  3ETU A;  4U33 A;  2D0T A;  4X1I E;  3RQW A;  2VQE T;  5FXW A;  4LMJ A;  3L3P A;  3T8O A;  4AKG A;  4TWH A;  3PUA A;  5DAB A;  2CXF A;  3FZM B;  2NTX A;  5EK4 A;  4CN4 A;  1H7C A;  3ZC0 A;  1HNX T;  3FZK B;  2K24 A;  1G73 A;  3UU6 A;  4LF9 T;  3QB5 A;  4ZS2 A;  3LDQ B;  2JRK A;  2LSI A;  3Q9D A;  5FXV A;  5KMG P;  3CVR A;  2CPT A;  5LBQ B;  3CX6 B;  4COF A;  4L0R A;  3EAB A;  2Q9Q D;  2FBW A;  4ILU A;  1LVK A;  3ZST A;  5FXX A;  2SPC A;  2IW5 B;  4I43 B;  4ZI3 D;  2ZLY A;  2VVN A;  4JI3 T;  1J5E T;  4U7I A;  5F5W A;  1X79 A;  2XQ3 A;  1HNW T;  5AQI B;  1KNR A;  4CXY A;  3HA4 A;  2I0M A;  4NUV A;  2LJL A;  2KZ7 B;  3ZYK A;  4OHF A;  3UU8 A;  3KBT A;  3ANW A;  2LKG A;  3P4W A;  4U2Z A;  5AQM B;  5IHY A;  2BZB A;  3LK2 B;  3C98 B;  4IGU A;  2ZM8 A;  5HXE A;  3AA7 B;  2RPA A;  3PU3 A;  1MND A;  3PTR B;  5LGN B;  4AKH A;  2E5L T;  4I50 E;  5J1G A;  3E22 E;  4HWD A;  4A56 A;  1I6Z A;  1MNE A;  3EI0 A;  3AEC A;  3PUQ A;  2H89 A;  1AJ3 A;  1HG5 A;  2YN6 A;  2CXD A;  5JDF A;  2WQY A;  2X9H A;  3K3Q C;  3N5L A;  4HKA A;  3RPU A;  2XZE A;  4YFS A;  1XMO T;  4TNV A;  5AQG B;  2NR4 A;  2OLT A;  4HFH A;  1SHZ C;  2M6B A;  3P7I A;  1GQE A;  4DUZ T;  5EK3 A;  5L3E B;  1BR4 A;  4IE7 A;  3FXD B;  5C2T A;  2YEV C;  4B3R T;  2YIN A;  4DV4 T;  3NRY A;  3FZF B;  2BG9 C;  2KSR A;  1T8B A;  4ZXL A;  5JDM A;  4UVB B;  2ODV A;  5HAX A;  3PDY A;  3CK6 A;  5JQG E;  2WZH A;  3VRB A;  2CLY C;  4E7Z A;  3LK4 2;  2X0L B;  1E7P A;  5JR9 A;  2G0U A;  3LSV A;  3HI2 A;  4EIW A;  3M65 A;  1N34 T;  2QA7 A;  3PJA A;  5AQL B;  3IF8 B;  2XQ6 A;  4DV2 T;  3RF1 A;  1X9B A;  4ADZ A;  4OX9 T;  4H9Q C;  4GOU A;  1W0B A;  2BS2 A;  4JV5 T;  3ONJ A;  4P0B A;  2ACX A;  3Q2M A;  4YJ3 E;  4EV6 A;  4A5X A;  3N9Q A;  4O4L E;  2XAG B;  2XSA A;  1N32 T;  4X1Y E;  4ANJ A;  5L3D B;  2KIN B;  4NXM T;  3UTK A;  5KDM C;  5L3C B;  2PBI A;  4LFB T;  1HNZ T;  3KV9 A;  3GWH A;  3KVB A;  4B3S T;  4HGA A;  1DU2 A;  3IBP A;  2N1G A;  3FZH B;  3W15 B;  3AEA A;  4YY3 T;  3D0T A;  4QXH B;  2X9W A;  3SFD A;  3ZLI A;  4PJL A;  3QK6 A;  4DV3 T;  2L8K A;  4QH4 A;  4MBQ A;  4LFA T;  3I0Q A;  4LF8 T;  2VQF T;  4HTE A;  2V7M A;  1U5P A;  3J7Y q;  3NBX X;  3UUB A;  2E9X A;  2V7K A;  1VRB A;  4DUY T;  2QRX A;  3B13 A;  3PUZ F;  4AKL A;  3CQC B;  1HX8 A;  2DCF A;  1MIV A;  2IML A;  5HWX A;  2WBL A;  3LK3 B;  3RQU A;  2XQ4 A;  3NVO A;  2DL1 A;  1KNZ A;  2WMN A;  4QHO A;  2X68 A;  4QXC B;  1FMV