2K9IA

Nmr structure of plasmid copy control protein orf56 from sulfolobus islandicus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
55
structure length
55
Chain Sequence
GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Stability Analysis of an Extremely Stable Dimeric DNA Binding Protein from Sulfolobus islandicus
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Dna binding protein
molecule keywords Uncharacterized protein ORF56
total genus 15
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2k9iA00
2WVFA 2K29A 3FT7A 3QOQA 2WVCA 1PARA 1X93A 1B28A 1Q5VA 4D8JA 2CAJA 2RBFA 2K6LA 2BNWA 2JXHA 3FMTA 2BJ7A 3GXQA 3VEAA 1MNTA 1IRQA 1NLAA 2BJ9A 2BJ3A 2GPEA 2CAXA 2BJ8A 2CADA 1QTGA 1BAZA 2HZAA 4ME7E 1BDVA 1MYLA 3LGHA 1U9PA 3H87C 2K1OA 2CA9A 2CPGA 2BJ1A 1BDTA 3OD2A 2AY0A 1P94A 1ARQA 2KELA 2WVEA 2K5JA 4FXEA 4HV0A 3VEBA 2BNZA 2WVBA 2WVDA 1MYKA 2BA3A 2H1OE 2JXIA 3VW4A 1EA4A 2HZVA 2BSQE 1ARRA 2JXGA 2K9IA 1B01A
chains in the Genus database with same CATH superfamily
2K29A 1PARA 1B28A 1X93A 2CAJA 2KOEA 3BSOA 3VEAA 2BJ9A 2GPEA 2BJ3A 2CADA 1SH2A 1QTGA 1MYLA 3H87C 2KKEA 2CPGA 4LQ3A 3G5OA 4QPXA 3IR7A 1ARQA 2KELA 4LQ9A 1SH3A 2WK4A 2JXIA 2H1OE 2HZVA 2ADLA 2CKWA 2BNWA 3GXQA 3UQSA 1IRQA 4ME7E 3NAIA 3LGHA 3NAHA 2CA9A 1BDTA 2WVEA 3H5YA 4FXEA 4HV0A 2B43A 2WVBA 3LJPA 2BA3A 2BSQE 3H5XA 2JXGA 3FT7A 4MJWA 4NRTA 2RBFA 1OHNA 2K6LA 4NRUA 1NLAA 2UUWA 2CAXA 1BDVA 1SIWA 2UUTA 2AY0A 3UPFA 4AAIA 3VEBA 2BNZA 2WVDA 3VW4A 1EA4A 4LRVA 1ARRA 1Q16A 2K9IA 2WVFA 2JBVA 3QOQA 2WVCA 3NNEA 1Q5VA 4D8JA 2JXHA 3NO7A 3FMTA 2BJ7A 1MNTA 1OG7A 2BJ8A 2Q2KA 4O4RA 1BAZA 2HZAA 2A2BA 3SFGA 3BSNA 2H3AA 3UR0A 1U9PA 2K1OA 2BJ1A 3OD2A 1SH0A 2AN7A 1P94A 2K5JA 3QIDA 1MYKA 3SFUA 1B01A
chains in the Genus database with same CATH topology
2WVFA 2K29A 3FT7A 3QOQA 2WVCA 1PARA 1X93A 1B28A 1Q5VA 4D8JA 2CAJA 2RBFA 2K6LA 2BNWA 2JXHA 3FMTA 2BJ7A 3GXQA 3VEAA 1MNTA 1IRQA 1NLAA 2BJ9A 2BJ3A 2GPEA 2CAXA 2BJ8A 2CADA 1QTGA 1BAZA 2HZAA 4ME7E 1BDVA 1MYLA 3LGHA 1U9PA 3H87C 2K1OA 2CA9A 2CPGA 2BJ1A 1BDTA 3OD2A 2AY0A 1P94A 1ARQA 2KELA 2WVEA 2K5JA 4FXEA 4HV0A 3VEBA 2BNZA 2WVBA 2WVDA 1MYKA 2BA3A 2H1OE 2JXIA 3VW4A 1EA4A 2HZVA 2BSQE 1ARRA 2JXGA 2K9IA 1B01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVF A;  2K29 A;  3FT7 A;  3QOQ A;  2WVC A;  1PAR A;  1X93 A;  1B28 A;  1Q5V A;  4D8J A;  2CAJ A;  2RBF A;  