2K9CA

Paramagnetic shifts in solid-state nmr of proteins to elicit structural information
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
152
structure length
152
Chain Sequence
HYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Paramagnetic shifts in solid-state NMR of proteins to elicit structural information
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 13
structure length 152
sequence length 152
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2008-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2k9cA00
2ERPA 3K7NA 3I7IA 3LQBA 2XS4A 1GO7P 4R3VA 1OMJA 2JT6A 4ON1A 2N8RA 2OY2A 1EB6A 3F17A 1L6JA 3LGPA 1IAAA 2RJPA 3LQ0A 3ZXHA 4PKWA 1D5JA 1BKCE 1HY7A 3VI1A 1GO8P 1USNA 4GQLA 1YP1A 2OVXA 2Y6DA 5JMYA 4L19A 830CA 1BSWA 1FM1A 2OXUA 2HU6A 1WNIA 1A86A 3DSLA 2MZHA 1ZVXA 1G4KA 2OW0A 2W0DA 1UMTA 5I0LA 1Y93A 1XFUA 5D7WA 1ROSA 3KMEA 4PKRA 3U1RA 1BQQM 4WF6A 5I12A 1BKCA 4XCTA 1Y8JA 4WKIA 4QKZA 4XM7A 1ZXCA 1SMPA 3KWVC 4AXQA 5I4OA 2MLSA 2OXWA 4DPEA 2MZIA 1FBLA 3V96B 2DDFA 2CKIA 2WO9A 1UEAA 1S4BP 4IJOA 966CA 1A85A 3LK8A 3HDAP 5L79A 1YQYA 1HFSA 4JA1A 1I76A 2OW2A 2SRTA 2E3XA 1DMTA 3KMCA 1CGEA 1AF0A 4PKUA 1BUDA 4GR0A 4H2EA 3HY9A 3O2XA 4ILWD 2TCLA 2FV5A 2OW9A 3P24A 1R1IA 1G05A 2OY4A 5D3CA 1D7XA 3OHLA 3EHXA 2WO8A 1IADA 4PKSA 3DL1A 1JH1A 5CZMA 2RJQA 4H1QA 1GKDA 3Q2HA 3N2UA 4H3XA 3ZUKA 2DW2A 2XS3A 3HY7A 4CTHA 2I47A 1ASTA 1CXVA 1PWVA 4A7BA 3EDHA 1JAOA 2USNA 1CGFA 3I7GA 2X3BA 1ZXVA 4AUOA 1KBCA 1MNCA 3LIKA 3G42A 3B2ZA 3LMCA 2J0TA 2EROA 2POJA 3K7LA 1EAKA 1XFVA 2MZEA 1IAGA 1G12A 1BZSA 3P1VA 2X7MA 4GR3A 1BQOA 4JP4A 3O64A 3KEJA 3OHOA 2X3AA 2OI0A 5I2ZA 1BUVM 5D2BA 5L7FA 4DV8A 4H84A 3L0VA 1G49A 1C7KA 3TT4A 3LIRA 1QJJA 1OM7A 3LJGA 1JIWP 1J7NA 1ZTQA 1MMPA 3LKAA 4I03A 5CXAA 5BOTA 4L6TA 1CK7A 5BPAA 4L63A 5B5OA 5CUHA 1D8FA 2D1OA 1JIZA 1XURA 1UTTA 1MMBA 3F19A 3AYKA 2O3EA 2JT5A 3LJZA 4GWMA 4XM6A 1K7QA 3F16A 1Z3JA 3KRYA 1KUIA 3AIGA 1O0TA 2X3CA 1XFXA 3LEAA 3BA0A 3N2VA 1GE7A 4FXYP 3WV1A 4H30A 1PWQA 1I1IP 1GKCA 2W13A 3NX7A 4PKQA 2W15A 4AYKA 2YIGA 3RTSA 2W12A 4EFSA 2QPJA 1FLSA 4WZVA 2DW0A 3WV3A 3L0TA 3HYGA 3B92A 1IABA 1KUGA 3F1AA 1Y0VA 1B3DA 1GXDA 3MA2A 1CQRA 1RM8A 1JANA 1QJIA 1C8TA 1GE6A 2PJTA 2Y6CA 1JKYA 1EUBA 4JPAA 4G9LA 4DF9A 1C3IA 1GE5A 2FV9A 3KECA 1O0QA 2Z2DA 3DPEA 1HTDA 1BKCI 3TSKA 2MLRA 4HMAA 3LJTA 1PWUA 1ND1A 5BOYA 1IACA 1QUAA 2O36A 1K7GA 1RMZA 3ELMA 3RTTA 4JIJA 1KUKA 4AIGA 1PWWA 4WKEA 2E2DA 3CKIA 3HBUP 4DD8A 1R1JA 3GBOA 1AKLA 2DDYA 4J4MA 3KHIA 1I73A 1ATLA 2OVZA 4XBHA 1OS9A 4H49A 4GF1A 1K7IA 4Q1LA 3DWBA 1QIBA 4IUWA 1ZS0A 456CA 3EDGA 2ERQA 1R1HA 3ZVSA 3DNGA 5D1UA 1IAEA 3LUMA 2YB9A 2L0RA 1KUFA 1OM6A 1HV5A 1KUHA 2OZRA 4FXQA 1R54A 2JNPA 3EDZA 1KAPP 4GUYA 2D1NA 4JQGA 1CIZA 1DTHA 1XFYA 1OS2A 1CAQA 1QIAA 5D1TA 1XUDA 5LABA 4ZR5A 