2K9DA

Solution structure of the domain x of measle phosphoprotein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
44
structure length
44
Chain Sequence
b'SVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLVKII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphoprotein
publication title Interaction between the C-terminal domains of N and P proteins of measles virus investigated by NMR.
pubmed doi rcsb
source organism Measles virus
molecule tags Viral protein
total genus 16
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2008-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2k9dA00
1A5TA 2MROB 2L2DA 1Y8GA 2DAGA 2KNAA 1G4AE 3FRHA 4UN2B 2JY8A 2CWBA 3H4JA 1VDLA 2QNJA 1KYIA 1CUKA 2KNZA 2DZLA 1UFZA 2JUJA 1TTEA 1GO5A 1WR1B 1VEGA 1G3IA 1DV0A 3FRIA 1DO2A 2DNAA 1WJ7A 1MN3A 1WHCA 2ZTCA 1OTRA 4Q7JA 2R0IA 2DKLA 2DHYA 5DFLA 1XXHE 1DO0A 1F4IA 1YLAA 1IM2A 1EFUB 2LVQD 2H5XA 1P3QQ 2JP7A 1V92A 1OAIA 3MMPA 3FE3A 1WGNA 1NV9A 1ZMVA 3IHPA 4WP2A 2LVOC 1VEKA 2DAMA 2KHHA 1ZMWA 2LVAA 2BWEA 1PGYA 2HAKA 1JR3E 1HT1E 3E46A 2EKKA 2LBCA 4F2LA 1XB2B 1VEJA 1HQYE 3E21A 2DAEA 2QSFX 4R71A 1R4GA 1BVSA 3LCUA 1VQ1A 2HWJA 1T43A 2JY6B 3B89A 1T6OA 1HJPA 2JNHA 2DENA 1HT2E 1AIPC 4HEOA 4F1IA 1WGLA 1IXSA 2DAIA 5JI2E 1C7YA 2WZJA 1SG9A 2K0BX 2L4FA 2K9DA 3GLIE 3GLGE 2ZTDA 2EJSA 4G3OA 1QZEA 2LTUA 2JY7A 2LVPC 2DI0A 4DBGB 1Q02A 2O25A 3T6PA 1ZMUA 2B3TA 2DAKA 2RRUA 1OKSA 2G3QA 3LCVB 2EKFA 1E94E 2LVNC 1G41A 2MGWA 1ZV1A 2MJ5B 3GLHE 2BWBA 2CP8A 2JZ0A 1TR8A 2JY5A 3IECA 2MR9A 2KNVA 2JZ1A 1NV8A 3K9OA 3GLFE 2QHOB 1IFYA 3K9PA 4GEWA 2OOBA 2L4EA 2OOAA 3F92A 3BBZA 1VG5A 2OO9A 1OQYA 1WIVA
chains in the Genus database with same CATH superfamily
3TL4X 3FRHA 2CWBA 4NOOB 1TH2A 4LY6A 1KYIA 1T3TA 1I94M 4RF1A 1XWIA 1LV7A 1TTEA 2QCUA 3GQ4A 1WR1B 1VEGA 3GPPA 3GLFB 1D2NA 2LXEA 3FRIA 3RFWA 4FW9A 1IBMM 4RF0A 2L7IA 3C3DA 2WSFF 1MN3A 1WHCA 3RGSA 3KW6A 2DKLA 1QUTA 3FUWA 1PJSA 5DFLA 1XXHE 2I7NA 1IQPA 3SC3A 2FOIC 1QAMA 1V34A 1N33M 3HHXA 1YLAA 3HKPA 1EFUB 3PNVA 4X65M 1XNQM 2CHVA 3KP0E 4L6V6 3VLFB 5KO3A 3QYBA 4DV4M 4B3SM 4YY3M 1DGBA 3U6CA 1QDRA 1P3QQ 2R65A 5EXXA 4M0DA 1OAIA 4KT0F 1HNZM 3HHZA 1NV9A 1ZMVA 3LMMA 5FTLA 4LFBM 3GQ3A 2OQ4A 1YSYA 1OFIA 3B74A 4IIWA 4IBCA 1YE9A 2DAMA 4M0WA 4LZZA 2G5GX 1KSFX 1W5TA 2M60A 4LJ4A 2LVAA 3HJQA 1QDTA 2K6BA 4BB9A 3AFHA 2QBYA 1IXRC 4LJ9A 2EKKA 2LNHC 5EXSA 4DV2M 4DR5M 1XB2B 1VEJA 1HQYE 2Y0QA 1GKIA 1NJGA 4LFAM 3SFZA 3JR5A 1IN5A 1SXJC 5ITRA 4LF5M 2C96A 4HLQA 1GJTA 1L1TA 3C3EA 3KXEC 3LVWA 2HWJA 1T43A 4JI4M 4DV1M 1ORYB 2F5SA 2VQFM 3U5ZA 1QVRA 2JNHA 1R2ZA 1OIZA 4HEOA 4F1IA 3GO8A 1WGLA 1XMOM 5E6JA 5JI2E 1OJLA 2WZJA 2XF3A 4D81A 4GC5A 3W0FA 4AZFA 3NWLA 3GLGE 2DVWB 3ZC7B 