2K9JA

Integrin alphaiib-beta3 transmembrane complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
42
structure length
42
Chain Sequence
b'GALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb light chain
publication title The structure of the integrin alphaIIbbeta3 transmembrane complex explains integrin transmembrane signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 11
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2008-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.930 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bicelle-embedded integrin alpha(iib) transmembrane segment 2k9jA00
2K9JA 2M3EA 2KNCA 2K1AA
chains in the Genus database with same CATH superfamily
3PHLA 1X79B 3S1KA 1BCCG 3QWOC 2D2CB 1L4AA 2V4HA 1UIXA 3TNUA 1KILE 4UB8E 2OTLP 1GL2C 3JSVC 3V4QA 1OXZA 3H1ID 1IZNB 2XV5A 1SQBE 2WITA 3L73E 1Y8AA 4W80A 1NTZG 4QMAA 5TJHA 1XTCC 3H1HG 3RK3C 2WPRA 1RE4A 1SQXJ 2WSCH 5APWA 4U7JA 1J1EB 1VDFA 2XDJA 1L0NJ 2WSFJ 3BRVB 2IZ0A 2G8YA 3Q5PA 5KLVK 1BDCA 3O8ZA 3S9OA 3CPWO 2NPSA 3AE2C 4PJ0E 4YTPC 1G2CA 1NHLA 2YNYA 2PRRA 1BCCJ 1L0LK 2M3BA 3G9RA 1M57D 1S5LX 4M3LA 1VQ4P 1HUCA 1PIXA 2W6JH 2YIUB 3H1IG 5CMZA 2E74D 2WQYC 1Q2NA 2CK3H 5AW6B 4A7PA 3SFDC 4HB1A 3D70A 3H6PA 2H43A 1W5CE 2Y0DA 1NTZJ 3Q2YA 4HKZH 3EFFK 1DD4A 2AXTH 2ZYAA 3R2PA 3H1HJ 5KLIC 3A0BE 3H32A 2R44A 3D6ZA 1LWUB 5AVUB 1FZCC 1N73B 2P67A 2K3RA 4GDOA 3H25A 2C9LY 2H88C 4HYTB 4D6TD 4YXWH 1SFCC 5AVWB 2K88A 2B89A 2J58A 2YXRB 4H0LC 2WT7A 5AVSB 2E76C 2FXPA 5EFWB 1AV1A 3KZIH 1LTJB 2FXOA 1YIJP 2IBZE 1SQVE 4PD4I 2FYNC 4N78E 1KC8Q 4H13D 3VOPA 3O6QA 3PJSK 3TDKA 3H1IJ 3D6YA 1L0NE 3HUSB 3L71D 2XZRA 3V2PA 1H0TB 1JY2P 5KJ7A 1RQVA 3B5ND 2V7QH 1DX7A 1XTGB 2BCCD 1EQ7A 3CWBE 5KAFH 3P8CD 2H8PD 1VQ8P 4ZNCA 2PP6A 3CXHH 1GK4A 2W90A 1A02F 4WY4A 1YITP 2QJPB 3AEFC 4H44C 5CCHA 4D6TG 3WUUA 3WUVA 2FXMA 3E7KA 2E74B 5AW7B 2QJKC 3FX0A 1AA0A 1GMJA 2HODA 2A06D 2L91A 3GF7A 2O01J 3I55P 3Q1MA 3VN0A 1DD3A 1EC5A 3H1HE 4RESB 3C9IA 3HTKB 5APTA 2PFXA 1NOHA 3BCCD 3M9HA 2Q3IA 1RE4C 2K9YA 3CD6P 1YTZI 2XNDH 1X8YA 5AVTB 1KILC 1KV4A 1U7JA 2OYOA 3WUTA 3HD7A 1HWTC 2R5DA 2YXQB 3H1JD 