A;  2UXN B;  2OV9 A;  3VU7 H;  3RIU C;  4ZZC A;  5FL1 A;  3UQ7 A;  4EED A;  3OKQ A;  3OPC A;  2BKO A;  1YQ4 A;  2K3W A;  3ZKR A;  3JC6 C;  2WDR A;  4H9P C;  3K3O A;  4UIG A;  1MMA A;  3AEG A;  3AXJ A;  2CHN A;  2PFV A;  3L8R A;  1IBM T;  2XJ7 A;  2BS3 A;  3KFW X;  5JR9 C;  3ANW B;  4AI6 A;  4ISS A;  3O1I A;  3I1A A;  2W0G A;  2MTQ A;  1US7 B;  2V26 A;  4O8S A;  3ZJ1 A;  4YJ2 E;  3SFE A;  1XNQ T;  1OXZ A;  2MAW A;  2CMR A;  1EZ3 A;  2WM9 A;  3UQ4 A;  4K0K T;  4AQY T;  2LSK A;  3AE1 A;  5L3G B;  5ABF A;  5EZY E;  3PUW F;  3N2O A;  5TAO A;  5IWA T;  1MMD A;  5AQP B;  3ZMS B;  3AED A;  4B3M T;  3PUR A;  3GN5 B;  3N9N A;  1I94 T;  5AQH B;  2BS4 A;  1M7K A;  3SOL A;  2LKH A;  4H63 H;  1J5W A;  2VB6 A;  4N78 D;  2Y48 B;  1Y64 B;  2KMF A;  3FHN A;  4JBW F;  5FYM A;  4H9S E;  4WBO A;  2MBG A;  2AXD S;  1W09 A;  3O9X A;  5HXS A;  2Y6X A;  1BR0 A;  5DQV A;  2VKO A;  3CML A;  1NWM X;  5FY7 A;  2XY8 B;  2DNX A;  4V1A v;  1WR0 A;  4UV8 B;  3MA9 A;  3RIA A;  5L2L A;  2E9X C;  3CPZ A;  1M62 A;  4PJN A;  4HWI B;  1W9R A;  3ZN0 B;  2CCQ A;  5ABG A;  4EZ4 A;  1CHU A;  2WU2 A;  2QGS A;  2V5D A;  4IL4 A;  2WAU A;  4ERR A;  5LJM A;  5JDH A;  3PUG A;  5JR9 B;  2JMK A;  2D5U A;  3P8C D;  4IHJ E;  2BVL A;  4KI0 F;  3TLU A;  3KV5 A;  4LF5 T;  4PK6 A;  5IYZ E;  4GKK T;  4UV9 B;  2UUB T;  4Z91 A;  4ZHQ E;  4AKI A;  5LOV E;  1MIY A;  3A5X A;  4X1K E;  4PJM A;  3I9W A;  2VKD A;  2K9A A;  5AQJ B;  1UX5 A;  5LMU T;  2EHO A;  5HWY A;  3ZN1 B;  5FMN A;  5C3J A;  3SS1 A;  2YDS A;  3P4R A;  4UXN B;  3C51 A;  5AQQ B;  4IDN A;  3AE4 A;  2W66 A;  5FNV E;  4BA9 A;  3UUL A;  3C50 A;  5JDN A;  1D0Z A;  3AA0 B;  3L09 A;  3UU3 A;  4MLK A;  2KLQ A;  4X66 T;  3UUN A;  4ZI2 C;  4L5G A;  3ZYL A;  3CIR A;  3AEB A;  4X65 T;  5J2U E;  4LML A;  1S94 A;  3ZMZ B;  2VWA A;  3FBZ A;  4UVA B;  1IBK T;  3PE0 A;  5C8Y E;  3Q5X A;  4PK5 A;  1IJ6 A;  3JC6 D;  5ABH A;  3N2G E;  3GA8 A;  2MOZ A;  3P4Q A;  4BJM A;  5AQV B;  4BJN A;  2VL8 A;  1HX1 B;  2X9X A;  5CJ5 A;  2E9X B;  3HL6 A;  1LKX A;  4KHZ F;  2V8S V;  4JI7 T;  2BG9 A;  4M1P A;  2PG8 A;  5LNK A;  2LT3 A;  2V6X A;  3ZYM A;  4QX8 B;  4X62 T;  5AQR B;  3N9L A;  5FL0 A;  1UX4 A;  1VCT A;  3HKC E;  2PTF A;  5JRC B;  5HEU A;  2JPF A;  4IE5 A;  4CI1 B;  3RI5 A;  3RHW A;  4HFC A;  3U3I A;  2UXX B;  1KNP A;  2V7L A;  2CM0 A;  4P1N A;  2W62 A;  3AXJ B;  4QX7 B;  3ZT6 A;  4OK0 A;  5CGM A;  1WYB A;  2UXC T;  2LSG A;  5E0O A;  3MK7 