3VTGA 1SLNA 1HFCA 3LE9A 1QICA 3HBVP 2OXZA 2WOAA 1XUCA 1YCMA 2A8HA 4HX3A 4H76A 3HB2P 3B8ZA 1BM6A 3EWJA 3AYUA 3F18A 3EDIA 1SU3A 1JAQA 1D8MA 2K9CA 3LILA 4FU4A 3Q2GA 4WK7A 1G9KA 5D1SA 2W14A 3G5CA 1R55A 3F15A 3UVCA 5I43A 2AIGP 1H71P 3WV2A 2OW1A 1CGLA 4PKVA 4FVLA 2KRJA 1MMQA 1UTZA 1Q3AA 4GWNA 2JSDA 2CLTA 1ZP5A 1JAPA 2J83A 4G0DA 1MMRA 1HOVA 4A3WA 4XM8A 5H8XA 3E8RA 4GR8A 1SLMA 1XFWA 1JJ9A 3TS4A 3EHYA 1B8YA 3SHIA 3TVCA 1OO9A 4PKTA 1OM8A 3KEKA 1SATA 1SRPA 3DPFA 4I35A 1AYKA 2DW1A 3HDBA 1YOUA 2AYKA 5B5PA 5I3MA 1JK3A 2K2GA 2JIHA 4H82A 1BIWA 1UMSA 3LUNA 1PWPA 4IN9A 2V4BA 3USNA 1XFZA
chains in the Genus database with same CATH superfamily
2ERPA 3K7NA 3I7IA 3LQBA 2XS4A 1GO7P 4R3VA 2YUFA 1OMJA 2JT6A 4ON1A 2N8RA 2OY2A 1EB6A 3F17A 1L6JA 3LGPA 1IAAA 2RJPA 3LQ0A 3ZXHA 1OZ9A 4PKWA 1D5JA 1BKCE 1HY7A 3VI1A 1GO8P 1USNA 4GQLA 1YP1A 2OVXA 2Y6DA 5JMYA 4L19A 830CA 1BSWA 1FM1A 2OXUA 2HU6A 1WNIA 1A86A 3DSLA 2MZHA 1ZVXA 1G4KA 2OW0A 2W0DA 1UMTA 5I0LA 1Y93A 1XFUA 5D7WA 1ROSA 3KMEA 4PKRA 3U1RA 1BQQM 4WF6A 5I12A 1BKCA 4XCTA 1Y8JA 4WKIA 4QKZA 4XM7A 1ZXCA 1SMPA 3KWVC 4AXQA 5I4OA 2MLSA 2OXWA 4DPEA 2MZIA 1FBLA 3V96B 2DDFA 2CKIA 2WO9A 1UEAA 1S4BP 4IJOA 966CA 1A85A 3LK8A 3HDAP 5L79A 1YQYA 1HFSA 4JA1A 1I76A 2OW2A 2SRTA 2E3XA 1DMTA 3KMCA 1CGEA 1AF0A 4PKUA 1BUDA 4GR0A 4H2EA 3HY9A 3O2XA 4ILWD 2TCLA 2FV5A 2OW9A 3P24A 1R1IA 1G05A 2OY4A 5D3CA 1D7XA 3OHLA 3EHXA 3DTKA 2WO8A 1IADA 4PKSA 3DL1A 1JH1A 5CZMA 2RJQA 4H1QA 1GKDA 3Q2HA 3N2UA 4H3XA 3ZUKA 2DW2A 2XS3A 3HY7A 4CTHA 2I47A 1ASTA 1CXVA 1PWVA 4A7BA 4L7AA 3EDHA 1JAOA 2USNA 1CGFA 3I7GA 2X3BA 1ZXVA 4AUOA 1KBCA 1MNCA 3LIKA 3G42A 3B2ZA 3LMCA 2J0TA 2EROA 2POJA 3K7LA 1EAKA 1XFVA 2MZEA 1IAGA 1G12A 1BZSA 3P1VA 2X7MA 4GR3A 1BQOA 4JP4A 3O64A 3KEJA 3OHOA 2X3AA 2OI0A 5I2ZA 1BUVM 5D2BA 5L7FA 4DV8A 4H84A 3L0VA 1G49A 1C7KA 3TT4A 3LIRA 1QJJA 1OM7A 3LJGA 1JIWP 1J7NA 1ZTQA 1MMPA 3LKAA 4I03A 5CXAA 5BOTA 4L6TA 1CK7A 5BPAA 4L63A 5B5OA 5CUHA 1D8FA 2D1OA 1JIZA 1XURA 1UTTA 1MMBA 3F19A 3AYKA 2O3EA 2JT5A 3LJZA 4GWMA 4XM6A 1K7QA 3F16A 1Z3JA 3KRYA 1KUIA 3AIGA 1O0TA 2X3CA 1XFXA 3LEAA 1TVIA 3BA0A 3N2VA 1GE7A 4FXYP 3WV1A 4H30A 1PWQA 1I1IP 1GKCA 2W13A 3NX7A 4PKQA 2W15A 4AYKA 2YIGA 3RTSA 2W12A 4EFSA 2QPJA 1FLSA 4WZVA 2DW0A 3WV3A 3L0TA 3HYGA 3B92A 1IABA 1KUGA 3F1AA 1Y0VA 1B3DA 1GXDA 3MA2A 1CQRA 1RM8A 1JANA 1QJIA 1C8TA 1GE6A 2PJTA 2Y6CA 1JKYA 1EUBA 4JPAA 4G9LA 4DF9A 1C3IA 1GE5A 2FV9A 3KECA 1O0QA 2Z2DA 3DPEA 1HTDA 1BKCI 3TSKA 2MLRA 4HMAA 3LJTA 1PWUA 1ND1A 5BOYA 1IACA 1QUAA 2O36A 1K7GA 1RMZA 3ELMA 3RTTA 4JIJA 1KUKA 4AIGA 1PWWA 4WKEA 2E2DA 3CKIA 3HBUP 4DD8A 1R1JA 1XM5A 3GBOA 1AKLA 1XAXA 2DDYA 4J4MA 3KHIA 1I73A 1ATLA 2OVZA 4XBHA 1OS9A 4H49A 4GF1A 1K7IA 4Q1LA 3DWBA 1QIBA 4IUWA 1ZS0A 456CA 3EDGA 2ERQA 1R1HA 3ZVSA 3DNGA 5D1UA 1IAEA 3LUMA 2YB9A 2L0RA 1KUFA 