2K9AA

The solution structure of the arl2 effector, bart
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
b'MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 2-binding protein
molecule tags Protein binding
source organism Homo sapiens
publication title The Structure of Binder of Arl2 (BART) Reveals a Novel G Protein Binding Domain: IMPLICATIONS FOR FUNCTION.
pubmed doi rcsb
total genus 41
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2k9aA00
4ZI3C 4ZI2D 4ZI3D 2K9AA 4ZI2C
chains in the Genus database with same CATH superfamily
5ETWA 2XZEA 2NW9A 1MIWA 1MIYA 3FBLA 3ZT6A 4ZI7E 1HNWT 4QXCB 5AQKB 2K3WA 4ZS2A 4Z90A 3GN5B 3ZMUB 4DBQA 4P0BA 4B3TT 2N9DA 2VVSA 3IEEA 3JCFA 1GQEA 5CA1E 1NEKA 2YKSA 4U2YA 3KBTA 2MPKA 2JIWA 4AQYT 1X9BA 2VVNA 5HXRA 3ZCJA 1BR0A 3KFWX 1UX5A 4YT0A 3UULA 3AEGA 2XQ3A 4GK5E 4PK4A 1Z0PA 3C98B 3LBXA 3OPCA 4C91A 5CJ5A 4X65T 4DV0T 1JNRA 3PDYA 5JRCA 5IWAT 5J2UE 2CBJA 1D1AA 2WS3A 3Q5WA 4B3RT 4DV6T 4IREA 2IDOB 1OEDB 2L8KA 2XASB 4PK5A 4DR5T 1N32T 2D0TA 3X1DA 4JYAT 3JAFA 3R84B 3L8RA 1JNZA 5FNVE 2YU2A 1HTJF 1NWMX 2OV9A 1MMGA 1WR6A 2LOSA 2YN6A 3JAEA 4OFZA 5ABFA 4AKGA 1HX8A 1G73A 2HH7A 3EAMA 5DQWA 2KLQA 4HWIB 4EEDA 4C90A 3UU3A 5ABGA 4EOZB 5LB7B 3W15B 5C2TA 1VRBA 2Q9QD 2VWAA 4HWCA 4H63H 2I6HA 3KVAA 3RHWA 3NBXX 3EABA 3HKEE 4U72A 3K1SA 4YJ2E 3RIFA 5L47A 5HWYA 3S4UA 3AE1A 1E2AA 4IIJE 1N33T 5F5WA 5FYMA 4WBOA 5M4YA 4JI3T 2VQET 1Y64B 2QVAA 1IJ6A 1NENA 3UU8A 2BBHA 4TV9E 1H7CA 3RLFF 2VK9A 3CQGB 2BG9B 4NUVA 2LRKA 2SPCA 5FY7A 4ZXLA 1FJGT 4H9QC 4GKKT 4H63V 2XUEA 1UCUA 5FY1A 5LP6E 2XHEB 3AEAA 3QB5A 4CI1B 1UGOA 4U74A 2FJDA 4EB6E 5JVDE 2UXCT 4IE7A 4U7YA 4H9PC 3BK9A 2J47A 4ISSA 1QUUA 4JI6T 4OYKA 2VQFT 3DP7A 2KMFA 2I0MA 2X9YA 3FXDB 4HKAA 3ZC0A 2V26A 3IHRA 5HAXA 5LG4A 3PURA 4L0RA 4E7SA 2E9XD 3C64A 2NP9A 4ILBA 1D0ZA 2OA5A 3TLSA 5L3CB 2DHRA 1MNDA 5IUXA 5JREA 2V7JA 1B7TA 4H9NC 3N9MA 4QH5A 3PUWF 1L0VA 4CI3B 5HXCA 3UQ7A 3T1HT 2YK0A 2IC9A 2L9QA 2QGSA 5AQQB 1WFDA 4JUYA 5DJQC 2IHR1 4DV5T 1J5ET 4TN7B 3VU7H 1FIOA 3IA3A 2D0UA 2LSGA 3VRAA 3C4WA 3UFEA 4HTEA 4EV6A 4AKHA 3RRWA 1N36T 3E08A 3H37A 3T8OA 4UF0B 4CN4A 3GA8A 4JEUB 4NXMT 1T7SA 3O1IA 2MAWA 2EHOC 4UVBB 3RYCE 2ZLYA 2XAGB 3N5LA 1SA0E 3WAJA 5JRCB 4ZZCA 5EK2A 2VB6A 1HG5A 2JMKA 1XNQT 5LHHB 2ACZA 3A5XA 3HKDE 3NKZA 2DCFA 4MLKA 4X1IE 1KNZA 5C3JA 1YKEB 3K8PC 3P50A 3Q5EA 2N2NA 3KINB 1BR2A 3TLVA 2XQ4A 3KBUA 3RYFE 4UV8B 2XTLA 4DBRA 5CA0E 3F57A 4DR3T 1WLXA 2V7IA 2KINB 3JADA 4TUYE 4AXPA 5JDGA 2ACXA 2ODUA 2V5CA 3PUSA 4G63A 3RH3A 3WAKA 5JDHA 4A5XA 5ABEA 4AISA 2UUCT 2CEAA 3ANWB 4EZHA 3SRZA 3AEEA 3HKCE 2HPLA 2E2AA 5TAOA 3OBVE 3P4RA 4UR9A 5AQPB 3QC9A 5LJNA 5J2TE 4DV3T 2F4VT 2J62A 3L39A 4KX6A 4PJNA 4HEAA 3SFDA 3ZC1A 4O4LE 2IUBA 4TNWA 3ZLIA 4A97A 3TKLB 5KX5E 4GYRA 5LMUT 2KSRA 3K3NA 1ZOYA 5FXVA 3PUGA 2XJ7A 4YTMA 3I0OA 5AQUB 1LVFA 4JI0T 4XAXB 1I94T 4JI5T 2UXNB 1HR0T 3U3IA 3P4PA 4NPPA 5AQJB 3SS1A 4EEBA 1IJ5A 1J1JA 3M65A 3RIUA 2VKJA 1YD8G 1XDOA 3VR9A 3AE2A 2X9HA 2WDRA 4IGUA 4TWHA 2VASA 3ONXA 2VL0A 2YEVC 3RQWA 4DUYT 2H7VC 2X9XA 2L3LA 4ILAA 3Q5DA 3SOLA 5AQIB 1LKXA 5FMNA 3ZYKA 4ILUA 4OHFA 5LHGB 2E5LT 2CA5A 2MOZA 3KV5A 1Z8UA 4PJLA 2BS2A 4UXNB 1IBKT 4B3MT 3RKGA 4JI1T 3J7Yq 3MACA 2CCQA 4OX9T 3AA7B 1BR4A 2FBWA 3AB3B 3ZT7A 3GMIA 3LSVA 4EYYR 5EZYE 2CXFA 2BZBA 3MXZA 1HG2A 2G0UA 2V7LA 3A7MA 3D0TA 3OKQA 5FL1A 2AE9A 3LK42 3ZSTA 5AQVB 4YSXA 5JQGE 1IBMT 2HN1A 2X66A 2LSKA 1M62A 2ZM2A 4WNKA 1HF8A 2XM1A 3AEFA 5LGUB 1HFAA 2NWBA 4B6XA 3P8CD 4ANJA 3MA9A 2W2UA 2MYSA 2WU5A 3FZMB 3QK6A 3L3PA 4O2AE 4LFBT 1IZNB 2CBIA 5FL0A 4DV7T 2LOPA 4CXYA 2Q9QC 3AEDA 1D0XA 1E7PA 3EDVA 5AQSB 3VHLA 4L9IA 5HEOA 3ZEFB 3HI2A 3UT5E 3V5UA 3RYHE 4U7IA 1YQ4A 5HEHA 3PU8A 2A2FX 4ZOLE 4UF0A 2MTQA 5DQVA 3TLTA 2XM2A 1T72A 4IL4A 5JDNA 4DR7T 3FB2A 2CRBA 2WP9A 3ZMTB 3PUYF 3LBXB 3PTRB 5EK3A 1OEDE 2DNXA 3M3ZB 4CXXA 2EHOD 3E0ZA 5LCYA 2VKOA 4L5GA 3LK3B 1VCSA 1CHUA 3ZN1B 3RC8A 2HHHT 1FMWA 2IIUA 3B57A 5AQTB 4E7ZA 1XMOT 3RI5A 1EZ3A 3EHZA 4TV8E 1YQ3A 2KWHA 3UFGA 2YU1A 4O8SA 4TZ4C 5LA6E 5HXHA 3P4WA 2IC6A 2WWUA 2H89A 3MKDA 4I50E 4QX8B 3RX6A 2BKOA 4BJNA 5HYAA 2V7MA 5FVLA 4Z91A 2LEHA 3ZJ1A 3ESLA 2E5VA 5ABHA 2JMHA 4HFEA 5L3GB 1W09A 2BG9C 3ONJA 2EHOA 4TX5A 4U31A 2JQ9A 3PUZF 2C0SA 4NIQA 4ZS3A 1UUSA 2PTFA 2Z6EA 4P1NA 4CI2B 