C;  1R8I A;  5IUX A;  3T1Y T;  4I4T E;  5L4H A;  1W0A A;  3V5S A;  2A3D A;  3UT5 E;  2YDR A;  3G06 A;  2ZM0 A;  3O4X E;  4JI8 T;  4TX5 A;  3AE8 A;  2D9D A;  3C64 A;  1FJG T;  4NPP A;  5AFU L;  4CI3 B;  5LHG B;  5HXC A;  2VVS A;  5FVL A;  1HF8 A;  5LYJ E;  3UFE A;  4I55 E;  2EHO C;  5HEO A;  5ABF B;  4ZZB A;  2FJD A;  3V5U A;  3JAE A;  2I59 A;  5L47 A;  5FXZ A;  2D0U A;  2E9X D;  2XQ9 A;  3AE9 A;  4YSZ A;  5LGU B;  3TLW A;  4CZZ B;  4U72 A;  4IDP A;  3GN5 A;  3AA1 B;  1WCR A;  5KX5 E;  2UXD T;  2FJE A;  4U31 A;  4DID B;  4UF0 A;  4O4J E;  2W00 A;  3NZQ A;  2LHN A;  2J47 A;  2MPK A;  4IST A;  4AXP A;  3RRW A;  4IDZ A;  5L4E A;  3MKD A;  2BBH A;  4WBN E;  2UUA T;  1D1C A;  4EOZ B;  5HEH A;  4PW8 A;  4GIW A;  2Y8D A;  4DMV A;  3RIU A;  2XAF B;  3MAC A;  3UUM A;  3PU8 A;  4K0U A;  2H7O A;  3P4P A;  1QUU A;  3VKG A;  2DLR A;  4IL9 A;  4DO0 A;  3EAM A;  2VAS A;  3KDS E;  5JH7 E;  2JMH A;  2BDE A;  3IA3 A;  4QWN B;  2CBI A;  3CWZ B;  4H9R C;  3RX6 A;  4LF6 T;  5H6Q B;  2WMO A;  4ZI2 D;  3H37 A;  1ZEE A;  4DR7 T;  2XQ5 A;  1YXR A;  4FI5 A;  3MXZ A;  4KX6 A;  3E08 A;  4XBF B;  2WDQ A;  4EZH A;  3MJX A;  5FVK A;  5LXT E;  5LP6 E;  1VOM A;  2CWO A;  2EHO B;  5AQU B;  4EEB A;  4C90 A;  1SA0 E;  4FJO A;  5DJQ C;  3UU5 A;  4H9N C;  1IZN B;  4G2A A;  4IE6 A;  5AQS B;  1KEY A;  5ABE A;  1HCI A;  3BQL A;  4DV5 T;  3S4U A;  2LSY A;  3RLF F;  3IEE A;  1T72 A;  3DP7 A;  4X5T A;  4KP3 C;  2ZM6 T;  2J62 A;  3QUJ A;  4AQG A;  4AIU A;  2RA1 A;  1OED A;  3LFM A;  2BKN A;  3R6N A;  2OA5 A;  1FEW A;  3JAF A;  4DBQ A;  4DVD A;  3F57 A;  2HPL A;  2L9Q A;  2BG9 B;  5FKY A;  5LGT B;  2CLY B;  2WY2 A;  1G8X A;  3VHL A;  1S35 A;  4GYS A;  2CE7 A;  3NZP A;  2BG9 E;  2WCA A;  3ZCJ A;  2KXP B;  2EHO D;  5JRC A;  3PUX F;  4HWF A;  3AE3 A;  5FY1 A;  2HPJ A;  4A97 A;  2CWY A;  2V1D B;  4QKN A;  2HN2 A;  2VUR A;  2LSJ A;  4PAG A;  5GON E;  2JQH A;  2LM9 A;  3LJC A;  4HWC A;  3AE6 A;  1SE7 A;  4DR1 T;  3EUH A;  4DND A;  3UFG A;  3C4X A;  4XAX B;  3CKD A;  4TWD A;  2A9U A;  1JNR A;  2CBJ A;  1WRD A;  3AE5 A;  4YXD A;  3HKE E;  2HN1 A;  4ZS3 A;  4DV1 T;  4UVC B;  1XDO A;  4GYR A;  2IC6 A;  5CB4 E;  4EYY R;  3FZL B;  2XAS B;  2B76 A;  5FP3 A;  4DR2 T;  4WZX A;  1B7T A;  2FJA A;  4YSX A;  3MZK B;  3E0Z A;  1UCU A;  3QC9 A;  1YKE B;  3RYF E;  4UF0 B;  2W4X A;  3NRX A;  2XAJ B;  4PK4 A;  4YSY A;  3N9O A;  3RYH E;  1LRZ A;  2IDO B;  2M6I A;  5HYA A;  4HN9 A;  2A72 