1OM6A 1HV5A 1KUHA 2OZRA 4FXQA 1R54A 2JNPA 3EDZA 1KAPP 4GUYA 2D1NA 3DTIA 1CIZA 4JQGA 1DTHA 1XFYA 1OS2A 1CAQA 1QIAA 5D1TA 1XUDA 5LABA 4ZR5A 3VTGA 1SLNA 1HFCA 3LE9A 1QICA 3HBVP 2OXZA 2WOAA 1XUCA 1YCMA 2A8HA 4HX3A 4H76A 3HB2P 3B8ZA 1BM6A 3EWJA 3AYUA 3F18A 3EDIA 1SU3A 1JAQA 1D8MA 2K9CA 3DTEA 3LILA 3Q2GA 4FU4A 4WK7A 1G9KA 5D1SA 2W14A 3G5CA 1R55A 3F15A 3UVCA 5I43A 2AIGP 1H71P 3WV2A 2OW1A 1CGLA 4PKVA 4FVLA 2KRJA 1MMQA 1UTZA 1Q3AA 4GWNA 2JSDA 2CLTA 1ZP5A 1JAPA 2J83A 4G0DA 1MMRA 1HOVA 4A3WA 4XM8A 5H8XA 3E8RA 4GR8A 1SLMA 1XFWA 1JJ9A 3TS4A 3EHYA 1B8YA 3SHIA 3TVCA 1OO9A 4PKTA 1OM8A 3KEKA 1SATA 1SRPA 3DPFA 4I35A 1AYKA 2DW1A 3HDBA 1YOUA 2AYKA 5B5PA 5I3MA 1JK3A 2K2GA 2JIHA 4H82A 1BIWA 1UMSA 3LUNA 1PWPA 4IN9A 2V4BA 3USNA 1XFZA
chains in the Genus database with same CATH topology
2ERPA 3K7NA 3I7IA 3LQBA 2XS4A 1GO7P 4R3VA 2YUFA 1OMJA 2JT6A 4ON1A 2N8RA 2OY2A 1EB6A 3F17A 1L6JA 3LGPA 1IAAA 2RJPA 3LQ0A 3ZXHA 4PKWA 1D5JA 1BKCE 1HY7A 3VI1A 1GO8P 1USNA 4GQLA 1YP1A 2OVXA 2Y6DA 5JMYA 4L19A 830CA 1BSWA 1FM1A 2OXUA 2HU6A 1WNIA 1A86A 3DSLA 2MZHA 1ZVXA 1G4KA 2OW0A 2W0DA 1UMTA 5I0LA 1Y93A 1XFUA 5D7WA 1ROSA 3KMEA 4PKRA 3U1RA 1BQQM 4WF6A 5I12A 1BKCA 4XCTA 1Y8JA 4WKIA 4QKZA 4XM7A 1ZXCA 1SMPA 3KWVC 4AXQA 5I4OA 2MLSA 2OXWA 4DPEA 2MZIA 1FBLA 3V96B 2DDFA 2CKIA 2WO9A 1UEAA 1S4BP 4IJOA 966CA 1A85A 3LK8A 3HDAP 5L79A 1YQYA 1HFSA 4JA1A 1I76A 2OW2A 2SRTA 2E3XA 1DMTA 3KMCA 1CGEA 1AF0A 4PKUA 1BUDA 4GR0A 4H2EA 3HY9A 3O2XA 4ILWD 2TCLA 2FV5A 2OW9A 3P24A 1R1IA 1G05A 2OY4A 5D3CA 1D7XA 3OHLA 3EHXA 3DTKA 2WO8A 1IADA 4PKSA 3DL1A 1JH1A 5CZMA 2RJQA 4H1QA 1GKDA 3Q2HA 3N2UA 4H3XA 3ZUKA 2DW2A 2XS3A 3HY7A 4CTHA 2I47A 1ASTA 1CXVA 1PWVA 4A7BA 4L7AA 3EDHA 1JAOA 2USNA 1CGFA 3I7GA 2X3BA 1ZXVA 4AUOA 1KBCA 1MNCA 3LIKA 3G42A 3B2ZA 3LMCA 2J0TA 2EROA 2POJA 3K7LA 1EAKA 1XFVA 2MZEA 1IAGA 1G12A 1BZSA 3P1VA 2X7MA 4GR3A 1BQOA 4JP4A 3O64A 3KEJA 3OHOA 2X3AA 2OI0A 5I2ZA 1BUVM 5D2BA 5L7FA 4DV8A 4H84A 3L0VA 1G49A 1C7KA 3TT4A 3LIRA 1QJJA 1OM7A 3LJGA 1JIWP 1J7NA 1ZTQA 1MMPA 3LKAA 4I03A 5CXAA 5BOTA 4L6TA 1CK7A 5BPAA 4L63A 5B5OA 5CUHA 1D8FA 2D1OA 1JIZA 1XURA 1UTTA 1MMBA 3F19A 3AYKA 2O3EA 2JT5A 3LJZA 4GWMA 4XM6A 1K7QA 3F16A 1Z3JA 3KRYA 1KUIA 3AIGA 1O0TA 2X3CA 1XFXA 3LEAA 3BA0A 3N2VA 1GE7A 4FXYP 3WV1A 4H30A 1PWQA 1I1IP 1GKCA 2W13A 3NX7A 4PKQA 2W15A 4AYKA 2YIGA 3RTSA 2W12A 4EFSA 2QPJA 1FLSA 4WZVA 2DW0A 3WV3A 3L0TA 3HYGA 3B92A 1IABA 1KUGA 3F1AA 1Y0VA 1B3DA 1GXDA 3MA2A 1CQRA 1RM8A 1JANA 1QJIA 1C8TA 1GE6A 2PJTA 2Y6CA 1JKYA 1EUBA 4JPAA 4G9LA 4DF9A 1C3IA 1GE5A 2FV9A 3KECA 1O0QA 2Z2DA 3DPEA 1HTDA 1BKCI 3TSKA 2MLRA 4HMAA 3LJTA 1PWUA 1ND1A 5BOYA 1IACA 1QUAA 2O36A 1K7GA 1RMZA 3ELMA 3RTTA 4JIJA 1KUKA 4AIGA 1PWWA 4WKEA 2E2DA 3CKIA 3HBUP 4DD8A 1R1JA 3GBOA 1AKLA 2DDYA 4J4MA 3KHIA 1I73A 1ATLA 2OVZA 4XBHA 1OS9A 