3K3OA 3LFMA 4EIWA 2E8IA 4LFAT 2WY2A 2WDQA 3PUXF 4KMCA 2N1GA 5IYZE 4YY3T 1IBLT 2LT3A 4YLHA 1MMDA 2RA1A 5HXSA 2CE7A 4OK0A 3ANWA 4B3ST 2C5KT 3AE9A 3EVYA 3TLUA 3ETUA 2LSIA 2V6YA 4GOUA 3ONLC 4YTNA 2X0HA 1ZEEA 4HN9A 4UELA 2DI4A 5E0OA 3R6NA 4CN6A 4EZ4A 3VKGA 2D2SA 2XY8B 4PK6A 3AVSA 4N78D 3AA6B 4X62T 3RYIE 5AQLB 1WR0A 1ZHCA 1MNEA 2MBGA 3VRBA 4FJOA 4K0UA 3NVOA 2H7OA 2UUBT 2C5IT 3K3QC 5FVKA 1D1BA 3B13A 2WMNA 5JDFA 5C8YE 4H9SE 4YHHT 3CQXC 3B5MA 3ZYLA 2LHNA 2ES0A 2BG9A 2WAUA 5KMGP 4DR4T 5EK4A 3E22E 2BVMA 2K48A 2W67A 4IT4A 5CGMA 2BKNA 4FI5A 5LBMA 4IDZA 4F8HA 3QUJA 4ISTA 3AE6A 3UUNA 3AEBA 3HR0A 3MJXA 3N2GE 4AKLA 5L3FB 2P9BA 2CLYC 2V8SV 3CWZB 4GK0E 4CQIA 3ZN0B 4KHZF 5L4HA 5HEJA 2BBJA 5IHYA 3NWIA 1M7KA 3RQUA 4WBNE 3RF1A 2KNDA 2XQ5A 3N9NA 4PAGA 4QH4A 5AQRB 1T98A 4BJMA 2V5DA 4ADZA 3N9QA 1SUMB 4DMVA 4JBWF 1OEDA 4P0AA 1KNPA 1HNZT 4KHPT 5H6RB 4GIWA 5CFBA 4HFCA 2JQKA 4HFHA 3MZKB 5FP3A 2XSAA 5LYJE 1VCTA 3GWHA 4QX7B 2X51A 1QLBA 2ZMAA 5AQHB 1XMQT 3O9XA 5L2LA 4O4IE 1KFYA 3O1JA 4HFIA 5LJMA 3AE7A 1XNRT 2CMRA 2NW8A 2Q9QA 2V6YB 4HE8A 5HCMA 3ZPOA 2KZ7B 1OEDC 3FZKB 5HEGA 3CMLA 3FBZA 5LOVE 1WCRA 3Q2MA 3ZSSA 2PBIA 2CLYB 4F6RC 5LNKA 1BR1A 1WRDA 2XAJB 2Y48B 2RPAA 3CIRA 3CX6B 3I9WA 3UU6A 4A98A 4DV1T 1KNRA 2JQHA 3BQLA 5FXWA 4ZI3C 4YTPA 5L3DB 3H3MA 1WYBA 3HL6A 5AQNB 4IE5A 5L3EB 3I9YA 2K24A 4YSYA 2V7KA 3SWHA 1W0AA 2BG9E 3HA4A 2X0YA 3NRYA 3UU4A 2W00A 2XAQB 4U3CA 4DV2T 5LHIB 2FJEA 2X67A 5KXJA 2WCAA 1FEWA 2JQQA 3I0QA 4ASKA 4M1PA 5AQOB 3AE8A 2CXDA 3L09A 3OYXA 1OXZA 4MBQA 3AAIA 3AAAB 3DJBA 4LMKA 3RKOA 2WSSV 3F2EA 2NTXA 4DUZT 1XWMA 4I55E 4JI8T 4X1KE 2CHOA 2WU2A 1HNXT 3ZMVB 4LMLA 2HN2A 1XZYA 4X20E 3ZMZB 4MFRA 4TNVA 4PJJA 1SHZC 1UK5A 1W0BA 3RIUC 3CK6A 3C50A 3Q5XA 1XDPA 4MALA 4YSZA 5JH7E 2WWVA 4X5TA 3FHNA 1LVKA 2XAFB 5GONE 3LK2B 3OVUA 3QNUA 2CXLA 3NZPA 4YJ3E 4ILCA 2D5UA 4P09A 2GK9A 3FZFB 3G06A 4A56A 4LF6T 3FZHB 2LHRA 4JLEA 4LF5T 3PU3A 2A9UA 5AQMB 3PUQA 5JDLA 3CX7B 4QKNA 4YXDA 4H9RC 2B76A 3AE5A 2CWYA 4JEHB 1AJ3A 4DO0A 5AFUL 1CUNA 2NR4A 2XQ8A 4IHJE 3SFEA 2UUAT 4ZEYA 2JPFA 1S94A 1HCIA 2NOXA 1D0YA 1IAPA 3PV0F 4TWDA 4LFCT 4WZXA 2RP4A 1N34T 2H3RA 4HWFA 2WMOA 1WYCA 4HFVA 4PJMA 1VOMA 1U5PA 2M67A 3H3AA 2IMLA 1LRZA 4IDOA 4UIGA 4UVAB 4PFPA 3A8YC 5ABFB 1SE7A 3AXJB 2WDVA 3UQ4A 1J5WA 3DTOA 1D1CA 4QWNB 4YFSA 5BR8T 4AQGA 4HGAA 2BDEA 3OJAA 2BS3A 4OYJA 4I4TE 4DR1T 2ZM8A 1S35A 2NTYA 2W4XA 1QSDA 2B1EA 3AXJA 2QA7A 3I1AA 5HEUA 2KXPB 2E9XA 3C51A 4QH1A 5LBQB 4DNDA 2PJQA 5FXXA 4U2ZA 4X66T 3N9LA 4KP3C 3ZJ2A 4AIUA 4EYUA 1KEYA 1MMNA 2E9XC 5JTGA 3ABVA 5BMVE 2LSJA 3CPZA 3CX8B 3NZQA 2X0LB 2A72A 3PE0A 2LKGA 4IE0A 2PFVA 2W0GA 3EI0A 4O2BE 2DWKA 4UVCB 2J1DG 5FKYA 2KWIB 4HFDA 3TLWA 3ZYMA 2WQYA 4KI0F 4KBMB 4AKRB 4CZZB 4XBFB 4U33A 3ZKRA 2IAKA 2I59A 3RGLA 2YDRA 1YKHB 4LF4T 2DLRA 3FZLB 3NRXA 3AA1B 2XQAA 4GKJT 2UXXB 2XQ7A 4DIDB 4WW0A 2X68A 3N9OA 3IF8B 3BQIA 3N2OA 4IDPA 4WYVA 3FXEB 5KDMC 3AE3A 4NUUA 2LM9A 2Y6XA 3BQKA 1Y01A 2XAHB 3P7IA 3PJAA 2A3DA 3KVBA 4DMWA 4Z8XA 4JI2T 3RPUA 3RC3A 5LGTB 4YHJA 4ERRA 2XQ6A 3Q9DA 5AQFB 1X79A 4X1YE 2W62A 2W61A 2H88A 4LF7T 2V6XA 3LG7A 4UV9B 2UXDT 2LSYA 2NW7A 2XPKA 4PFOA 1E1HB 2DL1A 1G8XA 1HX1B 2CWOA 3AVRA 3U78A 4AQFA 4I0UA 4JI4T 1MIVA 2BVLA 2CM0A 3LJCA 4CXWA 2WBLA 5LGNB 5HWXA 1US7B 2UU9T 4HWHA 5JDMA 4ZI3D 3HKBE 5CB4E 3ZCIA 1R8IA 1V9DA 2LE8A 3F31A 4NXNT 2Y8DA 1ZKEA 4H9OC 4MHCA 4AKIA 2LJLA 3KV9A 2VKHA 1W9RA 1YW0A 4ZHQE 2W66A 2C5JA 1DU2A 4JI7T 2QYWA 3ZT5A 4G2AA 2IW5B 2DWGA 3J9X1 3UUMA 4UEMA 4LF8T 2UXBT 3MK7C 2AXDS 3OTOT 1MMAA 1O3XA 2BS4A 2HPJA 3KV6A 2WM9A 4AQFC 1UX4A 3ETVA 2VL8A 4TWFA 4DR2T 2OLTA 4V1Av 2Q9QB 3AECA 5A1LA 2YINA 4HWDA 1ZV4X 3QB5K 4COFA 3GN5A 1T8BA 2ODVA 3PJAJ 2V1DB 1NAFA 3N2KE 3C4XA 3JC6C 2J4GA 2LM2A 3O4XE 2YDQA 3OYZA 3RIAA 3RRCA 1I6ZA 3VR8A 3AE4A 3CKDA 3UU5A 4AI6A 2JRKA 4I43B 5H6QB 2BKPA 2FUPA 2XSBA 2ZM6T 2EHOB 4PNIA 3KV4A 3P4SA 4KUMB 4DR6T 4EAHA 2VKDA 5L4EA 4IL9A 3UTKA 5HCJA 4J2CA 4ZI2C 5HXEA 2YOEA 1HS7A 3CVRA 4O4JE 2QRXA 4DVDA 4ZZBA 2YDSA 3P4QA 2LLYA 2LRLA 5JR9B 2XQ9A 5F3JA 3N9PA 1KK7A 3C4ZA 4K0KT 3EUHA 3LDQB 5J1GA 5AQGB 3UUBA 4DV4T 2M6IA 1FMVA 4HFBA 3T1YT 1ZP0A 5LXTE 3CQCB 2WB5A 1UURA 2ZM0A 2K9AA 5JR9A 3UUXB 3WI3A 2LKHA 2FJBA 2R6GF 3EDUA 4JV5T 3AAEB 4BA9A 5ADXL 5LG3A 3ZMSB 5JDQA 4IDNA 3PUAA 3O1HA 2VURA 4QXHB 4BAYB 4ZI2D 3V5SA 2FJAA 2JJ9A 2M6BA 5DABA 2CHNA 2PG8A 2WZHA 5LMNT 3IBPA 4LMJA 2KT9A 2WZIA 4QHOA 4QXBB 1U4QA 3KDSE 4IDQA 4IE6A 4EGWA 4X64T 2W63A 5J0ZA 1YXRA 4PW8A 5FY0A 4GYSA 1OWAA 5JR9C 1KF6A 2XQYA 3PUVF 4IE4A 3JC6D 2E9XB 3AA0B 3VKHA 4O4HE 5FXZA 2K5BB 4CN1A 4EXTA 2D9DA 4XZCA 3QOFA 5L3BB 2X9WA 4LF9T 5F8PA 2CPTA 4Q25A