2BCCG 1RF1B 1ZV8A 2R32A 4GKGA 2JP3A 3FGAD 1NJIQ 2WSCJ 2SPZA 2B87A 1BGYD 2NPSC 1M1JB 3AE3C 2W8ZA 3AECC 3CXHD 4XA4A 3U1AA 2WSSH 4R4MA 3QH9A 3E1IA 3CCQP 4H13B 4D6TJ 1VQNP 2E75C 1VF5C 2A06G 1IFIA 3L75D 1WT6A 1OVRA 5M1BA 5BU8B 2C0WA 3RK3E 1LWUA 2FYUD 2H89C 4LC1A 5GTIE 3B5NB 3BCCG 1K04A 2J5UA 4XE5B 5CCGD 1AQ5A 3B8EB 3SSUA 1NTMK 1VQLP 1N7SD 1W2EA 3H1JG 4DZOA 1LTJA 1IFPA 1S72P 5KKZC 2BCCJ 3PTZA 3OA7A 2GUSA 1LT9B 2ZVOB 1M8OB 1BGYG 3LW5J 4Z1MH 1USDA 2KXPB 3V2QA 1M7LA 4MN4C 1YJ9P 3N4XA 4DCKA 1D7MA 1U57A 3JC22 3L75G 1Y9BA 1LTAC 1SQPE 3RL0g 1SVFA 1SQQK 2FYUG 4OGQB 2B88A 3SFEC 5KJ7C 3GG2A 2D2CC 3CLQA 2Y9YA 3JCUE 3BCCJ 2KB7P 1FDMA 2E42A 2R5BA 2A45H 1PPJD 1KFNA 3H1JJ 2RH0A 3SWFA 3CL3D 5CCHC 1KYOH 5E79E 2V7QJ 3OJAB 4GODA 4ASVA 4PV1D 1BGYJ 1MFTA 3G6EP 2P7JA 1S9KD 3Q5SA 4IL6H 1FZCA 1NYHA 4HH2A 5TISH 4XFJA 1J1EC 1RE3C 1LTTC 1ZR2A 2HPCA 3IFMA 4L74A 1KQLA 1OVUA 3L71E 2ZFCA 5AW8B 1RF1A 3L75J 5KLVD 5GTHE 1N7SB 4NPFX 5AW5B 3M9QA 2FYUJ 2QG4A 2NRGA 2OYHB 3MP7B 2I8DA 1YQ3C 1L0LD 1SS1A 1PPJG 3CC4P 1JMBA 2YIUC 1OIPA 3A0HH 3RL0B 3EWKA 2G3AA 2N1TD 1Q7YQ 3AEGC 1JOCA 1X9VA 3GF3A 2Q7CA 1KB9H 1VQ7P 2W6BA 3CCVP 1BE3E 1KYOD 2ZT9D 2HLOA 4BWNA 3KPEA 4GIFA 4UB6H 1WMKA 3CXHI 1LTSC 2ZAEB 1LWUC 2KS1B 3H1LD 4RKUJ 1KMIZ 4BRYB 1T6AA 1M56D 2HG5D 2LXCB 5KLVG 2BEQD 3AEDC 4EIJA 2P2UA 1FDOA 1S5LH 1LT9A 1LP1A 3NTNA 2O1KA 3EFGA 3CCRP 3BASA 4I6MC 1SQVK 1LTJC 5AVRB 5C39A 3KQGA 1GL2D 3L4FA 1L0LG 1X22A 1JY3P 1JM0A 4PV1B 2POHA 1KTMA 1ZR4A 1KILA 2I1JA 3CCLP 3CI9A 3HUSC 4OWFA 1EZVG 3C8VA 1HGVA 3KXDA 3U1CA 1FZAA 1KB9D 3G4SP 1JEKA 1R5SA 1Q82Q 2OGUA 3H1LG 2FYZA 4YXDC 1OW8A 3L74G 5CJ4A 3K5BA 2QJPC 3HE4B 3GLMA 1CI6B 1Q81Q 2KSEA 1BSNA 2WVRA 3SWYA 2GM4A 5KAIE 5KLVJ 3LIDA 2E74C 1FZGA 3A2AA 3L37A 4C7NB 1EXJA 2ZXXA 1ZRTE 1AQTA 1QLED 2YMKA 2WWWA 4O9BA 2N9BA 1R5LA 1S4XA 1L0LJ 5DJUB 2XKMA 2ZJSE 1N7LA 1JY2N 1P84H 5B5EH 1JO5A 3CX5H 1YJWP 4ASWA 2KOGA 1RF1C 5BU5A 2HFED 1YQ4C 3P32A 4N3YB 1HJBA 2WSEJ 1OVVA 4W7YA 1M1JC 3H1LJ 3VYIA 4OVNF 5BVZA 1SFCD 1SQXE 1G1JA 3OW2O 3L74J 3IR9A 2JJLA 3OAKA 2KLVA 2E76D 4Y28J 4H13C 1WRGA 1JMMA 1JTHB 1Y47A 2ZVNB 5APYA 3TK1A 2QE7H 2QJYB 4BRYA 3B5NC 1S9KE 4UB8H 