1XMQM 1QAQA 4X64M 4G4QA 4FCWA 2LVPC 2JY7A 2V1CA 2C98A 1Q39A 2C99A 3FYDA 3K8ZA 1Z5BA 1Q02A 3A45A 4OVZB 4ZPXA 5H37D 5A2QS 4FCVA 2ZAOA 2KEBA 2F5PA 4LJ6A 3KP1E 1NNUC 3FUUA 5L8RF 4P17A 4M9SA 3GRYA 3TE6A 3FTCA 1G41A 4KO8A 4KHPM 1ZV1A 4P16A 4R3DA 3U6LA 2BWBA 4BLCA 4MB7A 3GP1A 3GLIB 4LF6M 3THGA 2KNVA 3CTWB 2XZFA 2HL7A 2XSZD 2WSCF 4LG2A 1TH4A 1QZMA 4LJ7A 4G4NA 2DWLA 3GLFE 1IBKM 2QHOB 2XZUA 3K9PA 3RGPA 2F5OA 3EIEA 2NQ8C 1XXHA 4WURA 3B7NA 2OOAA 2UU9M 1DGHA 3FUTA 4KODA 4B3RM 4JI2M 3IG8A 5C18A 3MHVC 3U60B 2EO2A 1DGGA 4B7GA 2R6FA 1A5TA 3ZH9B 1EE8A 2AHMA 3HY5A 3GLHB 3SMSA 2KDLA 5ITUA 1G4AE 3MK6A 2Z4SA 3U6QA 1TDZA 1JQJC 2DWZB 4DR4M 1VDLA 5KQ8A 3SASA 4JI6M 1IN7A 3B9PA 1G59A 4W5WA 2F5QA 4RKUF 3C9PA 2JXNA 1G71A 4JI3M 5KPRA 1Z5AA 1DV0A 2XH9A 2QENA 3U61A 4XK8F 2ZTCA 4Q7JA 2FH0A 3UJNA 3NBXX 3VFDA 3I51A 4DR6M 3WHLA 2W82A 2DHRA 4I5SA 4DV7M 2QQ8A 2LVQD 3W67A 3CF2A 2VIIA 3DFZA 2JP7A 1QANA 1V92A 4LRTA 5DYGA 3AOEA 3FE3A 4DV6M 1XHBA 3KVWA 3IHPA 4NXNM 4LCBA 4WP2A 3VKHA 1R7RA 4LRSA 4PDGA 4GC9A 3GLGA 2C9CA 3LQQA 3T1HM 2V1UA 3R8FA 2R62A 3K1JA 5ITQA 1N78A 3OTOM 4S12A 1JR3A 1PGYA 3FUVA 4CISA 3J80S 4X62M 4MM3B 5FTMA 4A3VB 3LQRA 3HJSA 2DAEA 1J7KA 2Y20A 2CFOA 4GIPA 3LCUA 1SXJB 4B7FA 3DA1A 3B89A 4HL4A 3I01M 4DR1M 3PXGA 3H4MA 1HJPA 1WXQA 3JAMS 3FTFA 2UXDM 4FVMA 1L2DA 3T38A 3K92A 1L2BA 2DAIA 3U6MA 3U5ZB 3A46A 1SG9A 5C1BA 2L4FA 4LGYA 3HU1A 3SYKA 2F4VM 2K9DA 1PRBA 2CHGA 2VDBB 4IJEA 2YR0A 2CUZA 2Q2EB 2ZTDA 1PJTA 1YUBA 1SXJD 2MH8A 3GRRA 1J09A 3J27B 4FWDA 1Q3CA 1S3SA 2EJSA 1QZEA 7CATA 4AQYM 1J5EM 3L2AA 1LTMA 2DI0A 3HX3A 2UUCM 3HU2A 1GLNA 2P5TA 3ZQJA 3KS4A 2DWNA 4Y28F 1ZMUA 2A5YB 2DAKA 2RRUA 5DYIA 3TPZA 2HKJA 5FLXS 4DR3M 4D82A 3GQ5A 4JI7M 1FNNA 2EKFA 1W5SA 2YQZA 2XFSA 2KRUA 2LVNC 4ANRA 2HHHM 3FTEA 2MGWA 4NRWA 3U60A 3GLHE 1FJGM 1K3XA 4JI8M 2CP8A 3J7AS 3SYLA 1VDDA 4IBJA 1TR8A 4FCTA 3KOZE 1KFVA 4AKGA 1NY5A 4II7A 2JZ1A 4DR2M 1NV8A 3CF0A 3UMMA 3GPYA 4FWHA 3C58A 1Z6TA 3UGJA 5IWAM 3A42A 4GKKM 1IFYA 1IBLM 2KRKA 2OOBA 3IG5A 2CRUA 4QOSA 3F92A 4WW0A 2FFJA 1N36M 2R46A 3HU3A 4IBEA 1IN4A 3KS8A 4L4UA 1WIVA 2UUBM 3AL0C 3M7GA 2Y0TA 2MROB 3GRUA 3BXWA 2R45A 2KNAA 4UN2B 2E5LM 3L25A 1ZQ9A 1IXSB 2YNMD 3E9SA 3H4JA 3UZUA 2YFQA 1NHGC 2KNZA 2DZLA 2LH0A 1UFZA 2JUJA 3SHFA 4AI6A 1XC8A 5FTNA 1GO5A 4LF7M 4RNAA 4L8RC 1G3IA 2RGHA 4CIZA 2F5NA 1QYRA 3KOWE 5EXPA 3CGWA 1DO2A 2XEPA 1HNXM 2D7GA 2XFTA 2FNAA 1WJ7A 4B7HA 3DOAA 4D80A 3TWLA 1PJJA 1TDHA 2VF8A 1IY0A 2DHYA 1DO0A 1OAOC 1TF0B 3GLFA 2KZSA 3HHWA 3A98B 3CF6E 1IM2A 4OVZA 3FD9A 4MGYE 5EJCA 2N35A 3BOSA 2J7OA 3VDPA 2XSZA 3AJIB 5GKNA 5IZ7D 3TWKA 4GMQA 2H5XA 5EP2A 4YHHM 5ITXE 5KPTA 1SXJE 2CV0A 1WGNA 3SARA 3HZJA 2R44A 1NO1A 3KOXE 5KPZA 2H1RA 3DZDA 4GH9A 3UK6A 2LVOC 4IJFA 