A;  1OED C;  5AQT B;  2LLY A;  4DR3 T;  3Q5D A;  2XAQ B;  2NW7 A;  3HKD E;  4L9I A;  3L39 A;  5LA6 E;  3ZEF B;  3TLS A;  5CA0 E;  3QB5 K;  2H7V C;  4HFI A;  4NXN T;  1UGO A;  4Q25 A;  1WLX A;  3ZT7 A;  4U3C A;  4YTN A;  3ZT5 A;  4JI6 T;  2VKJ A;  3ABV A;  2PJQ A;  4DR5 T;  4JUY A;  1OWA A;  3EHZ A;  2C5I T;  4YLH A;  3RYC E;  1UK5 A;  2J4G A;  3ESL A;  4YHJ A;  1QLB A;  2FJB A;  2A2F X;  1IBL T;  1XWM A;  3X1D A;  1KFY A;  3KV4 A;  3ZMT B;  4ILB A;  3AAI A;  4EXT A;  4IE0 A;  5JDG A;  4NIQ A;  3ZSS A;  2C0S A;  2JJ9 A;  4X64 T;  1ZOY A;  5HXR A;  5L3F B;  2ODU A;  5ADX L;  2X0Y A;  2YOE A;  3C4Z A;  3ZMV B;  2V7I A;  3EDU A;  4B6X A;  4U2Y A;  4P09 A;  4EGW A;  5EK2 A;  1UUS A;  2NP9 A;  4TN7 B;  3OBV E;  4AQF C;  4HE8 A;  3LBX A;  1OED B;  1WYC A;  4J2C A;  4MAL A;  2WSS V;  3ZCI A;  3RYI E;  1FMW A;  3BQK A;  3C4W A;  1D0Y A;  2N2N A;  2X51 A;  2BVM A;  1OED E;  3KIN B;  1ZKE A;  5JDQ A;  2W63 A;  3ETV A;  1U4Q A;  4JLE A;  3TLT A;  4IDQ A;  3UU4 A;  2XQA A;  3VRA A;  5AQN B;  2NOX A;  2YDQ A;  3PUV F;  5A1L A;  2MYS A;  4CQI A;  2LEH A;  3K1S A;  1ZP0 A;  4DR6 T;  2H88 A;  3PJA J;  2NWB A;  4KHP T;  5LBM A;  4EYU A;  2M67 A;  3T1H T;  3P50 A;  2X67 A;  4HFV A;  2X9Y A;  3RGL A;  3DJB A;  3GMI A;  4IE4 A;  4ILA A;  4O2B E;  3FXE B;  4H63 V;  2JIW A;  2KWH A;  1E1H B;  3N9P A;  4LMK A;  3NKZ A;  2NW8 A;  3AEE A;  2WS3 A;  5BR8 T;  4GKJ T;  2DWG A;  4EAH A;  3AB3 B;  4UEL A;  4DR4 T;  4IRE A;  5BMV E;  3SWH A;  2D2S A;  2LRL A;  1KK7 A;  1JNZ A;  4HWH A;  3RIF A;  3J9X 1;  2DI4 A;  2YU2 A;  3RC8 A;  2E8I A;  4MHC A;  5JTG A;  4MFR A;  4YTP A;  4OFZ A;  2DWK A;  2WZI A;  2XQY A;  4JI2 T;  4QH5 A;  1IJ5 A;  5CFB A;  4C91 A;  3RRC A;  1J1J A;  2WWV A;  1T7S A;  4YTM A;  3WI3 A;  5H6R B;  4E7S A;  2XM2 A;  5FY0 A;  3DTO A;  5AQK B;  4GK5 E;  2CXL A;  2W61 A;  2ZMA A;  3ONX A;  3AA6 B;  2VL0 A;  2YK0 A;  3IHR A;  3M3Z B;  3BQI A;  4I0U A;  5DQW A;  4TNW A;  2HH7 A;  4IT4 A;  5LHI B;  3WAK A;  4G63 A;  4U7Y A;  2CA5 A;  4ZOL E;  2X66 A;  3AVR A;  4TV8 E;  5M4Y A;  4ZEY A;  2QVA A;  3Q5W A;  5LCY A;  2C5J A;  4TV9 E;  3O1J A;  1ZV4 X;  4JEU B;  2GK9 A;  2V6Y A;  2YU1 A;  2JQ9 A;  3F31 A;  2NTY A;  4JI0 T;  4OYJ A;  1D0X A;  3KV6 A;  4UEM A;  1D1B A;  4HFE A;  2CHO A;  4IDO A;  1XMQ T;  1O3X A;  5CA1 E;  3O1H A;  1XNR T;  4HFD A;  3B5M A;  3CQX C;  3B57 A;  2KWI B;  1YKH B;  2BKP A;  3AVS A;  4XZC A;  1CUN A;  5L3B B;  2Z6E