chains in the Genus database with same CATH topology
5ETWA 2NW9A 1MIWA 1MIYA 3FBLA 4ZI7E 4QXCB 4ZS2A 3GN5B 3ZMUB 4DBQA 4P0BA 2N9DA 3IEEA 5CA1E 3KBTA 5HXRA 3ZCJA 1BR0A 3KFWX 1UX5A 3UULA 4GK5E 4PK4A 1Z0PA 3C98B 3LBXA 4C91A 3PDYA 5J2UE 1D1AA 3Q5WA 2L8KA 2XASB 4PK5A 2D0TA 3R84B 5FNVE 2YU2A 1HTJF 1NWMX 2LOSA 1MMGA 1WR6A 4AKGA 4OFZA 1HX8A 1G73A 2HH7A 5DQWA 2KLQA 4C90A 4EOZB 3W15B 1VRBA 2Q9QD 2VWAA 4H63H 3KVAA 3NBXX 4U72A 3HKEE 4YJ2E 5HWYA 3S4UA 4IIJE 5FYMA 4WBOA 5M4YA 1Y64B 1IJ6A 4TV9E 1H7CA 2VK9A 3CQGB 4NUVA 2SPCA 4H9QC 4H63V 2XUEA 1UCUA 5FY1A 5LP6E 2XHEB 4CI1B 4U74A 4EB6E 5JVDE 4IE7A 4H9PC 3BK9A 4ISSA 1QUUA 4OYKA 3DP7A 2KMFA 3FXDB 2X9YA 4HKAA 3ZC0A 2V26A 3IHRA 5HAXA 5LG4A 3PURA 4L0RA 4E7SA 2E9XD 3C64A 2NP9A 5L3CB 1D0ZA 2OA5A 5JREA 2DHRA 1MNDA 2V7JA 1B7TA 4H9NC 3N9MA 4CI3B 5HXCA 2YK0A 2IC9A 2L9QA 2QGSA 4JUYA 5DJQC 4TN7B 3VU7H 1FIOA 4AKHA 2D0UA 2LSGA 3C4WA 3UFEA 4HTEA 3RRWA 3E08A 3H37A 3T8OA 4UF0B 3GA8A 4JEUB 3O1IA 4UVBB 2EHOC 3RYCE 2ZLYA 2XAGB 3N5LA 1SA0E 3WAJA 5JRCB 5EK2A 2VB6A 1HG5A 2JMKA 5LHHB 3A5XA 3HKDE 2DCFA 4MLKA 4X1IE 1KNZA 1YKEB 3K8PC 2N2NA 3KINB 1BR2A 3KBUA 3RYFE 4UV8B 2XTLA 4DBRA 3F57A 1WLXA 2V7IA 2KINB 4AXPA 4TUYE 5JDHA 5JDGA 2ACXA 2ODUA 3PUSA 4G63A 3WAKA 3RH3A 5JRCA 2CEAA 3ANWB 4EZHA 3SRZA 3HKCE 2HPLA 5TAOA 3OBVE 3QC9A 5LJNA 5J2TE 3ZC1A 4PJNA 4HEAA 4O4LE 3ZLIA 5KX5E 3TKLB 4GYRA 3K3NA 5FXVA 3PUGA 3I0OA 1LVFA 4XAXB 2UXNB 3U3IA 3SS1A 1IJ5A 3M65A 2VKJA 1YD8G 2X9HA 4IGUA 2VASA 3ONXA 2YEVC 2H7VC 2X9XA 2L3LA 3SOLA 3ZYKA 5LHGB 1LKXA 5FMNA 4ILUA 4OHFA 2CA5A 2MOZA 3KV5A 4PJLA 4UXNB 3J7Yq 3MACA 2CCQA 3AA7B 1BR4A 3AB3B 3GMIA 4EYYR 5EZYE 2CXFA 2BZBA 3MXZA 1HG2A 2G0UA 2V7LA 3D0TA 3OKQA 5JQGE 3LK42 2X66A 2LSKA 2ZM2A 4WNKA 1HF8A 5LGUB 1HFAA 2NWBA 4B6XA 3P8CD 4ANJA 3MA9A 2MYSA 3QK6A 3L3PA 4O2AE 1IZNB 2LOPA 4CXYA 2Q9QC 1D0XA 3EDVA 3VHLA 4L9IA 3ZEFB 3HI2A 3UT5E 3V5UA 3RYHE 3PU8A 2A2FX 4ZOLE 4UF0A 2MTQA 5DQVA 5JDNA 3FB2A 3ZMTB 3LBXB 3PTRB 5EK3A 2DNXA 4CXXA 2EHOD 3E0ZA 5LCYA 2VKOA 4L5GA 3LK3B 3ZN1B 3RC8A 1FMWA 3B57A 4E7ZA 1EZ3A 4TV8E 2KWHA 2YU1A 4O8SA 4TZ4C 5LA6E 5HXHA 4QX8B 2IC6A 2WWUA 3MKDA 4I50E 3RX6A 4BJNA 5HYAA 2V7MA 2LEHA 3ZJ1A 3ESLA 2JMHA 5L3GB 2EHOA 4TX5A 2C0SA 4ZS3A 2Z6EA 4CI2B 3K3OA 3LFMA 4EIWA 2E8IA 4KMCA 2N1GA 5IYZE 2LT3A 4YLHA 1MMDA 2RA1A 5HXSA 2CE7A 4OK0A 3ANWA 2C5KT 3EVYA 3ETUA 2LSIA 4GOUA 1ZEEA 4HN9A 4UELA 2DI4A 5E0OA 3R6NA 4EZ4A 3VKGA 2D2SA 4PK6A 3AVSA 4N78D 3AA6B 3RYIE 1ZHCA 2MBGA 1MNEA 4FJOA 4K0UA 2H7OA 2C5IT 3K3QC 1D1BA 3B13A 2WMNA 5JDFA 5C8YE 4H9SE 3CQXC 3ZYLA 2LHNA 2ES0A 5KMGP 2WAUA 5EK4A 3E22E 2BVMA 2K48A 4FI5A 5LBMA 4IDZA 3QUJA 4ISTA 3UUNA 3MJXA 3HR0A 3N2GE 4AKLA 5L3FB 2P9BA 2CLYC 3CWZB 4GK0E 4CQIA 3ZN0B 5IHYA 4WBNE 2KNDA 3N9NA 4PAGA 4BJMA 1T98A 4ADZA 3N9QA 4DMVA 4P0AA 5H6RB 4GIWA 3MZKB 5FP3A 5LYJE 3GWHA 4QX7B 2X51A 2ZMAA 3O9XA 5L2LA 4O4IE 3O1JA 5LJMA 2CMRA 2NW8A 2Q9QA 4HE8A 3ZPOA 2KZ7B 3CMLA 3FBZA 5LOVE 3Q2MA 2PBIA 2CLYB 4F6RC 5LNKA 1BR1A 2Y48B 1WRDA 2XAJB 3CX6B 3I9WA 5FXWA 3BQLA 4ZI3C 5L3DB 1WYBA 3HL6A 4IE5A 5L3EB 3I9YA 2K24A 2V7KA 3SWHA 3NRYA 3HA4A 2W00A 2XAQB 5LHIB 2X67A 1FEWA 2JQQA 3I0QA 4ASKA 4M1PA 2CXDA 3L09A 3OYXA 1OXZA 4MBQA 3AAIA 3AAAB 3DJBA 3RKOA 2WSSV 3F2EA 2NTXA 4I55E 4X1KE 3ZMVB 4X20E 3ZMZB 4MFRA 4PJJA 1SHZC 3C50A 3Q5XA 4MALA 5JH7E 3FHNA 1LVKA 2XAFB 5GONE 3LK2B 4YJ3E 2CXLA 3NZPA 4P09A 2D5UA 2GK9A 4A56A 4JLEA 2LHRA 3PU3A 5JDLA 3PUQA 3CX7B 4QKNA 4H9RC 2CWYA 4JEHB 1AJ3A 4DO0A 5AFUL 1CUNA 4IHJE 2JPFA 1HCIA 1S94A 2NOXA 1D0YA 1IAPA 2RP4A 2H3RA 2WMOA 1WYCA 4HFVA 4PJMA 1VOMA 1U5PA 2M67A 3H3AA 1LRZA 4UIGA 4UVAB 4PFPA 3DTOA 1D1CA 4QWNB 4YFSA 4AQGA 4HGAA 2BDEA 3OJAA 4OYJA 4I4TE 2ZM8A 1S35A 2NTYA 3I1AA 1QSDA 2B1EA 2QA7A 2KXPB 2E9XA 3C51A 5LBQB 4DNDA 2PJQA 5FXXA 3N9LA 4KP3C 3ZJ2A 4EYUA 1MMNA 2E9XC 3CPZA 2LSJA 3CX8B 3NZQA 2X0LB 2A72A 3PE0A 4IE0A 4O2BE 2PFVA 2W0GA 4UVCB 5FY7A 2DWKA 3ZYMA 2J1DG 4ERRA 2KWIB 4AKRB 5CA0E 4XBFB 4KBMB 4CZZB 2IAKA 2I59A 1YKHB 