2C9OA 3U61B 1X37A 2D7EA 1E32A 3GLIE 3Q8GA 2KHHA 4GKJM 2BWEA 3HWSA 4FWGA 2C5RA 3MJ5A 1HT1E 2CEAA 3E46A 3L28A 1GVNA 2LBCA 5IT9S 2VF7A 5EP3A 2LHCA 3FTDA 1E9RA 2CE7A 2FS1A 1NJFA 2QSFX 3I4YA 4R71A 4JV5M 3QAUA 5FTJA 5JI3E 3VK7A 2CV2A 4LF8M 1GABA 1D0LA 2G8LA 2WSEF 3KDSE 3ZCBB 3ILKA 1HR0M 4JI1M 3GLHA 4Z6YA 3L26A 3B7QA 4LFCM 2DENA 1HT2E 1D0KA 5DNYA 5EXTA 2DZOB 1QAOA 3V76A 3SAWA 1D0MA 2K0BX 4XBOA 1UM8A 4IBFA 4IBIA 4KLNA 1ZAEA 2D7HA 3Q8XA 2CHQA 5BPVA 5KQDA 2XLJA 4M9XA 4GRIA 1PJIA 2Z8YM 2LTUA 1EIJA 4DUYM 2GNOA 4DBGB 1N77A 2OPFA 4OU7A 1QQWA 3FUXA 3VK8A 4FD2A 2DXIA 3GPUA 2HCBA 4NRVA 4L15A 1OKSA 4L78A 3AOEC 1IN6A 3HJ8A 3KOYE 1JR3D 4AG6A 4DV5M 1N34M 4AW4A 4XGIA 3R9XB 2VQEM 5FTKA 4M9ZA 1HQCA 1R6BX 4LJAA 2J7NA 4EIWA 2BJWA 2K47A 4NSOB 1AUAA 3IECA 2MR9A 1K82A 4AG5A 3KFUG 3FYCA 3TWMA 5LMNM 5BR8M 2I7PA 3E4RA 4REZA 1IN8A 3W0LB 4B08A 4LF9M 2X4AA 4K0KM 4QNRA 2L4EA 3QWLA 2J5YA 3BBZA 1VG5A 4OX9M 4BBAA 4AKHA 2OO9A 3FKEA 2ZANA 1OQYA 4LJ5A 4PT5A 5ITTA 4DV3M 1C1KA 2JWSA 2L2DA 2RGOA 3EIHA 3B7ZA 4I4LA 3QYEA 3T15A 2ZAMA 4I81A 5ITXA 1Y8GA 2DAGA 4CGYB 1SXJA 3LW5F 5EP4A 4IBBA 1IY1A 4NXMM 1HNWM 2JY8A 2L09A 3SBJA 4JXJA 2QNJA 1I4WA 3GRVA 1CUKA 3TQSA 4QHTA 3U6PA 4QNMA 2M5ZA 1MX0A 2JA2A 3GPXA 4GHAA 2KW0A 1E9SA 1Q3BA 3RE8A 3J81S 5LMUM 3D8LA 1NNJA 3T1YM 1IY2A 2RKOA 1MJGM 2DNAA 2QPAA 3PNYA 2CV1A 3SMPA 1PM5A 1R2YA 2UUAM 3D8BA 3U6DA 4PCZA 1V33A 1N75A 1OTRA 2R0IA 2KA6B 4CHTB 2Y21A 4MGIE 1Z59A 3WHKA 3KSXA 4DV0M 4Z8XA 5EQTA 2R18A 2KXEA 4PDIA 1N32M 1F4IA 2O5RA 4ITQA 2V6ZM 5E26A 1RU3A 2Z4RA 1JB0F 4L16A 2DWMA 2APLA 1NSFA 1L2CA 3U6EA 3MMPA 1DGFA 5IREB 2Z7JA 3HGIA 3AV0A 4JI0M 4G4OA 1XNRM 3PVSA 3LVVA 4MGZE 4LF4M 1VEKA 2BNKA 1TGUA 2R4JA 2XGNA 3JR4A 1L1ZA 1ZMWA 1XXHB 4MGKE 2HAKA 4MH0E 5EP1A 1JR3E 1DGHB 3HHYA 3M6AA 3L29A 4F2LA 4JN6A 5ITYA 1GJSA 2EUCA 2L6OA 3E21A 2X49A 1R4GA 4GITA 4B3TM 4DR7M 1BVSA 2GQFA 4R7GA 8CATA 3U6SA 3VKGA 1VQ1A 2JY6B 2X8AA 4G4RA 1OFHA 3SATA 3U6OA 1T6OA 4JYAM 1AIPC 3NBIA 2EA0A 4I8OA 1IXSA 2BJVA 2FE8A 2O01F 2Z3XA 1C7YA 3W68A 2L7HA 2QBYB 3SAUA 3AOGA 3GLIA 3VDUA 4PD2A 1OIPA 2ZBKB 4MGHA 4LZJA 1GL6A 1MU5A 4LJ8A 4NL4H 4AKIA 4G3OA 3J7BA 1NHWC 4JI5M 4GHLA 1NY6A 4OW0A 4LGMA 1K3WA 5F3WA 4B3MM 4X66M 1R5LA 2O25A 3T6PA 3M0EA 4TUWA 1TH3A 3AKZA 2R4EA 1IXZA 2B3TA 2QP9X 2G3QA 1NVMA 2ERCA 3LCVB 3SHGB 1E94E 4G6ZA 4NSRA 2KZUA 2UXBM 3I4VA 2QZ4A 2MJ5B 1Z5CA 4IBDA 2DZNB 1QUSA 4CJ6A 4NC6A 3PFIA 2LHGA 4QHSA 2JZ0A 3J2PB 3GLGB 1L8QA 1G8PA 1PJQA 3I04M 1GL7A 3K9OA 3K2LA 4IBKA 4QOZC 5FSWA 4DUZM 2UXCM 2LWXA 4GEWA 1H6UA 4IBGA 2ZM6M 3SAVA 3KSJA 3L27A 2JY5A
chains in the Genus database with same CATH topology