4H49A 4GF1A 1K7IA 4Q1LA 3DWBA 1QIBA 4IUWA 1ZS0A 456CA 3EDGA 2ERQA 1R1HA 3ZVSA 3DNGA 5D1UA 1IAEA 3LUMA 2YB9A 2L0RA 1KUFA 1OM6A 1HV5A 1KUHA 2OZRA 4FXQA 1R54A 2JNPA 3EDZA 1KAPP 4GUYA 2D1NA 3DTIA 1CIZA 4JQGA 1DTHA 1XFYA 1OS2A 1CAQA 1QIAA 5D1TA 1XUDA 5LABA 4ZR5A 3VTGA 1SLNA 1HFCA 3LE9A 1QICA 3HBVP 2OXZA 2WOAA 1XUCA 1YCMA 2A8HA 4HX3A 4H76A 3HB2P 3B8ZA 1BM6A 3EWJA 3AYUA 3F18A 3EDIA 1SU3A 1JAQA 1D8MA 2K9CA 3DTEA 3LILA 3Q2GA 4FU4A 4WK7A 1G9KA 5D1SA 2W14A 3G5CA 1R55A 3F15A 3UVCA 5I43A 2AIGP 1H71P 3WV2A 2OW1A 1CGLA 4PKVA 4FVLA 2KRJA 1MMQA 1UTZA 1Q3AA 4GWNA 2JSDA 2CLTA 1ZP5A 1JAPA 2J83A 4G0DA 1MMRA 1HOVA 4A3WA 4XM8A 5H8XA 3E8RA 4GR8A 1SLMA 1XFWA 1JJ9A 3TS4A 3EHYA 1B8YA 3SHIA 3TVCA 1OO9A 4PKTA 1OM8A 3KEKA 1SATA 1SRPA 3DPFA 4I35A 1AYKA 2DW1A 3HDBA 1YOUA 2AYKA 5B5PA 5I3MA 1JK3A 2K2GA 2JIHA 4H82A 1BIWA 1UMSA 3LUNA 1PWPA 4IN9A 2V4BA 3USNA 1XFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERP A;  3K7N A;  3I7I A;  3LQB A;  2XS4 A;  1GO7 P;  4R3V A;  1OMJ A;  2JT6 A;  4ON1 A;  2N8R A;  2OY2 A;  1EB6 A;  3F17 A;  1L6J A;  3LGP A;  1IAA A;  2RJP A;  3LQ0 A;  3ZXH A;  4PKW A;  1D5J A;  1BKC E;  1HY7 A;  3VI1 A;  1GO8 P;  1USN A;  4GQL A;  1YP1 A;  2OVX A;  2Y6D A;  5JMY A;  4L19 A;  830C A;  1BSW A;  1FM1 A;  2OXU A;  2HU6 A;  1WNI A;  1A86 A;  3DSL A;  2MZH A;  1ZVX A;  1G4K A;  2OW0 A;  2W0D A;  1UMT A;  5I0L A;  1Y93 A;  1XFU A;  5D7W A;  1ROS A;  3KME A;  4PKR A;  3U1R A;  1BQQ M;  4WF6 A;  5I12 A;  1BKC A;  4XCT A;  1Y8J A;  4WKI A;  4QKZ A;  4XM7 A;  1ZXC A;  1SMP A;  3KWV C;  4AXQ A;  5I4O A;  2MLS A;  2OXW A;  4DPE A;  2MZI A;  1FBL A;  3V96 B;  2DDF A;  2CKI A;  2WO9 A;  1UEA A;  1S4B P;  4IJO A;  966C A;  1A85 A;  3LK8 A;  3HDA P;  5L79 A;  1YQY A;  1HFS A;  4JA1 A;  1I76 A;  2OW2 A;  2SRT A;  2E3X A;  1DMT A;  3KMC A;  1CGE A;  1AF0 A;  4PKU A;  1BUD A;  4GR0 A;  4H2E A;  3HY9 A;  3O2X A;  4ILW D;  2TCL A;  2FV5 A;  2OW9 A;  3P24 A;  1R1I A;  1G05 A;  2OY4 A;  5D3C A;  1D7X A;  3OHL A;  3EHX A;  2WO8 A;  1IAD A;  4PKS A;  3DL1 A;  1JH1 A;  5CZM A;  2RJQ A;  4H1Q A;  1GKD A;  3Q2H A;  3N2U A;  4H3X A;  3ZUK A;  2DW2 A;  2XS3 A;  3HY7 A;  4CTH A;  2I47 A;  1AST A;  1CXV A;  1PWV A;  4A7B A;  3EDH A;  1JAO A;  2USN A;  1CGF A;  3I7G A;  2X3B A;  1ZXV A;  4AUO A;  1KBC A;  1MNC A;  3LIK A;  3G42 A;  3B2Z A;  3LMC A;  2J0T A;  2ERO A;  2POJ A;  3K7L A;  1EAK A;  1XFV A;  2MZE A;  1IAG A;  1G12 A;  1BZS A;  3P1V A;  2X7M A;  4GR3 A;  1BQO A;  4JP4 A;  3O64 A;  3KEJ A;  3OHO A;  2X3A A;  2OI0 A;  5I2Z A;  1BUV M;  5D2B A;  5L7F A;  4DV8 A;  4H84 A;  3L0V A;  1G49 A;  1C7K A;  3TT4 A;  3LIR A;  1QJJ A;  1OM7 A;  3LJG A;  1JIW P;  1J7N A;  1ZTQ A;  1MMP A;  3LKA A;  4I03 A;  5CXA A;  5BOT A;  4L6T A;  1CK7 A;  5BPA A;  4L63 A;  