2DLRA 3NRXA 3AA1B 2UXXB 4WW0A 2X68A 3N9OA 3IF8B 3BQIA 3N2OA 5KDMC 3FXEB 4NUUA 2LM9A 2Y6XA 3BQKA 2XAHB 3P7IA 2A3DA 3KVBA 4DMWA 4Z8XA 3RPUA 3RC3A 5LGTB 4YHJA 3Q9DA 1X79A 4X1YE 2W62A 2W61A 3LG7A 4UV9B 2LSYA 2NW7A 4PFOA 1E1HB 4AQFA 1G8XA 3AVRA 2CWOA 3U78A 1MIVA 2BVLA 2CM0A 3LJCA 4CXWA 2WBLA 5LGNB 5HWXA 1US7B 5JDMA 4ZI3D 3HKBE 5CB4E 3ZCIA 1V9DA 2LE8A 3F31A 2Y8DA 1ZKEA 4H9OC 4MHCA 4AKIA 2LJLA 3KV9A 2VKHA 4ZHQE 1YW0A 2C5JA 4G2AA 2IW5B 2DWGA 3J9X1 3UUMA 4UEMA 3MK7C 1MMAA 1O3XA 2HPJA 3KV6A 2WM9A 4AQFC 1UX4A 3ETVA 2VL8A 4V1Av 2Q9QB 5A1LA 2YINA 1ZV4X 3GN5A 2ODVA 5BMVE 2V1DB 1NAFA 3N2KE 3C4XA 3JC6C 3O4XE 3OYZA 3RRCA 3CKDA 4AI6A 2JRKA 4I43B 5H6QB 2EHOB 4PNIA 3KV4A 4KUMB 4EAHA 2VKDA 3UTKA 4J2CA 4ZI2C 5HXEA 1HS7A 3CVRA 4O4JE 4DVDA 5JR9B 5F3JA 3N9PA 1KK7A 3C4ZA 3EUHA 5J1GA 1FMVA 5LXTE 3CQCB 2ZM0A 2K9AA 5JR9A 3UUXB 3WI3A 3EDUA 3AAEB 4BA9A 5ADXL 3ZMSB 5JDQA 3PUAA 3O1HA 4BAYB 4QXHB 4ZI2D 3V5SA 2JJ9A 5DABA 2PG8A 3IBPA 2KT9A 4QHOA 4QXBB 1U4QA 3KDSE 4IE6A 2W63A 4PW8A 5FY0A 4GYSA 1OWAA 5JR9C 2XQYA 4IE4A 3JC6D 2E9XB 3AA0B 3VKHA 4O4HE 5FXZA 2K5BB 4EXTA 4XZCA 5L3BB 2X9WA 5F8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI3 C;  4ZI2 D;  4ZI3 D;  2K9A A;  4ZI2 C; 
#chains in the Genus database with same CATH topology
 5ETW A;  2XZE A;  2NW9 A;  1MIW A;  1MIY A;  3FBL A;  3ZT6 A;  4ZI7 E;  1HNW T;  4QXC B;  5AQK B;  2K3W A;  4ZS2 A;  4Z90 A;  3GN5 B;  3ZMU B;  4DBQ A;  4P0B A;  4B3T T;  2N9D A;  2VVS A;  3IEE A;  3JCF A;  1GQE A;  5CA1 E;  1NEK A;  2YKS A;  4U2Y A;  3KBT A;  2MPK A;  2JIW A;  4AQY T;  1X9B A;  2VVN A;  5HXR A;  3ZCJ A;  1BR0 A;  3KFW X;  1UX5 A;  4YT0 A;  3UUL A;  3AEG A;  2XQ3 A;  4GK5 E;  4PK4 A;  1Z0P A;  3C98 B;  3LBX A;  3OPC A;  4C91 A;  5CJ5 A;  4X65 T;  4DV0 T;  1JNR A;  3PDY A;  5JRC A;  5IWA T;  5J2U E;  2CBJ A;  1D1A A;  2WS3 A;  3Q5W A;  4B3R T;  4DV6 T;  4IRE A;  2IDO B;  1OED B;  2L8K A;  2XAS B;  4PK5 A;  4DR5 T;  1N32 T;  2D0T A;  3X1D A;  4JYA T;  3JAF A;  3R84 B;  3L8R A;  1JNZ A;  5FNV E;  2YU2 A;  1HTJ F;  1NWM X;  2OV9 A;  1MMG A;  1WR6 A;  2LOS A;  2YN6 A;  3JAE A;  4OFZ A;  5ABF A;  4AKG A;  1HX8 A;  1G73 A;  2HH7 A;  3EAM A;  5DQW A;  2KLQ A;  4HWI B;  4EED A;  4C90 A;  3UU3 A;  5ABG A;  4EOZ B;  5LB7 B;  3W15 B;  5C2T A;  1VRB A;  2Q9Q D;  2VWA A;  4HWC A;  4H63 H;  2I6H A;  3KVA A;  3RHW A;  3NBX X;  3EAB A;  3HKE E;  4U72 A;  3K1S A;  4YJ2 E;  3RIF A;  5L47 A;  5HWY A;  3S4U A;  3AE1 A;  1E2A A;  4IIJ E;  1N33 T;  5F5W A;  5FYM A;  4WBO A;  5M4Y A;  4JI3 T;  2VQE T;  1Y64 B;  2QVA A;  1IJ6 A;  1NEN A;  3UU8 A;  2BBH A;  4TV9 E;  1H7C A;  3RLF F;  2VK9 A;  3CQG B;  2BG9 B;  4NUV A;  2LRK A;  2SPC A;  5FY7 A;  4ZXL A;  1FJG T;  4H9Q C;  4GKK T;  4H63 V;  2XUE A;  1UCU A;  5FY1 A;  5LP6 E;  2XHE B;  3AEA A;  3QB5 A;  4CI1 B;  1UGO A;  4U74 A;  2FJD A;  4EB6 E;  5JVD E;  2UXC T;  4IE7 A;  4U7Y A;  4H9P C;  3BK9 A;  2J47 A;  4ISS A;  1QUU A;  4JI6 T;  4OYK A;  2VQF T;  3DP7 A;  2KMF A;  2I0M A;  2X9Y A;  3FXD B;  4HKA A;  3ZC0 A;  2V26 A;  3IHR A;  5HAX A;  5LG4 A;  3PUR A;  4L0R A;  4E7S A;  2E9X D;  3C64 A;  2NP9 A;  4ILB A;  1D0Z A;  2OA5 A;  3TLS A;  5L3C B;  2DHR A;  1MND A;  5IUX A;  5JRE A;  2V7J A;  1B7T A;  4H9N C;  3N9M A;  4QH5 A;  3PUW F;  1L0V A;  4CI3 B;  5HXC A;  3UQ7 A;  3T1H T;  2YK0 A;  2IC9 A;  2L9Q A;  2QGS A;  5AQQ B;  1WFD A;  4JUY A;  5DJQ C;  2IHR 1;  4DV5 T;  1J5E T;  4TN7 B;  3VU7 H;  1FIO A;  3IA3 A;  2D0U A;  2LSG A;  3VRA A;  3C4W A;  3UFE A;  4HTE A;  4EV6 A;  4AKH A;  3RRW A;  1N36 T;  3E08 A;  3H37 A;  3T8O A;  4UF0 B;  4CN4 A;  3GA8 A;  4JEU B;  4NXM T;  1T7S A;  3O1I A;  2MAW A;  2EHO C;  4UVB B;  3RYC E;  2ZLY A;  2XAG B;  3N5L A;  1SA0 E;  3WAJ A;  5JRC B;  4ZZC A;  5EK2 A;  2VB6 A;  1HG5 A;  2JMK A;  1XNQ T;  5LHH B;  2ACZ A;  3A5X A;  3HKD E;  3NKZ A;  2DCF A;  4MLK A;  4X1I E;  1KNZ A;  5C3J A;  1YKE B;  3K8P C;  3P50 A;  3Q5E A;  2N2N A;  3KIN B;  1BR2 A;  3TLV A;  2XQ4 A;  3KBU A;  3RYF E;  4UV8 B;  2XTL A;  4DBR A;  5CA0 E;  3F57 A;  4DR3 T;  1WLX A;  2V7I A;  2KIN B;  3JAD A;  4TUY E;  4AXP A;  5JDG A;  2ACX A;  2ODU A;  2V5C A;  3PUS A;  4G63 A;  3RH3 A;  3WAK A;  5JDH A;  4A5X A;  5ABE A;  4AIS A;  2UUC T;  