1A5TA 2MROB 2L2DA 1Y8GA 2DAGA 2KNAA 1G4AE 3FRHA 4UN2B 2JY8A 2CWBA 3H4JA 1VDLA 2QNJA 1KYIA 1CUKA 2KNZA 2DZLA 1UFZA 2JUJA 1TTEA 1GO5A 1WR1B 1VEGA 1G3IA 1DV0A 3FRIA 1DO2A 2DNAA 1WJ7A 1MN3A 1WHCA 2ZTCA 1OTRA 4Q7JA 2R0IA 2DKLA 2DHYA 5DFLA 1XXHE 1DO0A 1F4IA 1YLAA 1IM2A 1EFUB 2LVQD 2H5XA 1P3QQ 2JP7A 1V92A 1OAIA 3MMPA 3FE3A 1WGNA 1NV9A 1ZMVA 3IHPA 4WP2A 2LVOC 1VEKA 2DAMA 2KHHA 1ZMWA 2LVAA 2BWEA 1PGYA 2HAKA 1JR3E 1HT1E 3E46A 2EKKA 2LBCA 4F2LA 1XB2B 1VEJA 1HQYE 3E21A 2DAEA 2QSFX 4R71A 1R4GA 1BVSA 3LCUA 1VQ1A 2HWJA 1T43A 2JY6B 3B89A 1T6OA 1HJPA 2JNHA 2DENA 1HT2E 1AIPC 4HEOA 4F1IA 1WGLA 1IXSA 2DAIA 5JI2E 1C7YA 2WZJA 1SG9A 2K0BX 2L4FA 2K9DA 3GLIE 3GLGE 2ZTDA 2EJSA 4G3OA 1QZEA 2LTUA 2JY7A 2LVPC 2DI0A 4DBGB 1Q02A 2O25A 3T6PA 1ZMUA 2B3TA 2DAKA 2RRUA 1OKSA 2G3QA 3LCVB 2EKFA 1E94E 2LVNC 1G41A 2MGWA 1ZV1A 2MJ5B 3GLHE 2BWBA 2CP8A 2JZ0A 1TR8A 2JY5A 3IECA 2MR9A 2KNVA 2JZ1A 1NV8A 3K9OA 3GLFE 2QHOB 1IFYA 3K9PA 4GEWA 2OOBA 2L4EA 2OOAA 3F92A 3BBZA 1VG5A 2OO9A 1OQYA 1WIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5T A;  2MRO B;  2L2D A;  1Y8G A;  2DAG A;  2KNA A;  1G4A E;  3FRH A;  4UN2 B;  2JY8 A;  2CWB A;  3H4J A;  1VDL A;  2QNJ A;  1KYI A;  1CUK A;  2KNZ A;  2DZL A;  1UFZ A;  2JUJ A;  1TTE A;  1GO5 A;  1WR1 B;  1VEG A;  1G3I A;  1DV0 A;  3FRI A;  1DO2 A;  2DNA A;  1WJ7 A;  1MN3 A;  1WHC A;  2ZTC A;  1OTR A;  4Q7J A;  2R0I A;  2DKL A;  2DHY A;  5DFL A;  1XXH E;  1DO0 A;  1F4I A;  1YLA A;  1IM2 A;  1EFU B;  2LVQ D;  2H5X A;  1P3Q Q;  2JP7 A;  1V92 A;  1OAI A;  3MMP A;  3FE3 A;  1WGN A;  1NV9 A;  1ZMV A;  3IHP A;  4WP2 A;  2LVO C;  1VEK A;  2DAM A;  2KHH A;  1ZMW A;  2LVA A;  2BWE A;  1PGY A;  2HAK A;  1JR3 E;  1HT1 E;  3E46 A;  2EKK A;  2LBC A;  4F2L A;  1XB2 B;  1VEJ A;  1HQY E;  3E21 A;  2DAE A;  2QSF X;  4R71 A;  1R4G A;  1BVS A;  3LCU A;  1VQ1 A;  2HWJ A;  1T43 A;  2JY6 B;  3B89 A;  1T6O A;  1HJP A;  2JNH A;  2DEN A;  1HT2 E;  1AIP C;  4HEO A;  4F1I A;  1WGL A;  1IXS A;  2DAI A;  5JI2 E;  1C7Y A;  2WZJ A;  1SG9 A;  2K0B X;  2L4F A;  2K9D A;  3GLI E;  3GLG E;  2ZTD A;  2EJS A;  4G3O A;  1QZE A;  2LTU A;  2JY7 A;  2LVP C;  2DI0 A;  4DBG B;  1Q02 A;  2O25 A;  3T6P A;  1ZMU A;  2B3T A;  2DAK A;  2RRU A;  1OKS A;  2G3Q A;  3LCV B;  2EKF A;  1E94 E;  2LVN C;  1G41 A;  2MGW A;  1ZV1 A;  2MJ5 B;  3GLH E;  2BWB A;  2CP8 A;  2JZ0 A;  1TR8 A;  2JY5 A;  3IEC A;  2MR9 A;  2KNV A;  2JZ1 A;  1NV8 A;  3K9O A;  3GLF E;  2QHO B;  1IFY A;  3K9P A;  4GEW A;  2OOB A;  2L4E A;  2OOA A;  3F92 A;  3BBZ A;  1VG5 A;  2OO9 A;  1OQY A;  1WIV A; 
#chains in the Genus database with same CATH topology