5B5O A;  5CUH A;  1D8F A;  2D1O A;  1JIZ A;  1XUR A;  1UTT A;  1MMB A;  3F19 A;  3AYK A;  2O3E A;  2JT5 A;  3LJZ A;  4GWM A;  4XM6 A;  1K7Q A;  3F16 A;  1Z3J A;  3KRY A;  1KUI A;  3AIG A;  1O0T A;  2X3C A;  1XFX A;  3LEA A;  3BA0 A;  3N2V A;  1GE7 A;  4FXY P;  3WV1 A;  4H30 A;  1PWQ A;  1I1I P;  1GKC A;  2W13 A;  3NX7 A;  4PKQ A;  2W15 A;  4AYK A;  2YIG A;  3RTS A;  2W12 A;  4EFS A;  2QPJ A;  1FLS A;  4WZV A;  2DW0 A;  3WV3 A;  3L0T A;  3HYG A;  3B92 A;  1IAB A;  1KUG A;  3F1A A;  1Y0V A;  1B3D A;  1GXD A;  3MA2 A;  1CQR A;  1RM8 A;  1JAN A;  1QJI A;  1C8T A;  1GE6 A;  2PJT A;  2Y6C A;  1JKY A;  1EUB A;  4JPA A;  4G9L A;  4DF9 A;  1C3I A;  1GE5 A;  2FV9 A;  3KEC A;  1O0Q A;  2Z2D A;  3DPE A;  1HTD A;  1BKC I;  3TSK A;  2MLR A;  4HMA A;  3LJT A;  1PWU A;  1ND1 A;  5BOY A;  1IAC A;  1QUA A;  2O36 A;  1K7G A;  1RMZ A;  3ELM A;  3RTT A;  4JIJ A;  1KUK A;  4AIG A;  1PWW A;  4WKE A;  2E2D A;  3CKI A;  3HBU P;  4DD8 A;  1R1J A;  3GBO A;  1AKL A;  2DDY A;  4J4M A;  3KHI A;  1I73 A;  1ATL A;  2OVZ A;  4XBH A;  1OS9 A;  4H49 A;  4GF1 A;  1K7I A;  4Q1L A;  3DWB A;  1QIB A;  4IUW A;  1ZS0 A;  456C A;  3EDG A;  2ERQ A;  1R1H A;  3ZVS A;  3DNG A;  5D1U A;  1IAE A;  3LUM A;  2YB9 A;  2L0R A;  1KUF A;  1OM6 A;  1HV5 A;  1KUH A;  2OZR A;  4FXQ A;  1R54 A;  2JNP A;  3EDZ A;  1KAP P;  4GUY A;  2D1N A;  4JQG A;  1CIZ A;  1DTH A;  1XFY A;  1OS2 A;  1CAQ A;  1QIA A;  5D1T A;  1XUD A;  5LAB A;  4ZR5 A;  3VTG A;  1SLN A;  1HFC A;  3LE9 A;  1QIC A;  3HBV P;  2OXZ A;  2WOA A;  1XUC A;  1YCM A;  2A8H A;  4HX3 A;  4H76 A;  3HB2 P;  3B8Z A;  1BM6 A;  3EWJ A;  3AYU A;  3F18 A;  3EDI A;  1SU3 A;  1JAQ A;  1D8M A;  2K9C A;  3LIL A;  4FU4 A;  3Q2G A;  4WK7 A;  1G9K A;  5D1S A;  2W14 A;  3G5C A;  1R55 A;  3F15 A;  3UVC A;  5I43 A;  2AIG P;  1H71 P;  3WV2 A;  2OW1 A;  1CGL A;  4PKV A;  4FVL A;  2KRJ A;  1MMQ A;  1UTZ A;  1Q3A A;  4GWN A;  2JSD A;  2CLT A;  1ZP5 A;  1JAP A;  2J83 A;  4G0D A;  1MMR A;  1HOV A;  4A3W A;  4XM8 A;  5H8X A;  3E8R A;  4GR8 A;  1SLM A;  1XFW A;  1JJ9 A;  3TS4 A;  3EHY A;  1B8Y A;  3SHI A;  3TVC A;  1OO9 A;  4PKT A;  1OM8 A;  3KEK A;  1SAT A;  1SRP A;  3DPF A;  4I35 A;  1AYK A;  2DW1 A;  3HDB A;  1YOU A;  2AYK A;  5B5P A;  5I3M A;  1JK3 A;  2K2G A;  2JIH A;  4H82 A;  1BIW A;  1UMS A;  3LUN A;  1PWP A;  4IN9 A;  2V4B A;  3USN A;  1XFZ A; 
#chains in the Genus database with same CATH topology
