2K9IA

Nmr structure of plasmid copy control protein orf56 from sulfolobus islandicus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
55
structure length
55
Chain Sequence
b'GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ORF56
publication title Structure-Based Stability Analysis of an Extremely Stable Dimeric DNA Binding Protein from Sulfolobus islandicus
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Dna binding protein
total genus 15
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2k9iA00
2CA9A 4FXEA 3VEAA 1P94A 2AY0A 2K29A 1PARA 2BNZA 1NLAA 2K1OA 3FT7A 3H87C 2CAXA 2CADA 3OD2A 1MYKA 4HV0A 2WVFA 2WVDA 2WVCA 2BNWA 3QOQA 1BAZA 2JXHA 3VEBA 2BA3A 1BDVA 1Q5VA 2WVEA 1X93A 3LGHA 1B28A 1MNTA 2K9IA 4D8JA 2H1OE 1U9PA 1MYLA 2CAJA 2GPEA 2JXGA 2BJ3A 2K6LA 1BDTA 2JXIA 3VW4A 4ME7E 2BJ9A 2HZAA 1IRQA 1EA4A 1ARQA 3GXQA 2RBFA 2K5JA 2WVBA 1B01A 2BJ7A 3FMTA 2BSQE 1ARRA 1QTGA 2KELA 2CPGA 2HZVA 2BJ1A 2BJ8A
chains in the Genus database with same CATH superfamily
3BSNA 3LJPA 4LQ9A 3H5XA 2CAXA 3OD2A 1MYKA 4QPXA 2WVCA 2BNWA 1OHNA 2ADLA 1SIWA 1B28A 4D8JA 1MYLA 4O4RA 2K6LA 2JXGA 1Q16A 4NRTA 2BJ3A 1IRQA 2RBFA 2K5JA 3SFUA 2HZVA 1ARRA 1QTGA 4LRVA 3VEAA 1SH0A 1PARA 3FT7A 2K1OA 2CADA 4HV0A 3H5YA 1SH3A 2H3AA 2BA3A 2AN7A 1MNTA 2K9IA 2UUWA 1U9PA 3NAIA 2CAJA 2UUTA 1OG7A 4NRUA 3UQSA 3GXQA 3NAHA 2KELA 2BJ8A 2Q2KA 4FXEA 1P94A 3UPFA 2BNZA 3SFGA 1NLAA 2JXHA 3VEBA 1Q5VA 2H1OE 4MJWA 2GPEA 2JXIA 4LQ3A 2WK4A 2HZAA 1EA4A 1ARQA 2JBVA 2B43A 2BSQE 2CKWA 3UR0A 2CA9A 2AY0A 2K29A 3H87C 3IR7A 2WVDA 3QOQA 1BAZA 3QIDA 1BDVA 2KKEA 3BSOA 2WVEA 1X93A 3LGHA 2A2BA 2KOEA 1BDTA 3VW4A 4ME7E 3G5OA 2BJ9A 3NO7A 4AAIA 1B01A 2WVBA 3NNEA 1SH2A 2BJ7A 3FMTA 2WVFA 2CPGA 2BJ1A
chains in the Genus database with same CATH topology
2CA9A 4FXEA 3VEAA 1P94A 2AY0A 2K29A 1PARA 2BNZA 1NLAA 2K1OA 3FT7A 3H87C 2CAXA 2CADA 3OD2A 1MYKA 4HV0A 2WVFA 2WVDA 2WVCA 2BNWA 3QOQA 1BAZA 2JXHA 3VEBA 2BA3A 1BDVA 1Q5VA 2WVEA 1X93A 3LGHA 1B28A 1MNTA 2K9IA 4D8JA 2H1OE 1U9PA 1MYLA 2CAJA 2GPEA 2JXGA 2BJ3A 2K6LA 1BDTA 2JXIA 3VW4A 4ME7E 2BJ9A 2HZAA 1IRQA 1EA4A 1ARQA 3GXQA 2RBFA 2K5JA 2WVBA 1B01A 2BJ7A 3FMTA 2BSQE 1ARRA 1QTGA 2KELA 2CPGA 2HZVA 2BJ1A 2BJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CA9 A;  4FXE A;  3VEA A;  1P94 A;  2AY0 A;  2K29 A;  1PAR A;  2BNZ A;  1NLA A;  2K1O A;  3FT7 A;  3H87 C;  2CAX