 3TL4 X;  3FRH A;  2CWB A;  4NOO B;  1TH2 A;  4LY6 A;  1KYI A;  1T3T A;  1I94 M;  4RF1 A;  1XWI A;  1LV7 A;  1TTE A;  2QCU A;  3GQ4 A;  1WR1 B;  1VEG A;  3GPP A;  3GLF B;  1D2N A;  2LXE A;  3FRI A;  3RFW A;  4FW9 A;  1IBM M;  4RF0 A;  2L7I A;  3C3D A;  2WSF F;  1MN3 A;  1WHC A;  3RGS A;  3KW6 A;  2DKL A;  1QUT A;  3FUW A;  1PJS A;  5DFL A;  1XXH E;  2I7N A;  1IQP A;  3SC3 A;  2FOI C;  1QAM A;  1V34 A;  1N33 M;  3HHX A;  1YLA A;  3HKP A;  1EFU B;  3PNV A;  4X65 M;  1XNQ M;  2CHV A;  3KP0 E;  4L6V 6;  3VLF B;  5KO3 A;  3QYB A;  4DV4 M;  4B3S M;  4YY3 M;  1DGB A;  3U6C A;  1QDR A;  1P3Q Q;  2R65 A;  5EXX A;  4M0D A;  1OAI A;  4KT0 F;  1HNZ M;  3HHZ A;  1NV9 A;  1ZMV A;  3LMM A;  5FTL A;  4LFB M;  3GQ3 A;  2OQ4 A;  1YSY A;  1OFI A;  3B74 A;  4IIW A;  4IBC A;  1YE9 A;  2DAM A;  4M0W A;  4LZZ A;  2G5G X;  1KSF X;  1W5T A;  2M60 A;  4LJ4 A;  2LVA A;  3HJQ A;  1QDT A;  2K6B A;  4BB9 A;  3AFH A;  2QBY A;  1IXR C;  4LJ9 A;  2EKK A;  2LNH C;  5EXS A;  4DV2 M;  4DR5 M;  1XB2 B;  1VEJ A;  1HQY E;  2Y0Q A;  1GKI A;  1NJG A;  4LFA M;  3SFZ A;  3JR5 A;  1IN5 A;  1SXJ C;  5ITR A;  4LF5 M;  2C96 A;  4HLQ A;  1GJT A;  1L1T A;  3C3E A;  3KXE C;  3LVW A;  2HWJ A;  1T43 A;  4JI4 M;  4DV1 M;  1ORY B;  2F5S A;  2VQF M;  3U5Z A;  1QVR A;  2JNH A;  1R2Z A;  1OIZ A;  4HEO A;  4F1I A;  3GO8 A;  1WGL A;  1XMO M;  5E6J A;  5JI2 E;  1OJL A;  2WZJ A;  2XF3 A;  4D81 A;  4GC5 A;  3W0F A;  4AZF A;  3NWL A;  3GLG E;  2DVW B;  3ZC7 B;  1XMQ M;  1QAQ A;  4X64 M;  4G4Q A;  4FCW A;  2LVP C;  2JY7 A;  2V1C A;  2C98 A;  1Q39 A;  2C99 A;  3FYD A;  3K8Z A;  1Z5B A;  1Q02 A;  3A45 A;  4OVZ B;  4ZPX A;  5H37 D;  5A2Q S;  4FCV A;  2ZAO A;  2KEB A;  2F5P A;  4LJ6 A;  3KP1 E;  1NNU C;  3FUU A;  5L8R F;  4P17 A;  4M9S A;  3GRY A;  3TE6 A;  3FTC A;  1G41 A;  4KO8 A;  4KHP M;  1ZV1 A;  4P16 A;  4R3D A;  3U6L A;  2BWB A;  4BLC A;  4MB7 A;  3GP1 A;  3GLI B;  4LF6 M;  3THG A;  2KNV A;  3CTW B;  2XZF A;  2HL7 A;  2XSZ D;  2WSC F;  4LG2 A;  1TH4 A;  1QZM A;  4LJ7 A;  4G4N A;  2DWL A;  3GLF E;  1IBK M;  2QHO B;  2XZU A;  3K9P A;  3RGP A;  2F5O A;  3EIE A;  2NQ8 C;  1XXH A;  4WUR A;  3B7N A;  2OOA A;  2UU9 M;  1DGH A;  3FUT A;  4KOD A;  4B3R M;  4JI2 M;  3IG8 A;  5C18 A;  3MHV C;  3U60 B;  2EO2 A;  1DGG A;  4B7G A;  2R6F A;  1A5T A;  3ZH9 B;  1EE8 A;  2AHM A;  3HY5 A;  3GLH B;  3SMS A;  2KDL A;  5ITU A;  1G4A E;  3MK6 A;  2Z4S A;  3U6Q A;  1TDZ A;  1JQJ C;  2DWZ B;  4DR4 M;  1VDL A;  5KQ8 A;  3SAS A;  4JI6 M;  1IN7 A;  3B9P A;  1G59 A;  4W5W A;  2F5Q A;  4RKU F;  3C9P A;  2JXN A;  1G71 A;  4JI3 M;  5KPR A;  1Z5A A;  1DV0 A;  2XH9 A;  2QEN A;  3U61 A;  4XK8 F;  2ZTC A;  4Q7J A;  2FH0 A;  3UJN A;  3NBX X;  3VFD A;  3I51 A;  4DR6 M;  3WHL A;  2W82 A;  2DHR A;  4I5S A;  4DV7 M;  2QQ8 A;  2LVQ D;  3W67 A;  3CF2 A;  2VII A;  3DFZ A;  2JP7 A;  1QAN A;  1V92 A;  4LRT