2CEA A;  3ANW B;  4EZH A;  3SRZ A;  3AEE A;  3HKC E;  2HPL A;  2E2A A;  5TAO A;  3OBV E;  3P4R A;  4UR9 A;  5AQP B;  3QC9 A;  5LJN A;  5J2T E;  4DV3 T;  2F4V T;  2J62 A;  3L39 A;  4KX6 A;  4PJN A;  4HEA A;  3SFD A;  3ZC1 A;  4O4L E;  2IUB A;  4TNW A;  3ZLI A;  4A97 A;  3TKL B;  5KX5 E;  4GYR A;  5LMU T;  2KSR A;  3K3N A;  1ZOY A;  5FXV A;  3PUG A;  2XJ7 A;  4YTM A;  3I0O A;  5AQU B;  1LVF A;  4JI0 T;  4XAX B;  1I94 T;  4JI5 T;  2UXN B;  1HR0 T;  3U3I A;  3P4P A;  4NPP A;  5AQJ B;  3SS1 A;  4EEB A;  1IJ5 A;  1J1J A;  3M65 A;  3RIU A;  2VKJ A;  1YD8 G;  1XDO A;  3VR9 A;  3AE2 A;  2X9H A;  2WDR A;  4IGU A;  4TWH A;  2VAS A;  3ONX A;  2VL0 A;  2YEV C;  3RQW A;  4DUY T;  2H7V C;  2X9X A;  2L3L A;  4ILA A;  3Q5D A;  3SOL A;  5AQI B;  1LKX A;  5FMN A;  3ZYK A;  4ILU A;  4OHF A;  5LHG B;  2E5L T;  2CA5 A;  2MOZ A;  3KV5 A;  1Z8U A;  4PJL A;  2BS2 A;  4UXN B;  1IBK T;  4B3M T;  3RKG A;  4JI1 T;  3J7Y q;  3MAC A;  2CCQ A;  4OX9 T;  3AA7 B;  1BR4 A;  2FBW A;  3AB3 B;  3ZT7 A;  3GMI A;  3LSV A;  4EYY R;  5EZY E;  2CXF A;  2BZB A;  3MXZ A;  1HG2 A;  2G0U A;  2V7L A;  3A7M A;  3D0T A;  3OKQ A;  5FL1 A;  2AE9 A;  3LK4 2;  3ZST A;  5AQV B;  4YSX A;  5JQG E;  1IBM T;  2HN1 A;  2X66 A;  2LSK A;  1M62 A;  2ZM2 A;  4WNK A;  1HF8 A;  2XM1 A;  3AEF A;  5LGU B;  1HFA A;  2NWB A;  4B6X A;  3P8C D;  4ANJ A;  3MA9 A;  2W2U A;  2MYS A;  2WU5 A;  3FZM B;  3QK6 A;  3L3P A;  4O2A E;  4LFB T;  1IZN B;  2CBI A;  5FL0 A;  4DV7 T;  2LOP A;  4CXY A;  2Q9Q C;  3AED A;  1D0X A;  1E7P A;  3EDV A;  5AQS B;  3VHL A;  4L9I A;  5HEO A;  3ZEF B;  3HI2 A;  3UT5 E;  3V5U A;  3RYH E;  4U7I A;  1YQ4 A;  5HEH A;  3PU8 A;  2A2F X;  4ZOL E;  4UF0 A;  2MTQ A;  5DQV A;  3TLT A;  2XM2 A;  1T72 A;  4IL4 A;  5JDN A;  4DR7 T;  3FB2 A;  2CRB A;  2WP9 A;  3ZMT B;  3PUY F;  3LBX B;  3PTR B;  5EK3 A;  1OED E;  2DNX A;  3M3Z B;  4CXX A;  2EHO D;  3E0Z A;  5LCY A;  2VKO A;  4L5G A;  3LK3 B;  1VCS A;  1CHU A;  3ZN1 B;  3RC8 A;  2HHH T;  1FMW A;  2IIU A;  3B57 A;  5AQT B;  4E7Z A;  1XMO T;  3RI5 A;  1EZ3 A;  3EHZ A;  4TV8 E;  1YQ3 A;  2KWH A;  3UFG A;  2YU1 A;  4O8S A;  4TZ4 C;  5LA6 E;  5HXH A;  3P4W A;  2IC6 A;  2WWU A;  2H89 A;  3MKD A;  4I50 E;  4QX8 B;  3RX6 A;  2BKO A;  4BJN A;  5HYA A;  2V7M A;  5FVL A;  4Z91 A;  2LEH A;  3ZJ1 A;  3ESL A;  2E5V A;  5ABH A;  2JMH A;  4HFE A;  5L3G B;  1W09 A;  2BG9 C;  3ONJ A;  2EHO A;  4TX5 A;  4U31 A;  2JQ9 A;  3PUZ F;  2C0S A;  4NIQ A;  4ZS3 A;  1UUS A;  2PTF A;  2Z6E A;  4P1N A;  4CI2 B;  3K3O A;  3LFM A;  4EIW A;  2E8I A;  4LFA T;  2WY2 A;  2WDQ A;  3PUX F;  4KMC A;  2N1G A;  5IYZ E;  4YY3 T;  1IBL T;  2LT3 A;  4YLH A;  1MMD A;  2RA1 A;  5HXS A;  2CE7 A;  4OK0 A;  3ANW A;  4B3S T;  2C5K T;  3AE9 A;  3EVY A;  3TLU A;  3ETU A;  2LSI A;  2V6Y A;  4GOU A;  3ONL C;  4YTN A;  2X0H A;  1ZEE A;  4HN9 A;  4UEL A;  2DI4 A;  5E0O A;  3R6N A;  4CN6 A;  4EZ4 A;  3VKG A;  2D2S A;  2XY8 B;  4PK6 A;  3AVS A;  4N78 D;  3AA6 B;  4X62 T;  3RYI E;  5AQL B;  1WR0 A;  1ZHC A;  1MNE A;  2MBG A;  3VRB A;  4FJO A;  4K0U A;  3NVO A;  2H7O A;  2UUB T;  2C5I T;  3K3Q C;  5FVK A;  1D1B A;  3B13 A;  2WMN A;  5JDF A;  5C8Y E;  4H9S E;  4YHH T;  3CQX C;  3B5M A;  3ZYL A;  2LHN A;  2ES0 A;  2BG9 A;  2WAU A;  5KMG P;  4DR4 T;  5EK4 A;  3E22 E;  2BVM A;  2K48 A;  2W67 A;  4IT4 A;  5CGM A;  2BKN A;  4FI5 A;  5LBM A;  4IDZ A;  4F8H A;  3QUJ A;  4IST A;  3AE6 A;  3UUN A;  3AEB A;  3HR0 A;  3MJX A;  3N2G E;  4AKL A;  5L3F B;  2P9B A;  2CLY C;  2V8S V;  3CWZ B;  4GK0 E;  4CQI A;  3ZN0 B;  4KHZ F;  5L4H A;  5HEJ A;  2BBJ A;  5IHY A;  3NWI A;  1M7K A;  3RQU A;  4WBN E;  3RF1 A;  2KND A;  2XQ5 A;  3N9N A;  4PAG A;  4QH4 A;  5AQR B;  1T98 A;  4BJM A;  2V5D A;  4ADZ A;  3N9Q A;  1SUM B;  4DMV A;  4JBW F;  1OED A;  4P0A A;  1KNP A;  1HNZ T;  4KHP T;  5H6R B;  4GIW A;  5CFB A;  4HFC A;  2JQK A;  4HFH A;  3MZK B;  5FP3 A;  2XSA A;  5LYJ E;  1VCT A;  3GWH A;  4QX7 B;  2X51 A;  1QLB A;  2ZMA A;  5AQH B;  1XMQ T;  3O9X A;  5L2L A;  4O4I E;  1KFY A;  3O1J A;  4HFI A;  5LJM A;  3AE7 A;  1XNR T;  2CMR A;  2NW8 A;  2Q9Q A;  2V6Y B;  4HE8 A;  5HCM A;  3ZPO A;  2KZ7 B;  1OED C;  3FZK B;  5HEG A;  3CML A;  3FBZ A;  5LOV E;  1WCR A;  3Q2M A;  