 2ERP A;  3K7N A;  3I7I A;  3LQB A;  2XS4 A;  1GO7 P;  4R3V A;  2YUF A;  1OMJ A;  2JT6 A;  4ON1 A;  2N8R A;  2OY2 A;  1EB6 A;  3F17 A;  1L6J A;  3LGP A;  1IAA A;  2RJP A;  3LQ0 A;  3ZXH A;  1OZ9 A;  4PKW A;  1D5J A;  1BKC E;  1HY7 A;  3VI1 A;  1GO8 P;  1USN A;  4GQL A;  1YP1 A;  2OVX A;  2Y6D A;  5JMY A;  4L19 A;  830C A;  1BSW A;  1FM1 A;  2OXU A;  2HU6 A;  1WNI A;  1A86 A;  3DSL A;  2MZH A;  1ZVX A;  1G4K A;  2OW0 A;  2W0D A;  1UMT A;  5I0L A;  1Y93 A;  1XFU A;  5D7W A;  1ROS A;  3KME A;  4PKR A;  3U1R A;  1BQQ M;  4WF6 A;  5I12 A;  1BKC A;  4XCT A;  1Y8J A;  4WKI A;  4QKZ A;  4XM7 A;  1ZXC A;  1SMP A;  3KWV C;  4AXQ A;  5I4O A;  2MLS A;  2OXW A;  4DPE A;  2MZI A;  1FBL A;  3V96 B;  2DDF A;  2CKI A;  2WO9 A;  1UEA A;  1S4B P;  4IJO A;  966C A;  1A85 A;  3LK8 A;  3HDA P;  5L79 A;  1YQY A;  1HFS A;  4JA1 A;  1I76 A;  2OW2 A;  2SRT A;  2E3X A;  1DMT A;  3KMC A;  1CGE A;  1AF0 A;  4PKU A;  1BUD A;  4GR0 A;  4H2E A;  3HY9 A;  3O2X A;  4ILW D;  2TCL A;  2FV5 A;  2OW9 A;  3P24 A;  1R1I A;  1G05 A;  2OY4 A;  5D3C A;  1D7X A;  3OHL A;  3EHX A;  3DTK A;  2WO8 A;  1IAD A;  4PKS A;  3DL1 A;  1JH1 A;  5CZM A;  2RJQ A;  4H1Q A;  1GKD A;  3Q2H A;  3N2U A;  4H3X A;  3ZUK A;  2DW2 A;  2XS3 A;  3HY7 A;  4CTH A;  2I47 A;  1AST A;  1CXV A;  1PWV A;  4A7B A;  4L7A A;  3EDH A;  1JAO A;  2USN A;  1CGF A;  3I7G A;  2X3B A;  1ZXV A;  4AUO A;  1KBC A;  1MNC A;  3LIK A;  3G42 A;  3B2Z A;  3LMC A;  2J0T A;  2ERO A;  2POJ A;  3K7L A;  1EAK A;  1XFV A;  2MZE A;  1IAG A;  1G12 A;  1BZS A;  3P1V A;  2X7M A;  4GR3 A;  1BQO A;  4JP4 A;  3O64 A;  3KEJ A;  3OHO A;  2X3A A;  2OI0 A;  5I2Z A;  1BUV M;  5D2B A;  5L7F A;  4DV8 A;  4H84 A;  3L0V A;  1G49 A;  1C7K A;  3TT4 A;  3LIR A;  1QJJ A;  1OM7 A;  3LJG A;  1JIW P;  1J7N A;  1ZTQ A;  1MMP A;  3LKA A;  4I03 A;  5CXA A;  5BOT A;  4L6T A;  1CK7 A;  5BPA A;  4L63 A;  5B5O A;  5CUH A;  1D8F A;  2D1O A;  1JIZ A;  1XUR A;  1UTT A;  1MMB A;  3F19 A;  3AYK A;  2O3E A;  2JT5 A;  3LJZ A;  4GWM A;  4XM6 A;  1K7Q A;  3F16 A;  1Z3J A;  3KRY A;  1KUI A;  3AIG A;  1O0T A;  2X3C A;  1XFX A;  3LEA A;  1TVI A;  3BA0 A;  3N2V A;  1GE7 A;  4FXY P;  3WV1 A;  4H30 A;  1PWQ A;  1I1I P;  1GKC A;  2W13 A;  3NX7 A;  4PKQ A;  2W15 A;  4AYK A;  2YIG A;  3RTS A;  2W12 A;  4EFS A;  2QPJ A;  1FLS A;  4WZV A;  2DW0 A;  3WV3 A;  3L0T A;  3HYG A;  3B92 A;  1IAB A;  1KUG A;  3F1A A;  1Y0V A;  1B3D A;  1GXD A;  3MA2 A;  1CQR A;  1RM8 A;  1JAN A;  1QJI A;  1C8T A;  1GE6 A;  2PJT A;  2Y6C A;  1JKY A;  1EUB A;  4JPA A;  4G9L A;  4DF9 A;  1C3I A;  1GE5 A;  2FV9 A;  3KEC A;  1O0Q A;  2Z2D A;  3DPE A;  1HTD A;  1BKC I;  3TSK A;  2MLR A;  4HMA A;  3LJT A;  1PWU A;  1ND1 A;  5BOY A;  1IAC A;  1QUA A;  2O36 A;  1K7G A;  1RMZ A;  3ELM A;  3RTT A;  4JIJ A;  1KUK A;  4AIG A;  1PWW A;  4WKE A;  2E2D A;  3CKI A;  3HBU P;  4DD8 A;  1R1J A;  1XM5 A;  3GBO A;  1AKL A;  1XAX A;  2DDY A;  4J4M A;  3KHI A;  1I73 A;  1ATL A;  2OVZ A;  4XBH A;  1OS9 A;  4H49 A;  4GF1 A;  1K7I A;  4Q1L A;  3DWB A;  1QIB A;  4IUW A;  1ZS0 A;  456C A;  3EDG A;  2ERQ A;  1R1H A;  3ZVS A;  3DNG A;  5D1U