A;  5DYG A;  3AOE A;  3FE3 A;  4DV6 M;  1XHB A;  3KVW A;  3IHP A;  4NXN M;  4LCB A;  4WP2 A;  3VKH A;  1R7R A;  4LRS A;  4PDG A;  4GC9 A;  3GLG A;  2C9C A;  3LQQ A;  3T1H M;  2V1U A;  3R8F A;  2R62 A;  3K1J A;  5ITQ A;  1N78 A;  3OTO M;  4S12 A;  1JR3 A;  1PGY A;  3FUV A;  4CIS A;  3J80 S;  4X62 M;  4MM3 B;  5FTM A;  4A3V B;  3LQR A;  3HJS A;  2DAE A;  1J7K A;  2Y20 A;  2CFO A;  4GIP A;  3LCU A;  1SXJ B;  4B7F A;  3DA1 A;  3B89 A;  4HL4 A;  3I01 M;  4DR1 M;  3PXG A;  3H4M A;  1HJP A;  1WXQ A;  3JAM S;  3FTF A;  2UXD M;  4FVM A;  1L2D A;  3T38 A;  3K92 A;  1L2B A;  2DAI A;  3U6M A;  3U5Z B;  3A46 A;  1SG9 A;  5C1B A;  2L4F A;  4LGY A;  3HU1 A;  3SYK A;  2F4V M;  2K9D A;  1PRB A;  2CHG A;  2VDB B;  4IJE A;  2YR0 A;  2CUZ A;  2Q2E B;  2ZTD A;  1PJT A;  1YUB A;  1SXJ D;  2MH8 A;  3GRR A;  1J09 A;  3J27 B;  4FWD A;  1Q3C A;  1S3S A;  2EJS A;  1QZE A;  7CAT A;  4AQY M;  1J5E M;  3L2A A;  1LTM A;  2DI0 A;  3HX3 A;  2UUC M;  3HU2 A;  1GLN A;  2P5T A;  3ZQJ A;  3KS4 A;  2DWN A;  4Y28 F;  1ZMU A;  2A5Y B;  2DAK A;  2RRU A;  5DYI A;  3TPZ A;  2HKJ A;  5FLX S;  4DR3 M;  4D82 A;  3GQ5 A;  4JI7 M;  1FNN A;  2EKF A;  1W5S A;  2YQZ A;  2XFS A;  2KRU A;  2LVN C;  4ANR A;  2HHH M;  3FTE A;  2MGW A;  4NRW A;  3U60 A;  3GLH E;  1FJG M;  1K3X A;  4JI8 M;  2CP8 A;  3J7A S;  3SYL A;  1VDD A;  4IBJ A;  1TR8 A;  4FCT A;  3KOZ E;  1KFV A;  4AKG A;  1NY5 A;  4II7 A;  2JZ1 A;  4DR2 M;  1NV8 A;  3CF0 A;  3UMM A;  3GPY A;  4FWH A;  3C58 A;  1Z6T A;  3UGJ A;  5IWA M;  3A42 A;  4GKK M;  1IFY A;  1IBL M;  2KRK A;  2OOB A;  3IG5 A;  2CRU A;  4QOS A;  3F92 A;  4WW0 A;  2FFJ A;  1N36 M;  2R46 A;  3HU3 A;  4IBE A;  1IN4 A;  3KS8 A;  4L4U A;  1WIV A;  2UUB M;  3AL0 C;  3M7G A;  2Y0T A;  2MRO B;  3GRU A;  3BXW A;  2R45 A;  2KNA A;  4UN2 B;  2E5L M;  3L25 A;  1ZQ9 A;  1IXS B;  2YNM D;  3E9S A;  3H4J A;  3UZU A;  2YFQ A;  1NHG C;  2KNZ A;  2DZL A;  2LH0 A;  1UFZ A;  2JUJ A;  3SHF A;  4AI6 A;  1XC8 A;  5FTN A;  1GO5 A;  4LF7 M;  4RNA A;  4L8R C;  1G3I A;  2RGH A;  4CIZ A;  2F5N A;  1QYR A;  3KOW E;  5EXP A;  3CGW A;  1DO2 A;  2XEP A;  1HNX M;  2D7G A;  2XFT A;  2FNA A;  1WJ7 A;  4B7H A;  3DOA A;  4D80 A;  3TWL A;  1PJJ A;  1TDH A;  2VF8 A;  1IY0 A;  2DHY A;  1DO0 A;  1OAO C;  1TF0 B;  3GLF A;  2KZS A;  3HHW A;  3A98 B;  3CF6 E;  1IM2 A;  4OVZ A;  3FD9 A;  4MGY E;  5EJC A;  2N35 A;  3BOS A;  2J7O A;  3VDP A;  2XSZ A;  3AJI B;  5GKN A;  5IZ7 D;  3TWK A;  4GMQ A;  2H5X A;  5EP2 A;  4YHH M;  5ITX E;  5KPT A;  1SXJ E;  2CV0 A;  1WGN A;  3SAR A;  3HZJ A;  2R44 A;  1NO1 A;  3KOX E;  5KPZ A;  2H1R A;  3DZD A;  4GH9 A;  3UK6 A;  2LVO C;  4IJF A;  2C9O A;  3U61 B;  1X37 A;  2D7E A;  