2KZIA 3H1KD 2CPSA 1LT1A 1GW4A 3RGUA 3Q5RA 3BRTB 1BCCE 2K9JB 4PD4E 2AXCA 1H8AA 1EZVI 1QVFO 1U7MA 1NTMD 3RK2C 1KYOI 3CX5D 2JEEA 3T97B 3MGNA 1LT9C 3A5TA 1HH0A 3L70D 2Q6QA 1L4AD 1N86A 1NTZE 2WZ7A 1RE3A 1YJNP 1PP9D 1R8EA 3D71A 5AVZB 4JYBA 4EOTA 1T8ZA 4NPEA 3VP8A 3B4SA 1SQPK 1EDIA 4KT0J 1J1DB 1PGQA 5B66E 1NU1D 3V4WA 2E5YA 2WPSA 3E1RA 4PJ0H 5K5GB 3NFQA 2RN0A 1SQQD 3G3ZA 4OGQC 1VQ6P 1MFZA 2IFNA 5AVXB 1DEBA 3H1KG 1GK6A 3HE4A 5AW0B 1CI6A 4Y99B 2Z5IA 2DW3A 3MTUE 3CC2P 4R4LA 4U3FD 3L36A 1DIPA 1NTMG 4C7NA 3TF5A 2E43A 2ZXEB 5H2FE 1KB9I 1NAFA 1E79H 3L73D 1FZBA 1ZMEC 4LLHA 2OYIB 3H1IE 2NPSD 2KP8A 3L70G 3A0BH 2XU6A 5CBOA 1NH4A 3I5CA 2I1KA 3GHGB 1PP9G 1NTKK 3KHUA 4WBAA 1N73A 1RQUA 4WVZA 1AJYA 3W68A 3VTPC 1FDIA 1NU1G 1RY3A 3MHVA 2K37A 3CCSP 2KZJA 4OH8B 1SQQG 3WU2E 3V5BA 1N7SC 1IFDA 1SP4A 1GU5A 3PLNA 1OMIA 4IOIH 2OYHC 4U3FG 3WMM0 3H1KJ 5L8RJ 5CHXA 1T3UA 2O01N 1L4AB 2WSFH 5AVYB 3HUSA 3L73G 3HE5B 1K73Q 1NTMJ 1UIIA 1OW7A 3RL0C 2K1AA 2MKVA 3HRNA 1H0TA 4DJGA 1HVVA 5APXA 3Q3DA 1NU1K 3RBZA 3MUDA 3L70J 3AEEC 2AEFA 3B71A 1YYCA 4TLFA 2K9JA 1PP9J 1YHQP 1VQMP 1N8RQ 2KSJA 2JWDA 1BDDA 4AQRD 3AE9C 3RBXA 1IFNA 2P58A 1FBMA 1S3JA 3F5HA 5APSA 1NU1J 3U59A 1CSBA 5KJ7D 1LTBC 1SQBK 3TSIA 2D2CD 1Q90D 1SQQJ 4D6TE 1IFJA 1H89A 2KNCB 3L35A 1PGPA 2IBZD 1SQVD 2NPSB 2KI7B 3HTKA 2W6AA 3NMDA 1NKZB 4U3FJ 1Q86Q 4WY4D 3TGUD 1P84I 4PV1C 1JY3O 3CX5I 1URQD 3L73J 2AEMA 4I1LA 2GUVA 2WPVB 3VP9A 3BATA 2C9NY 3CWBD 1KQFB 1M1JA 3CCUP 2BCCE 4IFDK 4I7ZB 3P8CE 3H1KE 1RHZB 2OQQA 3GW6A 2AXTE 2ZYDA 2MJZA 2IYPA 3M0DA 1USEA 3TYYA 1MKMA 2WTYA 1JCDA 3HD7D 2XNXA 2FBWC 1NTME 3G71P 1T2KD 2B9BA 5APVA 1JY3N 2IBZG 1SQVG 3L72D 5GTIH 1ZP0C 1EZVD 3B5NA 5DJTB 2A06E 3TGUG 5CJ0A 1RF0A 2Q1KA 3KZIE 3BVHA 3II6A 3MZWB 5AW4B 4CPGA 2FY8A 1GU4A 3BCCE 2IYOA 1PGJA 3O6QB 1N73C 3ABVC 3L74D 1KQGB 3CWBG 2JKVA 1JB0J 4AUWA 1SQQE 3H1JE 4ZMDA 3KYQA 1QL1A 4WWIA 1SQXK 3HE5A 2Y0CA 1HGZA 4I2LC 4U3FE 5KAFE 3FXDA 4LGDE 1BGYE 1FAVA 3MIWA 3IAOA 3CMEP 3CXHE 4JYCA 4WY4B 2A45G 1L0NK 3UIAA 3AE1C 4W7ZA 3L72G 2QVAA 1VQKP 1KZUB 1URQB 3RK3D 4BXLA 1SQVJ 3L75E 1G1IA 2HODB 3JCUH 2QEXP 2QJYC 1JY2O 1VPCA 1CW5A 1S1CX 3IF4A 3TGUJ 