3ZSS A;  2PBI A;  2CLY B;  4F6R C;  5LNK A;  1BR1 A;  1WRD A;  2XAJ B;  2Y48 B;  2RPA A;  3CIR A;  3CX6 B;  3I9W A;  3UU6 A;  4A98 A;  4DV1 T;  1KNR A;  2JQH A;  3BQL A;  5FXW A;  4ZI3 C;  4YTP A;  5L3D B;  3H3M A;  1WYB A;  3HL6 A;  5AQN B;  4IE5 A;  5L3E B;  3I9Y A;  2K24 A;  4YSY A;  2V7K A;  3SWH A;  1W0A A;  2BG9 E;  3HA4 A;  2X0Y A;  3NRY A;  3UU4 A;  2W00 A;  2XAQ B;  4U3C A;  4DV2 T;  5LHI B;  2FJE A;  2X67 A;  5KXJ A;  2WCA A;  1FEW A;  2JQQ A;  3I0Q A;  4ASK A;  4M1P A;  5AQO B;  3AE8 A;  2CXD A;  3L09 A;  3OYX A;  1OXZ A;  4MBQ A;  3AAI A;  3AAA B;  3DJB A;  4LMK A;  3RKO A;  2WSS V;  3F2E A;  2NTX A;  4DUZ T;  1XWM A;  4I55 E;  4JI8 T;  4X1K E;  2CHO A;  2WU2 A;  1HNX T;  3ZMV B;  4LML A;  2HN2 A;  1XZY A;  4X20 E;  3ZMZ B;  4MFR A;  4TNV A;  4PJJ A;  1SHZ C;  1UK5 A;  1W0B A;  3RIU C;  3CK6 A;  3C50 A;  3Q5X A;  1XDP A;  4MAL A;  4YSZ A;  5JH7 E;  2WWV A;  4X5T A;  3FHN A;  1LVK A;  2XAF B;  5GON E;  3LK2 B;  3OVU A;  3QNU A;  2CXL A;  3NZP A;  4YJ3 E;  4ILC A;  2D5U A;  4P09 A;  2GK9 A;  3FZF B;  3G06 A;  4A56 A;  4LF6 T;  3FZH B;  2LHR A;  4JLE A;  4LF5 T;  3PU3 A;  2A9U A;  5AQM B;  3PUQ A;  5JDL A;  3CX7 B;  4QKN A;  4YXD A;  4H9R C;  2B76 A;  3AE5 A;  2CWY A;  4JEH B;  1AJ3 A;  4DO0 A;  5AFU L;  1CUN A;  2NR4 A;  2XQ8 A;  4IHJ E;  3SFE A;  2UUA T;  4ZEY A;  2JPF A;  1S94 A;  1HCI A;  2NOX A;  1D0Y A;  1IAP A;  3PV0 F;  4TWD A;  4LFC T;  4WZX A;  2RP4 A;  1N34 T;  2H3R A;  4HWF A;  2WMO A;  1WYC A;  4HFV A;  4PJM A;  1VOM A;  1U5P A;  2M67 A;  3H3A A;  2IML A;  1LRZ A;  4IDO A;  4UIG A;  4UVA B;  4PFP A;  3A8Y C;  5ABF B;  1SE7 A;  3AXJ B;  2WDV A;  3UQ4 A;  1J5W A;  3DTO A;  1D1C A;  4QWN B;  4YFS A;  5BR8 T;  4AQG A;  4HGA A;  2BDE A;  3OJA A;  2BS3 A;  4OYJ A;  4I4T E;  4DR1 T;  2ZM8 A;  1S35 A;  2NTY A;  2W4X A;  1QSD A;  2B1E A;  3AXJ A;  2QA7 A;  3I1A A;  5HEU A;  2KXP B;  2E9X A;  3C51 A;  4QH1 A;  5LBQ B;  4DND A;  2PJQ A;  5FXX A;  4U2Z A;  4X66 T;  3N9L A;  4KP3 C;  3ZJ2 A;  4AIU A;  4EYU A;  1KEY A;  1MMN A;  2E9X C;  5JTG A;  3ABV A;  5BMV E;  2LSJ A;  3CPZ A;  3CX8 B;  3NZQ A;  2X0L B;  2A72 A;  3PE0 A;  2LKG A;  4IE0 A;  2PFV A;  2W0G A;  3EI0 A;  4O2B E;  2DWK A;  4UVC B;  2J1D G;  5FKY A;  2KWI B;  4HFD A;  3TLW A;  3ZYM A;  2WQY A;  4KI0 F;  4KBM B;  4AKR B;  4CZZ B;  4XBF B;  4U33 A;  3ZKR A;  2IAK A;  2I59 A;  3RGL A;  2YDR A;  1YKH B;  4LF4 T;  2DLR A;  3FZL B;  3NRX A;  3AA1 B;  2XQA A;  4GKJ T;  2UXX B;  2XQ7 A;  4DID B;  4WW0 A;  2X68 A;  3N9O A;  3IF8 B;  3BQI A;  3N2O A;  4IDP A;  4WYV A;  3FXE B;  5KDM C;  3AE3 A;  4NUU A;  2LM9 A;  2Y6X A;  3BQK A;  1Y01 A;  2XAH B;  3P7I A;  3PJA A;  2A3D A;  3KVB A;  4DMW A;  4Z8X A;  4JI2 T;  3RPU A;  3RC3 A;  5LGT B;  4YHJ A;  4ERR A;  2XQ6 A;  3Q9D A;  5AQF B;  1X79 A;  4X1Y E;  2W62 A;  2W61 A;  2H88 A;  4LF7 T;  2V6X A;  3LG7 A;  4UV9 B;  2UXD T;  2LSY A;  2NW7 A;  2XPK A;  4PFO A;  1E1H B;  2DL1 A;  1G8X A;  1HX1 B;  2CWO A;  3AVR A;  3U78 A;  4AQF A;  4I0U A;  4JI4 T;  1MIV A;  2BVL A;  2CM0 A;  3LJC A;  4CXW A;  2WBL A;  5LGN B;  5HWX A;  1US7 B;  2UU9 T;  4HWH A;  5JDM A;  4ZI3 D;  3HKB E;  5CB4 E;  3ZCI A;  1R8I A;  1V9D A;  2LE8 A;  3F31 A;  4NXN T;  2Y8D A;  1ZKE A;  4H9O C;  4MHC A;  4AKI A;  2LJL A;  3KV9 A;  2VKH A;  1W9R A;  1YW0 A;  4ZHQ E;  2W66 A;  2C5J A;  1DU2 A;  4JI7 T;  2QYW A;  3ZT5 A;  4G2A A;  2IW5 B;  2DWG A;  3J9X 1;  3UUM A;  4UEM A;  4LF8 T;  2UXB T;  3MK7 C;  2AXD S;  3OTO T;  1MMA A;  1O3X A;  2BS4 A;  2HPJ A;  3KV6 A;  2WM9 A;  4AQF C;  1UX4 A;  3ETV A;  2VL8 A;  4TWF A;  4DR2 T;  2OLT A;  4V1A v;  2Q9Q B;  3AEC A;  5A1L A;  2YIN A;  4HWD A;  1ZV4 X;  3QB5 K;  4COF A;  3GN5 A;  1T8B A;  2ODV A;  3PJA J;  2V1D B;  1NAF A;  3N2K E;  3C4X A;  3JC6 C;  2J4G A;  2LM2 A;  3O4X E;  2YDQ A;  3OYZ A;  3RIA A;  3RRC A;  1I6Z A;  3VR8 A;  3AE4 A;  3CKD A;  3UU5 A;  4AI6 A;  2JRK A;  4I43 B;  5H6Q B;  2BKP A;  2FUP A;  2XSB A;  2ZM6 T;  2EHO B;  4PNI A;  3KV4 A;  3P4S A;  4KUM B;  4DR6 T;  4EAH A;  2VKD A;  5L4E A;  4IL9 A;  3UTK A;  5HCJ A;  4J2C A;  4ZI2 C;  5HXE A;  2YOE A;  1HS7 A;  3CVR A;  4O4J E;  2QRX A;  4DVD A;  4ZZB A;  2YDS A;  3P4Q A;  2LLY A;  2LRL A;  5JR9 