1E32 A;  3GLI E;  3Q8G A;  2KHH A;  4GKJ M;  2BWE A;  3HWS A;  4FWG A;  2C5R A;  3MJ5 A;  1HT1 E;  2CEA A;  3E46 A;  3L28 A;  1GVN A;  2LBC A;  5IT9 S;  2VF7 A;  5EP3 A;  2LHC A;  3FTD A;  1E9R A;  2CE7 A;  2FS1 A;  1NJF A;  2QSF X;  3I4Y A;  4R71 A;  4JV5 M;  3QAU A;  5FTJ A;  5JI3 E;  3VK7 A;  2CV2 A;  4LF8 M;  1GAB A;  1D0L A;  2G8L A;  2WSE F;  3KDS E;  3ZCB B;  3ILK A;  1HR0 M;  4JI1 M;  3GLH A;  4Z6Y A;  3L26 A;  3B7Q A;  4LFC M;  2DEN A;  1HT2 E;  1D0K A;  5DNY A;  5EXT A;  2DZO B;  1QAO A;  3V76 A;  3SAW A;  1D0M A;  2K0B X;  4XBO A;  1UM8 A;  4IBF A;  4IBI A;  4KLN A;  1ZAE A;  2D7H A;  3Q8X A;  2CHQ A;  5BPV A;  5KQD A;  2XLJ A;  4M9X A;  4GRI A;  1PJI A;  2Z8Y M;  2LTU A;  1EIJ A;  4DUY M;  2GNO A;  4DBG B;  1N77 A;  2OPF A;  4OU7 A;  1QQW A;  3FUX A;  3VK8 A;  4FD2 A;  2DXI A;  3GPU A;  2HCB A;  4NRV A;  4L15 A;  1OKS A;  4L78 A;  3AOE C;  1IN6 A;  3HJ8 A;  3KOY E;  1JR3 D;  4AG6 A;  4DV5 M;  1N34 M;  4AW4 A;  4XGI A;  3R9X B;  2VQE M;  5FTK A;  4M9Z A;  1HQC A;  1R6B X;  4LJA A;  2J7N A;  4EIW A;  2BJW A;  2K47 A;  4NSO B;  1AUA A;  3IEC A;  2MR9 A;  1K82 A;  4AG5 A;  3KFU G;  3FYC A;  3TWM A;  5LMN M;  5BR8 M;  2I7P A;  3E4R A;  4REZ A;  1IN8 A;  3W0L B;  4B08 A;  4LF9 M;  2X4A A;  4K0K M;  4QNR A;  2L4E A;  3QWL A;  2J5Y A;  3BBZ A;  1VG5 A;  4OX9 M;  4BBA A;  4AKH A;  2OO9 A;  3FKE A;  2ZAN A;  1OQY A;  4LJ5 A;  4PT5 A;  5ITT A;  4DV3 M;  1C1K A;  2JWS A;  2L2D A;  2RGO A;  3EIH A;  3B7Z A;  4I4L A;  3QYE A;  3T15 A;  2ZAM A;  4I81 A;  5ITX A;  1Y8G A;  2DAG A;  4CGY B;  1SXJ A;  3LW5 F;  5EP4 A;  4IBB A;  1IY1 A;  4NXM M;  1HNW M;  2JY8 A;  2L09 A;  3SBJ A;  4JXJ A;  2QNJ A;  1I4W A;  3GRV A;  1CUK A;  3TQS A;  4QHT A;  3U6P A;  4QNM A;  2M5Z A;  1MX0 A;  2JA2 A;  3GPX A;  4GHA A;  2KW0 A;  1E9S A;  1Q3B A;  3RE8 A;  3J81 S;  5LMU M;  3D8L A;  1NNJ A;  3T1Y M;  1IY2 A;  2RKO A;  1MJG M;  2DNA A;  2QPA A;  3PNY A;  2CV1 A;  3SMP A;  1PM5 A;  1R2Y A;  2UUA M;  3D8B A;  3U6D A;  4PCZ A;  1V33 A;  1N75 A;  1OTR A;  2R0I A;  2KA6 B;  4CHT B;  2Y21 A;  4MGI E;  1Z59 A;  3WHK A;  3KSX A;  4DV0 M;  4Z8X A;  5EQT A;  2R18 A;  2KXE A;  4PDI A;  1N32 M;  1F4I A;  2O5R A;  4ITQ A;  2V6Z M;  5E26 A;  1RU3 A;  2Z4R A;  1JB0 F;  4L16 A;  2DWM A;  2APL A;  1NSF A;  1L2C A;  3U6E A;  3MMP A;  1DGF A;  5IRE B;  2Z7J A;  3HGI A;  3AV0 A;  4JI0 M;  4G4O A;  1XNR M;  3PVS A;  3LVV A;  4MGZ E;  4LF4 M;  1VEK A;  2BNK A;  1TGU A;  2R4J A;  2XGN A;  3JR4 A;  1L1Z A;  1ZMW A;  1XXH B;  4MGK E;  2HAK A;  4MH0 E;  5EP1 A;  1JR3 E;  1DGH B;  3HHY A;  3M6A A;  3L29 A;  4F2L A;  4JN6 A;  5ITY A;  1GJS A;  2EUC A;  2L6O A;  3E21 A;  2X49 A;  