A;  5JDL A;  2AE9 A;  5ETW A;  2E2A A;  2V7J A;  1XDP A;  4HEA A;  3N2K E;  3SRZ A;  2XUE A;  3JAD A;  1IAP A;  4LFC T;  2L3L A;  2ACZ A;  3EVY A;  4LF7 T;  3RKO A;  1YQ3 A;  4YHH T;  5LMN T;  2W2U A;  2W67 A;  2UXB T;  1NEN A;  4F6R C;  3QOF A;  5KXJ A;  2R6G F;  1N36 T;  4O4H E;  2Q9Q A;  3RH3 A;  1N33 T;  2B1E A;  4X20 E;  2XAH B;  4A98 A;  1UUR A;  4DV0 T;  4WYV A;  3LBX B;  4QXB B;  3KVA A;  1Y01 A;  3AE2 A;  3ZPO A;  5J0Z A;  5HXH A;  3FBL A;  4PFP A;  5LJN A;  2BBJ A;  1HFA A;  2HHH T;  2VKH A;  3PUY F;  4DV6 T;  4CN6 A;  4PNI A;  3N9M A;  4DV7 T;  2ZM2 A;  3BK9 A;  4ZI7 E;  3CX8 B;  2E5V A;  4TUY E;  3WAJ A;  2H3R A;  2NW9 A;  5F8P A;  5LG3 A;  4P0A A;  3RKG A;  5HCM A;  1FIO A;  1HTJ F;  2I6H A;  4ILC A;  4QH1 A;  2IC9 A;  3ONL C;  3TLV A;  2DHR A;  3Q5E A;  4CXW A;  2RP4 A;  1T98 A;  1BR1 A;  3OYX A;  4IIJ E;  2JQK A;  2XQ8 A;  5JVD E;  3UUX B;  2IIU A;  3HR0 A;  4B3T T;  3NWI A;  2LE8 A;  3KBU A;  4DMW A;  2F4V T;  4KBM B;  3HKB E;  2IHR 1;  4CN1 A;  4KMC A;  2XM1 A;  2CEA A;  4U74 A;  2QYW A;  3H3M A;  3VKH A;  1QSD A;  3CQG B;  3VR9 A;  5J2T E;  2UUC T;  2XQ7 A;  3QNU A;  3RC3 A;  1KF6 A;  2WWU A;  4CXX A;  4UR9 A;  4YT0 A;  3PUS A;  3LG7 A;  4Z8X A;  4O2A E;  3AAE B;  4WNK A;  1ZHC A;  1V9D A;  5HEJ A;  5HCJ A;  1L0V A;  5LHH B;  2XPK A;  4F8H A;  3EDV A;  4AQF A;  2K48 A;  3A8Y C;  2CRB A;  2WP9 A;  2Q9Q C;  1WFD A;  3I9Y A;  3P4S A;  1HG2 A;  3ZJ2 A;  2N9D A;  4WW0 A;  4ZI3 C;  2KND A;  2IAK A;  5JRE A;  2XHE B;  2K5B B;  1YW0 A;  5HEG A;  3JCF A;  3OJA A;  2P9B A;  3A7M A;  4ASK A;  4OYK A;  3VR8 A;  1LVF A;  3TKL B;  2KT9 A;  5AQO B;  4JEH B;  3AE7 A;  4JYA T;  2WDV A;  2V6Y B;  4Z90 A;  2X0H A;  3OYZ A;  2FUP A;  4AKR B;  1BR2 A;  2WB5 A;  1HS7 A;  1VCS A;  3AEF A;  5AQF B;  2LM2 A;  4JI4 T;  3AAA B;  2YKS A;  4PFO A;  4LF4 T;  4CI2 B;  3ZC1 A;  4EB6 E;  1SUM B;  1MMN A;  4TWF A;  4HFB A;  4BAY B;  4DBR A;  4GK0 E;  2LOS A;  3ZMU B;  2LHR A;  2V5C A;  1NEK A;  2XSB A;  3F2E A;  2XTL A;  3FB2 A;  3H3A A;  4PJJ A;  4AIS A;  5LG4 A;  2IUB A;  2ES0 A;  4O4I E;  2J1D G;  4KUM B;  1Z0P A;  2C5K T;  2JQQ A;  3R84 B;  2WU5 A;  1XZY A;  3K3N A;  1Z8U A;  3I0O A;  4H9O C;  1E2A A;  1MMG A;  3OTO T;  2Q9Q B;  2UU9 T;  5F3J A;  1WR6 A;  1MIW A;  4TZ4 C;  4JI5 T; 
#chains in the Genus database with same CATH homology