A;  1IAE A;  3LUM A;  2YB9 A;  2L0R A;  1KUF A;  1OM6 A;  1HV5 A;  1KUH A;  2OZR A;  4FXQ A;  1R54 A;  2JNP A;  3EDZ A;  1KAP P;  4GUY A;  2D1N A;  3DTI A;  1CIZ A;  4JQG A;  1DTH A;  1XFY A;  1OS2 A;  1CAQ A;  1QIA A;  5D1T A;  1XUD A;  5LAB A;  4ZR5 A;  3VTG A;  1SLN A;  1HFC A;  3LE9 A;  1QIC A;  3HBV P;  2OXZ A;  2WOA A;  1XUC A;  1YCM A;  2A8H A;  4HX3 A;  4H76 A;  3HB2 P;  3B8Z A;  1BM6 A;  3EWJ A;  3AYU A;  3F18 A;  3EDI A;  1SU3 A;  1JAQ A;  1D8M A;  2K9C A;  3DTE A;  3LIL A;  3Q2G A;  4FU4 A;  4WK7 A;  1G9K A;  5D1S A;  2W14 A;  3G5C A;  1R55 A;  3F15 A;  3UVC A;  5I43 A;  2AIG P;  1H71 P;  3WV2 A;  2OW1 A;  1CGL A;  4PKV A;  4FVL A;  2KRJ A;  1MMQ A;  1UTZ A;  1Q3A A;  4GWN A;  2JSD A;  2CLT A;  1ZP5 A;  1JAP A;  2J83 A;  4G0D A;  1MMR A;  1HOV A;  4A3W A;  4XM8 A;  5H8X A;  3E8R A;  4GR8 A;  1SLM A;  1XFW A;  1JJ9 A;  3TS4 A;  3EHY A;  1B8Y A;  3SHI A;  3TVC A;  1OO9 A;  4PKT A;  1OM8 A;  3KEK A;  1SAT A;  1SRP A;  3DPF A;  4I35 A;  1AYK A;  2DW1 A;  3HDB A;  1YOU A;  2AYK A;  5B5P A;  5I3M A;  1JK3 A;  2K2G A;  2JIH A;  4H82 A;  1BIW A;  1UMS A;  3LUN A;  1PWP A;  4IN9 A;  2V4B A;  3USN A;  1XFZ A; 
#chains in the Genus database with same CATH homology
 2ERP A;  3K7N A;  3I7I A;  3LQB A;  2XS4 A;  1GO7 P;  4R3V A;  2YUF A;  1OMJ A;  2JT6 A;  4ON1 A;  2N8R A;  2OY2 A;  1EB6 A;  3F17 A;  1L6J A;  3LGP A;  1IAA A;  2RJP A;  3LQ0 A;  3ZXH A;  4PKW A;  1D5J A;  1BKC E;  1HY7 A;  3VI1 A;  1GO8 P;  1USN A;  4GQL A;  1YP1 A;  2OVX A;  2Y6D A;  5JMY A;  4L19 A;  830C A;  1BSW A;  1FM1 A;  2OXU A;  2HU6 A;  1WNI A;  1A86 A;  3DSL A;  2MZH A;  1ZVX A;  1G4K A;  2OW0 A;  2W0D A;  1UMT A;  5I0L A;  1Y93 A;  1XFU A;  5D7W A;  1ROS A;  3KME A;  4PKR A;  3U1R A;  1BQQ M;  4WF6 A;  5I12 A;  1BKC A;  4XCT A;  1Y8J A;  4WKI A;  4QKZ A;  4XM7 A;  1ZXC A;  1SMP A;  3KWV C;  4AXQ A;  5I4O A;  2MLS A;  2OXW A;  4DPE A;  2MZI A;  1FBL A;  3V96 B;  2DDF A;  2CKI A;  2WO9 A;  1UEA A;  1S4B P;  4IJO A;  966C A;  1A85 A;  3LK8 A;  3HDA P;  5L79 A;  1YQY A;  1HFS A;  4JA1 A;  1I76 A;  2OW2 A;  2SRT A;  2E3X A;  1DMT A;  3KMC A;  1CGE A;  1AF0 A;  4PKU A;  1BUD A;  4GR0 A;  4H2E A;  3HY9 A;  3O2X A;  4ILW D;  2TCL A;  2FV5 A;  2OW9 A;  3P24 A;  1R1I A;  1G05 A;  2OY4 A;  5D3C A;  1D7X A;  3OHL A;  3EHX A;  3DTK A;  2WO8 A;  1IAD A;  4PKS A;  3DL1 A;  1JH1 A;  5CZM A;  2RJQ A;  4H1Q A;  1GKD A;  3Q2H A;  3N2U A;  4H3X A;  3ZUK A;  2DW2 A;  2XS3 A;  3HY7 A;  4CTH A;  2I47 A;  1AST A;  1CXV A;  1PWV A;  4A7B A;  4L7A A;  3EDH A;  1JAO A;  2USN A;  1CGF A;  3I7G A;  2X3B A;  1ZXV A;  4AUO A;  1KBC A;  1MNC A;  3LIK A;  3G42 A;  3B2Z A;  3LMC A;  2J0T A;  2ERO A;  2POJ A;  3K7L A;  1EAK A;  1XFV A;  2MZE A;  1IAG A;  1G12 A;  1BZS A;  