1R4G A;  4GIT A;  4B3T M;  4DR7 M;  1BVS A;  2GQF A;  4R7G A;  8CAT A;  3U6S A;  3VKG A;  1VQ1 A;  2JY6 B;  2X8A A;  4G4R A;  1OFH A;  3SAT A;  3U6O A;  1T6O A;  4JYA M;  1AIP C;  3NBI A;  2EA0 A;  4I8O A;  1IXS A;  2BJV A;  2FE8 A;  2O01 F;  2Z3X A;  1C7Y A;  3W68 A;  2L7H A;  2QBY B;  3SAU A;  3AOG A;  3GLI A;  3VDU A;  4PD2 A;  1OIP A;  2ZBK B;  4MGH A;  4LZJ A;  1GL6 A;  1MU5 A;  4LJ8 A;  4NL4 H;  4AKI A;  4G3O A;  3J7B A;  1NHW C;  4JI5 M;  4GHL A;  1NY6 A;  4OW0 A;  4LGM A;  1K3W A;  5F3W A;  4B3M M;  4X66 M;  1R5L A;  2O25 A;  3T6P A;  3M0E A;  4TUW A;  1TH3 A;  3AKZ A;  2R4E A;  1IXZ A;  2B3T A;  2QP9 X;  2G3Q A;  1NVM A;  2ERC A;  3LCV B;  3SHG B;  1E94 E;  4G6Z A;  4NSR A;  2KZU A;  2UXB M;  3I4V A;  2QZ4 A;  2MJ5 B;  1Z5C A;  4IBD A;  2DZN B;  1QUS A;  4CJ6 A;  4NC6 A;  3PFI A;  2LHG A;  4QHS A;  2JZ0 A;  3J2P B;  3GLG B;  1L8Q A;  1G8P A;  1PJQ A;  3I04 M;  1GL7 A;  3K9O A;  3K2L A;  4IBK A;  4QOZ C;  5FSW A;  4DUZ M;  2UXC M;  2LWX A;  4GEW A;  1H6U A;  4IBG A;  2ZM6 M;  3SAV A;  3KSJ A;  3L27 A;  2JY5 A; 
#chains in the Genus database with same CATH homology
 1A5T A;  2MRO B;  2L2D A;  1Y8G A;  2DAG A;  2KNA A;  1G4A E;  3FRH A;  4UN2 B;  2JY8 A;  2CWB A;  3H4J A;  1VDL A;  2QNJ A;  1KYI A;  1CUK A;  2KNZ A;  2DZL A;  1UFZ A;  2JUJ A;  1TTE A;  1GO5 A;  1WR1 B;  1VEG A;  1G3I A;  1DV0 A;  3FRI A;  1DO2 A;  2DNA A;  1WJ7 A;  1MN3 A;  1WHC A;  2ZTC A;  1OTR A;  4Q7J A;  2R0I A;  2DKL A;  2DHY A;  5DFL A;  1XXH E;  1DO0 A;  1F4I A;  1YLA A;  1IM2 A;  1EFU B;  2LVQ D;  2H5X A;  1P3Q Q;  2JP7 A;  1V92 A;  1OAI A;  3MMP A;  3FE3 A;  1WGN A;  1NV9 A;  1ZMV A;  3IHP A;  4WP2 A;  2LVO C;  1VEK A;  2DAM A;  2KHH A;  1ZMW A;  2LVA A;  2BWE A;  1PGY A;  2HAK A;  1JR3 E;  1HT1 E;  3E46 A;  2EKK A;  2LBC A;  4F2L A;  1XB2 B;  1VEJ A;  1HQY E;  3E21 A;  2DAE A;  2QSF X;  4R71 A;  1R4G A;  1BVS A;  3LCU A;  1VQ1 A;  2HWJ A;  1T43 A;  2JY6 B;  3B89 A;  1T6O A;  1HJP A;  2JNH A;  2DEN A;  1HT2 E;  1AIP C;  4HEO A;  4F1I A;  1WGL A;  1IXS A;  2DAI A;  5JI2 E;  1C7Y A;  2WZJ A;  1SG9 A;  2K0B X;  2L4F A;  2K9D A;  3GLI E;  3GLG E;  2ZTD A;  2EJS A;  4G3O A;  1QZE A;  2LTU A;  2JY7 A;  2LVP C;  2DI0 A;  4DBG B;  1Q02 A;  2O25 A;  3T6P A;  1ZMU A;  2B3T A;  2DAK A;  2RRU A;  1OKS A;  2G3Q A;  3LCV B;  2EKF A;  1E94 E;  2LVN C;  1G41 A;  2MGW A;  1ZV1 A;  2MJ5 B;  3GLH E;  2BWB A;  2CP8 A;  2JZ0 A;  1TR8 A;  2JY5 A;  3IEC A;  2MR9 A;  2KNV A;  2JZ1 A;  1NV8 A;  3K9O A;  3GLF E;  2QHO B;  1IFY A;  3K9P A;  4GEW A;  2OOB A;  2L4E A;  2OOA A;  3F92 A;  3BBZ A;  1VG5 A;  2OO9 A;  1OQY A;  1WIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...