 2LSY A;  4MFR A;  2LSK A;  4OFZ A;  5L3G B;  2DWK A;  2XQY A;  3IEE A;  5EZY E;  1IJ5 A;  3K8P C;  4C91 A;  3N2O A;  5TAO A;  1MMD A;  1YD8 G;  3RRC A;  3ZMS B;  2VK9 A;  3DP7 A;  2LOP A;  1NAF A;  4KP3 C;  3WI3 A;  5H6R B;  4E7S A;  3PUR A;  3GN5 B;  3N9N A;  5FY0 A;  3QUJ A;  3SOL A;  4AQG A;  3U78 A;  1D1A A;  3CX7 B;  3DTO A;  4NUU A;  4GK5 E;  2CXL A;  2W61 A;  4H63 H;  2VB6 A;  2ZMA A;  3ETU A;  3ONX A;  2RA1 A;  2D0T A;  3LFM A;  3AA6 B;  2YK0 A;  4N78 D;  4X1I E;  2Y48 B;  1Y64 B;  2KMF A;  3IHR A;  5FXW A;  3BQI A;  3FHN A;  5DQW A;  5FYM A;  3R6N A;  2OA5 A;  3L3P A;  4H9S E;  2HH7 A;  4WBO A;  1FEW A;  3T8O A;  2MBG A;  4DBQ A;  4DVD A;  3F57 A;  5HXS A;  2Y6X A;  3O9X A;  2HPL A;  1BR0 A;  4AKG A;  5LHI B;  2L9Q A;  5DQV A;  3WAK A;  4G63 A;  3PUA A;  5DAB A;  2CA5 A;  2CXF A;  2VKO A;  4ZOL E;  2NTX A;  2X66 A;  3AVR A;  3CML A;  4TV8 E;  5EK4 A;  5M4Y A;  1H7C A;  3Q5W A;  3ZC0 A;  1NWM X;  5LCY A;  2C5J A;  5FY7 A;  2K24 A;  5LGT B;  4TV9 E;  1G73 A;  2CLY B;  3O1J A;  1ZV4 X;  2DNX A;  1G8X A;  4V1A v;  4JEU B;  2GK9 A;  3VHL A;  1S35 A;  4UV8 B;  2YU1 A;  3F31 A;  3MA9 A;  4ZS2 A;  4GYS A;  2CE7 A;  5L2L A;  2NTY A;  2JRK A;  2LSI A;  3NZP A;  3Q9D A;  5FXV A;  2E9X C;  5KMG P;  3CPZ A;  3CVR A;  3ZCJ A;  4OYJ A;  4PJN A;  3S4U A;  1D0X A;  2KXP B;  2EHO D;  2CCQ A;  3ZN0 B;  3KV6 A;  5JRC A;  5LBQ B;  4UEM A;  1D1B A;  3CX6 B;  4L0R A;  5FY1 A;  1O3X A;  2HPJ A;  5CA1 E;  4EZ4 A;  3O1H A;  2CWY A;  2Q9Q D;  2QGS A;  4ILU A;  1LVK A;  2V1D B;  2WAU A;  4QKN A;  5FXX A;  4ERR A;  5LJM A;  3CQX C;  5JDH A;  3B57 A;  2KWI B;  1YKH B;  3PUG A;  5JR9 B;  2JMK A;  2SPC A;  2D5U A;  3P8C D;  2IW5 B;  4I43 B;  2LSJ A;  4IHJ E;  4ZI3 D;  4PAG A;  2ZLY A;  2BVL A;  3AVS A;  4XZC A;  1CUN A;  5GON E;  5L3B B;  2LM9 A;  3KV5 A;  4PK6 A;  3LJC A;  5IYZ E;  2Z6E A;  4UV9 B;  1X79 A;  5JDL A;  4ZHQ E;  5ETW A;  4AKI A;  4CXY A;  3HA4 A;  5LOV E;  1MIY A;  2V7J A;  4HEA A;  3N2K E;  3SRZ A;  3A5X A;  4X1K E;  3EUH A;  2XUE A;  4PJM A;  3I9W A;  1IAP A;  4NUV A;  4DND A;  2LJL A;  2KZ7 B;  3ZYK A;  4OHF A;  2L3L A;  2VKD A;  2K9A A;  3C4X A;  4XAX B;  3EVY A;  1UX5 A;  3CKD A;  3KBT A;  3ANW A;  3RKO A;  2EHO A;  5HWY A;  3ZN1 B;  1WRD A;  5IHY A;  5FMN A;  3SS1 A;  3HKE E;  4F6R C;  2BZB A;  4UXN B;  4ZS3 A;  3C51 A;  4O4H E;  2Q9Q A;  3LK2 B;  3C98 B;  4IGU A;  2ZM8 A;  4UVC B;  3RH3 A;  5HXE A;  3AA7 B;  4GYR A;  2IC6 A;  3PU3 A;  1MND A;  5FNV E;  5CB4 E;  3PTR B;  3C50 A;  3UUL A;  4BA9 A;  4EYY R;  5JDN