B;  2XQ9 A;  5F3J A;  3N9P A;  1KK7 A;  3C4Z A;  4K0K T;  3EUH A;  3LDQ B;  5J1G A;  5AQG B;  3UUB A;  4DV4 T;  2M6I A;  1FMV A;  4HFB A;  3T1Y T;  1ZP0 A;  5LXT E;  3CQC B;  2WB5 A;  1UUR A;  2ZM0 A;  2K9A A;  5JR9 A;  3UUX B;  3WI3 A;  2LKH A;  2FJB A;  2R6G F;  3EDU A;  4JV5 T;  3AAE B;  4BA9 A;  5ADX L;  5LG3 A;  3ZMS B;  5JDQ A;  4IDN A;  3PUA A;  3O1H A;  2VUR A;  4QXH B;  4BAY B;  4ZI2 D;  3V5S A;  2FJA A;  2JJ9 A;  2M6B A;  5DAB A;  2CHN A;  2PG8 A;  2WZH A;  5LMN T;  3IBP A;  4LMJ A;  2KT9 A;  2WZI A;  4QHO A;  4QXB B;  1U4Q A;  3KDS E;  4IDQ A;  4IE6 A;  4EGW A;  4X64 T;  2W63 A;  5J0Z A;  1YXR A;  4PW8 A;  5FY0 A;  4GYS A;  1OWA A;  5JR9 C;  1KF6 A;  2XQY A;  3PUV F;  4IE4 A;  3JC6 D;  2E9X B;  3AA0 B;  3VKH A;  4O4H E;  5FXZ A;  2K5B B;  4CN1 A;  4EXT A;  2D9D A;  4XZC A;  3QOF A;  5L3B B;  2X9W A;  4LF9 T;  5F8P A;  2CPT A;  4Q25 A; 
#chains in the Genus database with same CATH homology
 5ETW A;  2NW9 A;  1MIW A;  1MIY A;  3FBL A;  4ZI7 E;  4QXC B;  4ZS2 A;  3GN5 B;  3ZMU B;  4DBQ A;  4P0B A;  2N9D A;  3IEE A;  5CA1 E;  3KBT A;  5HXR A;  3ZCJ A;  1BR0 A;  3KFW X;  1UX5 A;  3UUL A;  4GK5 E;  4PK4 A;  1Z0P A;  3C98 B;  3LBX A;  4C91 A;  3PDY A;  5J2U E;  1D1A A;  3Q5W A;  2L8K A;  2XAS B;  4PK5 A;  2D0T A;  3R84 B;  5FNV E;  2YU2 A;  1HTJ F;  1NWM X;  2LOS A;  1MMG A;  1WR6 A;  4AKG A;  4OFZ A;  1HX8 A;  1G73 A;  2HH7 A;  5DQW A;  2KLQ A;  4C90 A;  4EOZ B;  3W15 B;  1VRB A;  2Q9Q D;  2VWA A;  4H63 H;  3KVA A;  3NBX X;  4U72 A;  3HKE E;  4YJ2 E;  5HWY A;  3S4U A;  4IIJ E;  5FYM A;  4WBO A;  5M4Y A;  1Y64 B;  1IJ6 A;  4TV9 E;  1H7C A;  2VK9 A;  3CQG B;  4NUV A;  2SPC A;  4H9Q C;  4H63 V;  2XUE A;  1UCU A;  5FY1 A;  5LP6 E;  2XHE B;  4CI1 B;  4U74 A;  4EB6 E;  5JVD E;  4IE7 A;  4H9P C;  3BK9 A;  4ISS A;  1QUU A;  4OYK A;  3DP7 A;  2KMF A;  3FXD B;  2X9Y A;  4HKA A;  3ZC0 A;  2V26 A;  3IHR A;  5HAX A;  5LG4 A;  3PUR A;  4L0R A;  4E7S A;  2E9X D;  3C64 A;  2NP9 A;  5L3C B;  1D0Z A;  2OA5 A;  5JRE A;  2DHR A;  1MND A;  2V7J A;  1B7T A;  4H9N C;  3N9M A;  4CI3 B;  5HXC A;  2YK0 A;  2IC9 A;  2L9Q A;  2QGS A;  4JUY A;  5DJQ C;  4TN7 B;  3VU7 H;  1FIO A;  4AKH A;  2D0U A;  2LSG A;  3C4W A;  3UFE A;  4HTE A;  3RRW A;  3E08 A;  3H37 A;  3T8O A;  4UF0 B;  3GA8 A;  4JEU B;  3O1I A;  4UVB B;  2EHO C;  3RYC E;  2ZLY A;  2XAG B;  3N5L A;  1SA0 E;  3WAJ A;  5JRC B;  5EK2 A;  2VB6 A;  1HG5 A;  2JMK A;  5LHH B;  3A5X A;  3HKD E;  2DCF A;  4MLK A;  4X1I E;  1KNZ A;  1YKE B;  3K8P C;  2N2N A;  3KIN B;  1BR2 A;  3KBU A;  3RYF E;  4UV8 B;  2XTL A;  4DBR A;  3F57 A;  1WLX A;  2V7I A;  2KIN B;  4AXP A;  4TUY E;  5JDH A;  5JDG A;  2ACX A;  2ODU A;  3PUS A;  4G63 A;  3WAK A;  3RH3 A;  5JRC A;  2CEA A;  3ANW B;  4EZH A;  3SRZ A;  3HKC E;  2HPL A;  5TAO A;  3OBV E;  3QC9 A;  5LJN A;  5J2T E;  3ZC1 A;  4PJN A;  4HEA A;  4O4L E;  3ZLI A;  5KX5 E;  3TKL B;  4GYR A;  3K3N A;  5FXV A;  3PUG A;  3I0O A;  1LVF A;  4XAX B;  2UXN B;  3U3I A;  3SS1 A;  1IJ5 A;  3M65 A;  2VKJ A;  1YD8 G;  2X9H A;  4IGU A;  2VAS A;  3ONX A;  2YEV C;  2H7V C;  2X9X A;  2L3L A;  3SOL A;  3ZYK A;  5LHG B;  1LKX A;  5FMN A;  4ILU A;  4OHF A;  2CA5 A;  2MOZ A;  3KV5 A;  4PJL A;  4UXN B;  3J7Y q;  3MAC A;  2CCQ A;  3AA7 B;  1BR4 A;  3AB3 B;  3GMI A;  4EYY R;  5EZY E;  2CXF A;  2BZB A;  3MXZ A;  1HG2 A;  2G0U A;  2V7L A;  3D0T A;  3OKQ A;  5JQG E;  3LK4 2;  2X66 A;  2LSK A;  2ZM2 A;  4WNK A;  1HF8 A;  5LGU B;  1HFA A;  2NWB A;  4B6X A;  3P8C D;  4ANJ A;  3MA9 A;  2MYS A;  3QK6 A;  3L3P A;  4O2A E;  1IZN B;  2LOP A;  4CXY A;  2Q9Q C;  1D0X A;  3EDV A;  3VHL A;  4L9I A;  3ZEF B;  3HI2 A;  3UT5 E;  3V5U A;  3RYH E;  3PU8 A;  2A2F X;  4ZOL E;  4UF0 A;  2MTQ A;  5DQV A;  5JDN A;  3FB2 A;  3ZMT B;  3LBX B;  3PTR B;  5EK3 A;  2DNX A;  4CXX A;  2EHO D;  3E0Z A;  5LCY A;  2VKO A;  4L5G A;  3LK3 B;  3ZN1 B;  3RC8 A;  1FMW A;  3B57 A;  4E7Z A;  1EZ3 A;  4TV8 E;  2KWH A;  2YU1 A;  4O8S A;  4TZ4 C;  5LA6 E;  5HXH A;  4QX8 B;  2IC6 A;  2WWU A;  3MKD A;  4I50 E;  3RX6 A;  4BJN A;  5HYA A;  2V7M A;  2LEH A;  3ZJ1 A;  3ESL A;  2JMH A;  5L3G B;  2EHO A;  4TX5 A;  2C0S A;  4ZS3 A;  2Z6E A;  4CI2 B;  3K3O A;  3LFM A;  4EIW A;  2E8I A;  4KMC