2K6L A;  2BNW A;  2JXH A;  3FMT A;  2BJ7 A;  3GXQ A;  3VEA A;  1MNT A;  1IRQ A;  1NLA A;  2BJ9 A;  2BJ3 A;  2GPE A;  2CAX A;  2BJ8 A;  2CAD A;  1QTG A;  1BAZ A;  2HZA A;  4ME7 E;  1BDV A;  1MYL A;  3LGH A;  1U9P A;  3H87 C;  2K1O A;  2CA9 A;  2CPG A;  2BJ1 A;  1BDT A;  3OD2 A;  2AY0 A;  1P94 A;  1ARQ A;  2KEL A;  2WVE A;  2K5J A;  4FXE A;  4HV0 A;  3VEB A;  2BNZ A;  2WVB A;  2WVD A;  1MYK A;  2BA3 A;  2H1O E;  2JXI A;  3VW4 A;  1EA4 A;  2HZV A;  2BSQ E;  1ARR A;  2JXG A;  2K9I A;  1B01 A; 
#chains in the Genus database with same CATH topology
 2K29 A;  1PAR A;  1B28 A;  1X93 A;  2CAJ A;  2KOE A;  3BSO A;  3VEA A;  2BJ9 A;  2GPE A;  2BJ3 A;  2CAD A;  1SH2 A;  1QTG A;  1MYL A;  3H87 C;  2KKE A;  2CPG A;  4LQ3 A;  3G5O A;  4QPX A;  3IR7 A;  1ARQ A;  2KEL A;  4LQ9 A;  1SH3 A;  2WK4 A;  2JXI A;  2H1O E;  2HZV A;  2ADL A;  2CKW A;  2BNW A;  3GXQ A;  3UQS A;  1IRQ A;  4ME7 E;  3NAI A;  3LGH A;  3NAH A;  2CA9 A;  1BDT A;  2WVE A;  3H5Y A;  4FXE A;  4HV0 A;  2B43 A;  2WVB A;  3LJP A;  2BA3 A;  2BSQ E;  3H5X A;  2JXG A;  3FT7 A;  4MJW A;  4NRT A;  2RBF A;  1OHN A;  2K6L A;  4NRU A;  1NLA A;  2UUW A;  2CAX A;  1BDV A;  1SIW A;  2UUT A;  2AY0 A;  3UPF A;  4AAI A;  3VEB A;  2BNZ A;  2WVD A;  3VW4 A;  1EA4 A;  4LRV A;  1ARR A;  1Q16 A;  2K9I A;  2WVF A;  2JBV A;  3QOQ A;  2WVC A;  3NNE A;  1Q5V A;  4D8J A;  2JXH A;  3NO7 A;  3FMT A;  2BJ7 A;  1MNT A;  1OG7 A;  2BJ8 A;  2Q2K A;  4O4R A;  1BAZ A;  2HZA A;  2A2B A;  3SFG A;  3BSN A;  2H3A A;  3UR0 A;  1U9P A;  2K1O A;  2BJ1 A;  3OD2 A;  1SH0 A;  2AN7 A;  1P94 A;  2K5J A;  3QID A;  1MYK A;  3SFU A;  1B01 A; 
#chains in the Genus database with same CATH homology
 2WVF A;  2K29 A;  3FT7 A;  3QOQ A;  2WVC A;  1PAR A;  1X93 A;  1B28 A;  1Q5V A;  4D8J A;  2CAJ A;  2RBF A;  2K6L A;  2BNW A;  2JXH A;  3FMT A;  2BJ7 A;  3GXQ A;  3VEA A;  1MNT A;  1IRQ A;  1NLA A;  2BJ9 A;  2BJ3 A;  2GPE A;  2CAX A;  2BJ8 A;  2CAD A;  1QTG A;  1BAZ A;  2HZA A;  4ME7 E;  1BDV A;  1MYL A;  3LGH A;  1U9P A;  3H87 C;  2K1O A;  2CA9 A;  2CPG A;  2BJ1 A;  1BDT A;  3OD2 A;  2AY0 A;  1P94 A;  1ARQ A;  2KEL A;  2WVE A;  2K5J A;  4FXE A;  4HV0 A;  3VEB A;  2BNZ A;  2WVB A;  2WVD A;  1MYK A;  2BA3 A;  2H1O E;  2JXI A;  3VW4 A;  1EA4 A;  2HZV A;  2BSQ E;  1ARR A;  2JXG A;  2K9I A;  1B01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...