A;  5LGN B;  2XAS B;  2B1E A;  4X20 E;  1D0Z A;  2XAH B;  5FP3 A;  4AKH A;  4I50 E;  5J1G A;  1B7T A;  3AA0 B;  3E22 E;  3L09 A;  3LBX B;  3MZK B;  4MLK A;  3E0Z A;  1UCU A;  2KLQ A;  4QXB B;  3KVA A;  3QC9 A;  3UUN A;  4ZI2 C;  4A56 A;  4L5G A;  3ZYL A;  1YKE B;  3RYF E;  4UF0 B;  3ZPO A;  5J2U E;  5HXH A;  3FBL A;  1MNE A;  3NRX A;  1S94 A;  4PFP A;  4EAH A;  2XAJ B;  5LJN A;  3ZMZ B;  2VWA A;  4PK4 A;  1HFA A;  3FBZ A;  2VKH A;  4UVA B;  3PE0 A;  5C8Y E;  3Q5X A;  3N9O A;  4PK5 A;  1IJ6 A;  3RYH E;  3PUQ A;  3N9M A;  3JC6 D;  1LRZ A;  4PNI A;  5HYA A;  4HN9 A;  3N2G E;  2ZM2 A;  2A72 A;  3BK9 A;  4ZI7 E;  3GA8 A;  1AJ3 A;  2MOZ A;  3CX8 B;  4BJM A;  4TUY E;  3WAJ A;  1HG5 A;  4BJN A;  2H3R A;  2CXD A;  2VL8 A;  5JDF A;  5F8P A;  2NW9 A;  2X9H A;  3K3Q C;  3N5L A;  4HKA A;  2X9X A;  3RPU A;  4P0A A;  2E9X B;  4YFS A;  3HL6 A;  1FIO A;  1HTJ F;  1LKX A;  2IC9 A;  2DHR A;  4CXW A;  4M1P A;  2PG8 A;  2RP4 A;  5LNK A;  2LT3 A;  1SHZ C;  2XAQ B;  1T98 A;  3ZYM A;  1BR1 A;  2NW7 A;  3OYX A;  3P7I A;  4QX8 B;  4IIJ E;  3N9L A;  3HKD E;  1UX4 A;  4L9I A;  5EK3 A;  5L3E B;  5JVD E;  5LA6 E;  1BR4 A;  3UUX B;  4IE7 A;  3ZEF B;  3FXD B;  2YEV C;  3HR0 A;  2YIN A;  5CA0 E;  3HKC E;  5JRC B;  3NRY A;  2H7V C;  5JDM A;  2LE8 A;  3KBU A;  4DMW A;  2JPF A;  4KBM B;  2ODV A;  4UVB B;  4IE5 A;  5HAX A;  4CI1 B;  3PDY A;  3HKB E;  5JQG E;  1WLX A;  2CLY C;  4E7Z A;  3U3I A;  2UXX B;  4KMC A;  2CEA A;  4U74 A;  2V7L A;  2CM0 A;  3LK4 2;  2W62 A;  2VKJ A;  4QX7 B;  2X0L B;  3VKH A;  4OK0 A;  5JR9 A;  1QSD A;  2G0U A;  3CQG B;  1WYB A;  2PJQ A;  3HI2 A;  5J2T E;  4EIW A;  2LSG A;  3M65 A;  4JUY A;  2QA7 A;  5E0O A;  3MK7 C;  1OWA A;  4I4T E;  3RC3 A;  2WWU A;  2C5I T;  3V5S A;  2A3D A;  3IF8 B;  4YLH A;  3RYC E;  4CXX A;  3UT5 E;  3ESL A;  3PUS A;  4YHJ A;  4ADZ A;  2ZM0 A;  3O4X E;  3LG7 A;  4H9Q C;  4Z8X A;  2A2F X;  4GOU A;  4TX5 A;  4O2A E;  3AAE B;  4WNK A;  3C64 A;  1ZHC A;  4P0B A;  1V9D A;  2ACX A;  3KV4 A;  5AFU L;  3Q2M A;  3ZMT B;  4YJ3 E;  3AAI A;  4CI3 B;  4EXT A;  4IE0 A;  5JDG A;  5LHG B;  5HXC A;  5LHH B;  1HF8 A;  2C0S A;  2JJ9 A;  3N9Q A;  5LYJ E;  3UFE A;  4I55 E;  4O4L E;  2EHO C;  5HXR A;  5L3F B;  2XAG B;  3EDV A;  2ODU A;  4AQF A;  3V5U A;  5ADX L;  4X1Y E;  2K48 A;  4ANJ A;  5L3D B;  3C4Z A;  2I59 A;  3ZMV B;  5FXZ A;  2D0U A;  2E9X D;  2KIN B;  2V7I A;  2Q9Q C;  3EDU A;  4B6X A;  3UTK A;  5KDM C;  3I9Y A;  5L3C