A;  2CAD A;  3OD2 A;  1MYK A;  4HV0 A;  2WVF A;  2WVD A;  2WVC A;  2BNW A;  3QOQ A;  1BAZ A;  2JXH A;  3VEB A;  2BA3 A;  1BDV A;  1Q5V A;  2WVE A;  1X93 A;  3LGH A;  1B28 A;  1MNT A;  2K9I A;  4D8J A;  2H1O E;  1U9P A;  1MYL A;  2CAJ A;  2GPE A;  2JXG A;  2BJ3 A;  2K6L A;  1BDT A;  2JXI A;  3VW4 A;  4ME7 E;  2BJ9 A;  2HZA A;  1IRQ A;  1EA4 A;  1ARQ A;  3GXQ A;  2RBF A;  2K5J A;  2WVB A;  1B01 A;  2BJ7 A;  3FMT A;  2BSQ E;  1ARR A;  1QTG A;  2KEL A;  2CPG A;  2HZV A;  2BJ1 A;  2BJ8 A; 
#chains in the Genus database with same CATH topology
 3BSN A;  3LJP A;  4LQ9 A;  3H5X A;  2CAX A;  3OD2 A;  1MYK A;  4QPX A;  2WVC A;  2BNW A;  1OHN A;  2ADL A;  1SIW A;  1B28 A;  4D8J A;  1MYL A;  4O4R A;  2K6L A;  2JXG A;  1Q16 A;  4NRT A;  2BJ3 A;  1IRQ A;  2RBF A;  2K5J A;  3SFU A;  2HZV A;  1ARR A;  1QTG A;  4LRV A;  3VEA A;  1SH0 A;  1PAR A;  3FT7 A;  2K1O A;  2CAD A;  4HV0 A;  3H5Y A;  1SH3 A;  2H3A A;  2BA3 A;  2AN7 A;  1MNT A;  2K9I A;  2UUW A;  1U9P A;  3NAI A;  2CAJ A;  2UUT A;  1OG7 A;  4NRU A;  3UQS A;  3GXQ A;  3NAH A;  2KEL A;  2BJ8 A;  2Q2K A;  4FXE A;  1P94 A;  3UPF A;  2BNZ A;  3SFG A;  1NLA A;  2JXH A;  3VEB A;  1Q5V A;  2H1O E;  4MJW A;  2GPE A;  2JXI A;  4LQ3 A;  2WK4 A;  2HZA A;  1EA4 A;  1ARQ A;  2JBV A;  2B43 A;  2BSQ E;  2CKW A;  3UR0 A;  2CA9 A;  2AY0 A;  2K29 A;  3H87 C;  3IR7 A;  2WVD A;  3QOQ A;  1BAZ A;  3QID A;  1BDV A;  2KKE A;  3BSO A;  2WVE A;  1X93 A;  3LGH A;  2A2B A;  2KOE A;  1BDT A;  3VW4 A;  4ME7 E;  3G5O A;  2BJ9 A;  3NO7 A;  4AAI A;  1B01 A;  2WVB A;  3NNE A;  1SH2 A;  2BJ7 A;  3FMT A;  2WVF A;  2CPG A;  2BJ1 A; 
#chains in the Genus database with same CATH homology
 2CA9 A;  4FXE A;  3VEA A;  1P94 A;  2AY0 A;  2K29 A;  1PAR A;  2BNZ A;  1NLA A;  2K1O A;  3FT7 A;  3H87 C;  2CAX A;  2CAD A;  3OD2 A;  1MYK A;  4HV0 A;  2WVF A;  2WVD A;  2WVC A;  2BNW A;  3QOQ A;  1BAZ A;  2JXH A;  3VEB A;  2BA3 A;  1BDV A;  1Q5V A;  2WVE A;  1X93 A;  3LGH A;  1B28 A;  1MNT A;  2K9I A;  4D8J A;  2H1O E;  1U9P A;  1MYL A;  2CAJ A;  2GPE A;  2JXG A;  2BJ3 A;  2K6L A;  1BDT A;  2JXI A;  3VW4 A;  4ME7 E;  2BJ9 A;  2HZA A;  1IRQ A;  1EA4 A;  1ARQ A;  3GXQ A;  2RBF A;  2K5J A;  2WVB A;  1B01 A;  2BJ7 A;  3FMT A;  2BSQ E;  1ARR A;  1QTG A;  2KEL A;  2CPG A;  2HZV A;  2BJ1 A;  2BJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...