3P1V A;  2X7M A;  4GR3 A;  1BQO A;  4JP4 A;  3O64 A;  3KEJ A;  3OHO A;  2X3A A;  2OI0 A;  5I2Z A;  1BUV M;  5D2B A;  5L7F A;  4DV8 A;  4H84 A;  3L0V A;  1G49 A;  1C7K A;  3TT4 A;  3LIR A;  1QJJ A;  1OM7 A;  3LJG A;  1JIW P;  1J7N A;  1ZTQ A;  1MMP A;  3LKA A;  4I03 A;  5CXA A;  5BOT A;  4L6T A;  1CK7 A;  5BPA A;  4L63 A;  5B5O A;  5CUH A;  1D8F A;  2D1O A;  1JIZ A;  1XUR A;  1UTT A;  1MMB A;  3F19 A;  3AYK A;  2O3E A;  2JT5 A;  3LJZ A;  4GWM A;  4XM6 A;  1K7Q A;  3F16 A;  1Z3J A;  3KRY A;  1KUI A;  3AIG A;  1O0T A;  2X3C A;  1XFX A;  3LEA A;  3BA0 A;  3N2V A;  1GE7 A;  4FXY P;  3WV1 A;  4H30 A;  1PWQ A;  1I1I P;  1GKC A;  2W13 A;  3NX7 A;  4PKQ A;  2W15 A;  4AYK A;  2YIG A;  3RTS A;  2W12 A;  4EFS A;  2QPJ A;  1FLS A;  4WZV A;  2DW0 A;  3WV3 A;  3L0T A;  3HYG A;  3B92 A;  1IAB A;  1KUG A;  3F1A A;  1Y0V A;  1B3D A;  1GXD A;  3MA2 A;  1CQR A;  1RM8 A;  1JAN A;  1QJI A;  1C8T A;  1GE6 A;  2PJT A;  2Y6C A;  1JKY A;  1EUB A;  4JPA A;  4G9L A;  4DF9 A;  1C3I A;  1GE5 A;  2FV9 A;  3KEC A;  1O0Q A;  2Z2D A;  3DPE A;  1HTD A;  1BKC I;  3TSK A;  2MLR A;  4HMA A;  3LJT A;  1PWU A;  1ND1 A;  5BOY A;  1IAC A;  1QUA A;  2O36 A;  1K7G A;  1RMZ A;  3ELM A;  3RTT A;  4JIJ A;  1KUK A;  4AIG A;  1PWW A;  4WKE A;  2E2D A;  3CKI A;  3HBU P;  4DD8 A;  1R1J A;  3GBO A;  1AKL A;  2DDY A;  4J4M A;  3KHI A;  1I73 A;  1ATL A;  2OVZ A;  4XBH A;  1OS9 A;  4H49 A;  4GF1 A;  1K7I A;  4Q1L A;  3DWB A;  1QIB A;  4IUW A;  1ZS0 A;  456C A;  3EDG A;  2ERQ A;  1R1H A;  3ZVS A;  3DNG A;  5D1U A;  1IAE A;  3LUM A;  2YB9 A;  2L0R A;  1KUF A;  1OM6 A;  1HV5 A;  1KUH A;  2OZR A;  4FXQ A;  1R54 A;  2JNP A;  3EDZ A;  1KAP P;  4GUY A;  2D1N A;  3DTI A;  1CIZ A;  4JQG A;  1DTH A;  1XFY A;  1OS2 A;  1CAQ A;  1QIA A;  5D1T A;  1XUD A;  5LAB A;  4ZR5 A;  3VTG A;  1SLN A;  1HFC A;  3LE9 A;  1QIC A;  3HBV P;  2OXZ A;  2WOA A;  1XUC A;  1YCM A;  2A8H A;  4HX3 A;  4H76 A;  3HB2 P;  3B8Z A;  1BM6 A;  3EWJ A;  3AYU A;  3F18 A;  3EDI A;  1SU3 A;  1JAQ A;  1D8M A;  2K9C A;  3DTE A;  3LIL A;  3Q2G A;  4FU4 A;  4WK7 A;  1G9K A;  5D1S A;  2W14 A;  3G5C A;  1R55 A;  3F15 A;  3UVC A;  5I43 A;  2AIG P;  1H71 P;  3WV2 A;  2OW1 A;  1CGL A;  4PKV A;  4FVL A;  2KRJ A;  1MMQ A;  1UTZ A;  1Q3A A;  4GWN A;  2JSD A;  2CLT A;  1ZP5 A;  1JAP A;  2J83 A;  4G0D A;  1MMR A;  1HOV A;  4A3W A;  4XM8 A;  5H8X A;  3E8R A;  4GR8 A;  1SLM A;  1XFW A;  1JJ9 A;  3TS4 A;  3EHY A;  1B8Y A;  3SHI A;  3TVC A;  1OO9 A;  4PKT A;  1OM8 A;  3KEK A;  1SAT A;  1SRP A;  3DPF A;  4I35 A;  1AYK A;  2DW1 A;  3HDB A;  1YOU A;  2AYK A;  5B5P A;  5I3M A;  1JK3 A;  2K2G A;  2JIH A;  4H82 A;  1BIW A;  1UMS A;  3LUN A;  1PWP A;  4IN9 A;  2V4B A;  3USN A;  1XFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...