B;  2PBI A;  4P09 A;  5LGU B;  1HG2 A;  3KV9 A;  5EK2 A;  4CZZ B;  3GWH A;  4U72 A;  3KVB A;  3ZJ2 A;  2NP9 A;  3AA1 B;  2N9D A;  3GN5 A;  4TN7 B;  4WW0 A;  4ZI3 C;  2KND A;  3OBV E;  4AQF C;  5KX5 E;  4HE8 A;  3LBX A;  2IAK A;  4HGA A;  5JRE A;  1WYC A;  3IBP A;  2N1G A;  3W15 B;  4J2C A;  2XHE B;  4MAL A;  2K5B B;  1YW0 A;  3D0T A;  4UF0 A;  4O4J E;  4QXH B;  2W00 A;  2X9W A;  2WSS V;  3ZCI A;  3ZLI A;  3RYI E;  1FMW A;  3OJA A;  2P9B A;  3BQK A;  3C4W A;  4PJL A;  3QK6 A;  1D0Y A;  4ASK A;  4OYK A;  3NZQ A;  1LVF A;  2N2N A;  2LHN A;  2L8K A;  2X51 A;  3TKL B;  2BVM A;  2KT9 A;  4IST A;  4AXP A;  5JDQ A;  3KIN B;  1ZKE A;  4JEH B;  4MBQ A;  4IDZ A;  2W63 A;  3RRW A;  3ETV A;  3MKD A;  3I0Q A;  1U4Q A;  4JLE A;  4HTE A;  4WBN E;  2NOX A;  2V7M A;  1U5P A;  3J7Y q;  3NBX X;  1D1C A;  4EOZ B;  4PW8 A;  4GIW A;  2E9X A;  2Y8D A;  5A1L A;  2MYS A;  4CQI A;  4DMV A;  2V7K A;  1VRB A;  3OYZ A;  2XAF B;  3MAC A;  3UUM A;  3B13 A;  3PU8 A;  2LEH A;  4K0U A;  2H7O A;  4AKL A;  3CQC B;  1HX8 A;  2DCF A;  1QUU A;  3VKG A;  4AKR B;  1BR2 A;  1MIV A;  1HS7 A;  5HWX A;  2DLR A;  2WBL A;  3LK3 B;  4DO0 A;  2NWB A;  1KNZ A;  2WMN A;  4QHO A;  2X68 A;  2VAS A;  3AAA B;  4QXC B;  5LBM A;  3KDS E;  4EYU A;  5JH7 E;  1FMV A;  2M67 A;  2JMH A;  2UXN B;  3VU7 H;  2BDE A;  4PFO A;  4CI2 B;  5LP6 E;  3ZC1 A;  2X67 A;  4HFV A;  4EB6 E;  3OKQ A;  2X9Y A;  4QWN B;  1MMN A;  3CWZ B;  4H9R C;  3RX6 A;  4BAY B;  3DJB A;  3GMI A;  4DBR A;  4IE4 A;  4GK0 E;  4O2B E;  3FXE B;  5H6Q B;  2LOS A;  2WMO A;  4H63 V;  3H37 A;  4ZI2 D;  3ZMU B;  2LHR A;  3JC6 C;  4H9P C;  2KWH A;  1E1H B;  1ZEE A;  2XTL A;  3F2E A;  3FB2 A;  3K3O A;  3H3A A;  3N9P A;  4PJJ A;  4FI5 A;  3MXZ A;  4UIG A;  1MMA A;  5LG4 A;  2PFV A;  2NW8 A;  3E08 A;  2ES0 A;  4O4I E;  4XBF B;  3KFW X;  2J1D G;  4EZH A;  2DWG A;  4KUM B;  3MJX A;  5JR9 C;  5LXT E;  1Z0P A;  3ANW B;  1VOM A;  2CWO A;  3AB3 B;  2C5K T;  4ISS A;  2JQQ A;  2EHO B;  4UEL A;  4AI6 A;  3R84 B;  3O1I A;  4C90 A;  1SA0 E;  3I1A A;  3K3N A;  2W0G A;  2MTQ A;  1US7 B;  2V26 A;  3I0O A;  4H9O C;  4FJO A;  5DJQ C;  1MMG A;  4O8S A;  3ZJ1 A;  4YJ2 E;  2Q9Q B;  4H9N C;  1OXZ A;  5BMV E;  1IZN B;  4G2A A;  4IE6 A;  3SWH A;  5F3J A;  2D2S A;  2CMR A;  1EZ3 A;  1KK7 A;  2WM9 A;  3J9X 1;  1WR6 A;  2DI4 A;  1HCI A;  3BQL A;  1MIW A;  2YU2 A;  3RC8 A;  4TZ4 C;  2E8I A;  4MHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...