A;  2N1G A;  5IYZ E;  2LT3 A;  4YLH A;  1MMD A;  2RA1 A;  5HXS A;  2CE7 A;  4OK0 A;  3ANW A;  2C5K T;  3EVY A;  3ETU A;  2LSI A;  4GOU A;  1ZEE A;  4HN9 A;  4UEL A;  2DI4 A;  5E0O A;  3R6N A;  4EZ4 A;  3VKG A;  2D2S A;  4PK6 A;  3AVS A;  4N78 D;  3AA6 B;  3RYI E;  1ZHC A;  2MBG A;  1MNE A;  4FJO A;  4K0U A;  2H7O A;  2C5I T;  3K3Q C;  1D1B A;  3B13 A;  2WMN A;  5JDF A;  5C8Y E;  4H9S E;  3CQX C;  3ZYL A;  2LHN A;  2ES0 A;  5KMG P;  2WAU A;  5EK4 A;  3E22 E;  2BVM A;  2K48 A;  4FI5 A;  5LBM A;  4IDZ A;  3QUJ A;  4IST A;  3UUN A;  3MJX A;  3HR0 A;  3N2G E;  4AKL A;  5L3F B;  2P9B A;  2CLY C;  3CWZ B;  4GK0 E;  4CQI A;  3ZN0 B;  5IHY A;  4WBN E;  2KND A;  3N9N A;  4PAG A;  4BJM A;  1T98 A;  4ADZ A;  3N9Q A;  4DMV A;  4P0A A;  5H6R B;  4GIW A;  3MZK B;  5FP3 A;  5LYJ E;  3GWH A;  4QX7 B;  2X51 A;  2ZMA A;  3O9X A;  5L2L A;  4O4I E;  3O1J A;  5LJM A;  2CMR A;  2NW8 A;  2Q9Q A;  4HE8 A;  3ZPO A;  2KZ7 B;  3CML A;  3FBZ A;  5LOV E;  3Q2M A;  2PBI A;  2CLY B;  4F6R C;  5LNK A;  1BR1 A;  2Y48 B;  1WRD A;  2XAJ B;  3CX6 B;  3I9W A;  5FXW A;  3BQL A;  4ZI3 C;  5L3D B;  1WYB A;  3HL6 A;  4IE5 A;  5L3E B;  3I9Y A;  2K24 A;  2V7K A;  3SWH A;  3NRY A;  3HA4 A;  2W00 A;  2XAQ B;  5LHI B;  2X67 A;  1FEW A;  2JQQ A;  3I0Q A;  4ASK A;  4M1P A;  2CXD A;  3L09 A;  3OYX A;  1OXZ A;  4MBQ A;  3AAI A;  3AAA B;  3DJB A;  3RKO A;  2WSS V;  3F2E A;  2NTX A;  4I55 E;  4X1K E;  3ZMV B;  4X20 E;  3ZMZ B;  4MFR A;  4PJJ A;  1SHZ C;  3C50 A;  3Q5X A;  4MAL A;  5JH7 E;  3FHN A;  1LVK A;  2XAF B;  5GON E;  3LK2 B;  4YJ3 E;  2CXL A;  3NZP A;  4P09 A;  2D5U A;  2GK9 A;  4A56 A;  4JLE A;  2LHR A;  3PU3 A;  5JDL A;  3PUQ A;  3CX7 B;  4QKN A;  4H9R C;  2CWY A;  4JEH B;  1AJ3 A;  4DO0 A;  5AFU L;  1CUN A;  4IHJ E;  2JPF A;  1HCI A;  1S94 A;  2NOX A;  1D0Y A;  1IAP A;  2RP4 A;  2H3R A;  2WMO A;  1WYC A;  4HFV A;  4PJM A;  1VOM A;  1U5P A;  2M67 A;  3H3A A;  1LRZ A;  4UIG A;  4UVA B;  4PFP A;  3DTO A;  1D1C A;  4QWN B;  4YFS A;  4AQG A;  4HGA A;  2BDE A;  3OJA A;  4OYJ A;  4I4T E;  2ZM8 A;  1S35 A;  2NTY A;  3I1A A;  1QSD A;  2B1E A;  2QA7 A;  2KXP B;  2E9X A;  3C51 A;  5LBQ B;  4DND A;  2PJQ A;  5FXX A;  3N9L A;  4KP3 C;  3ZJ2 A;  4EYU A;  1MMN A;  2E9X C;  3CPZ A;  2LSJ A;  3CX8 B;  3NZQ A;  2X0L B;  2A72 A;  3PE0 A;  4IE0 A;  4O2B E;  2PFV A;  2W0G A;  4UVC B;  5FY7 A;  2DWK A;  3ZYM A;  2J1D G;  4ERR A;  2KWI B;  4AKR B;  5CA0 E;  4XBF B;  4KBM B;  4CZZ B;  2IAK A;  2I59 A;  1YKH B;  2DLR A;  3NRX A;  3AA1 B;  2UXX B;  4WW0 A;  2X68 A;  3N9O A;  3IF8 B;  3BQI A;  3N2O A;  5KDM C;  3FXE B;  4NUU A;  2LM9 A;  2Y6X A;  3BQK A;  2XAH B;  3P7I A;  2A3D A;  3KVB A;  4DMW A;  4Z8X A;  3RPU A;  3RC3 A;  5LGT B;  4YHJ A;  3Q9D A;  1X79 A;  4X1Y E;  2W62 A;  2W61 A;  3LG7 A;  4UV9 B;  2LSY A;  2NW7 A;  4PFO A;  1E1H B;  4AQF A;  1G8X A;  3AVR A;  2CWO A;  3U78 A;  1MIV A;  2BVL A;  2CM0 A;  3LJC A;  4CXW A;  2WBL A;  5LGN B;  5HWX A;  1US7 B;  5JDM A;  4ZI3 D;  3HKB E;  5CB4 E;  3ZCI A;  1V9D A;  2LE8 A;  3F31 A;  2Y8D A;  1ZKE A;  4H9O C;  4MHC A;  4AKI A;  2LJL A;  3KV9 A;  2VKH A;  4ZHQ E;  1YW0 A;  2C5J A;  4G2A A;  2IW5 B;  2DWG A;  3J9X 1;  3UUM A;  4UEM A;  3MK7 C;  1MMA A;  1O3X A;  2HPJ A;  3KV6 A;  2WM9 A;  4AQF C;  1UX4 A;  3ETV A;  2VL8 A;  4V1A v;  2Q9Q B;  5A1L A;  2YIN A;  1ZV4 X;  3GN5 A;  2ODV A;  5BMV E;  2V1D B;  1NAF A;  3N2K E;  3C4X A;  3JC6 C;  3O4X E;  3OYZ A;  3RRC A;  3CKD A;  4AI6 A;  2JRK A;  4I43 B;  5H6Q B;  2EHO B;  4PNI A;  3KV4 A;  4KUM B;  4EAH A;  2VKD A;  3UTK A;  4J2C A;  4ZI2 C;  5HXE A;  1HS7 A;  3CVR A;  4O4J E;  4DVD A;  5JR9 B;  5F3J A;  3N9P A;  1KK7 A;  3C4Z A;  3EUH A;  5J1G A;  1FMV A;  5LXT E;  3CQC B;  2ZM0 A;  2K9A A;  5JR9 A;  3UUX B;  3WI3 A;  3EDU A;  3AAE B;  4BA9 A;  5ADX L;  3ZMS B;  5JDQ A;  3PUA A;  3O1H A;  4BAY B;  4QXH B;  4ZI2 D;  3V5S A;  2JJ9 A;  5DAB A;  2PG8 A;  3IBP A;  2KT9 A;  4QHO A;  4QXB B;  1U4Q A;  3KDS E;  4IE6 A;  2W63 A;  4PW8 A;  5FY0 A;  4GYS A;  1OWA A;  5JR9 C;  2XQY A;  4IE4 A;  3JC6 D;  2E9X B;  3AA0 B;  3VKH A;  4O4H E;  5FXZ A;  2K5B B;  4EXT A;  4XZC A;  5L3B B;  2X9W A;  5F8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...