2FYUE 3MUDC 2YKQA 2BEZF 1OX3A 2QA4P 1JCCA 3CCMP 1NWQA 3C1LA 1H88A 5E79H 2KNCA 1PV3A 1K8AQ 1AVYA 5AW3B 1PFIA 5AVQB 2RMZA 3HD7B 3CWBJ 1NTZK 4HJGH 3AE7C 2N1TB 5AW2B 4IFMA 2IPPA 1IO4A 1MV8A 1YBKA 1NO4A 3M0AA 1NKNA 2B87B 4K35A 2ZT9B 1W2BO 1OFCX 4EDFA 1MZ9A 5CCGA 1ZN5A 1OWAA 1RH5B 5GTHH 1SQPD 2FFDB 1J1DC 5AW9B 1N7SA 3L72J 1MUUA 3AE8C 3P8MC 2IBZI 3PH0A 4EYYQ 3LW5H 4ZKUA 1NAYA 2NZ2A 2P10A 2OYHA 3R4YA 2LKMA 2QM7A 4Y99C 2H7HA 2M0BA 2M3EA 2KYVA 3SWKA 1GW3A 1KN7A 3USSA 3V2RA 1Z56A 1GL2B 4YPCA 1HBWA 3N7NA 1AVOA 1GDTA 1FC2C 4H0LD 1PPJE 1K05A 1IK9A 3M0DC 2OYIC 2IX7C 1M1KQ 1OW6A 1IC2A 4ZKPA 1LTGC 3PP5A 3RK3B 1CZQA 1K9MQ 3AE5C 3GHGC 1OZHA 1JUNA 2KS1A 1NTKD 3TGUE 2IFMA 4TT3H 1QL2A 4L73A 2A45I 1SQPG 3VMZA 1RF0C 4IFFA 2QRXA 1NGMB 1KFMA 1FZFA 1PZQA 3FWNA 1P84D 3W67A 3VMAA 2OTKE 1FS0E 2JDIH 5KLVE 2JR8A 5APQA 1A02J 4H44D 3RK2D 1VQ5P 2W27A 1L4AC 1L0LE 2M5AB 1URQA 2KLUA 3VMYA 1M90Q 4GOEA 4AYCA 3AEBC 2LXBA 1BE3D 3V6IA 2IDBA 1LGHB 3L72E 2YMYA 2R3CA 1SLQA 1EZVE 2JO1A 1NTKG 1QX8A 1ZXGA 1KYOE 2HR3A 3FWLA 3ITKA 5KLIB 1VQ9P 1FU1A 1KQSO 3L71G 1KILD 5KAIH 1FZCB 3M9BA 1N2DC 2C0XA 5AVVB 3MD0A 3H1LE 4IL6E 1T3JA 5TISE 4OGQD 1SQPJ 3CCEP 2HPCB 1HTLC 1PL5A 5AW1B 3L74E 2ITAA 1LJ2A 2N1TA 1SFCB 1KORA 2WPQA 1SQBD 5CBNA 3LIEA 1FE6A 4H0LB 4DOJA 2E76B 4EI2A 4L76A 2YO3A 2FYNB 2E5TA 3AE6C 4DT0A 2PAJA 2FFDA 2E75D 1VF5D 2N9YB 1BE3G 2Z5HA 4NPDA 1J2JB 3A0HE 1FOSF 2OARA 5CCGC 4IL6X 3M06A 1KB9E 3CC7P 2QIWA 4B86A 1NTKJ 1L2PA 1GL2A 4I7ZC 1YI2P 4WB4A 1EXIA 1GD2E 1VQPP 4UB6E 3L71J 1JTHA 4H44B 3RK2B 3FXEA 1EDKA 3TNUB 1SQBG 1ZW0A 1X0TA 1ZRTD 2KIKA 2QJKB 2AEJA 2YKPA 1LP1B 1S5LE 2Z4EA 1BSHA 1GTWA 1FJPA 2QM8A 2IZ1A 1DEEG 1NVOA 3RL0D 1KD1Q 4C7RA 2Q9IA 1QVGO 3NXSA 4PD4H 3V2NA 3A7OA 1YTZT 1HJ0A 1ZOYC 2Y9ZA 4RO0A 3F89A 1KILB 2P1JA 3T97A 1BE3J 4JF7A 1QEXA 1IJDB 2O3JA 3M91A 1ZLLA 4RJTA 4JQ0D 2W83C 4C46A 1E5WA 1VQOP 3PRJA 3I56P 3CMAP 2Y0EA 2M5AA 3AE4C 2Q3EA 1IFMA 4JPZB 1SQXD 4N78D 1G2CB 3KDPB 3CCJP 3VMXA 3P7KA 2M8RA 4WY4C 1PGOA 5B66H 5CCHD 1L0ND 1LTIC 2E75B 3GMAA 2L5GB 1SQBJ 1VF5B 3IN6A 2CPBA 1QGKB 3A3YB 2Q5UA 1URQC 1FOSE 2KK7A 1LNQA 3EQ2A 2FYUK 2WSEH 1IK7A 2OTJP 4K3AA 2VRSA 4GT1A 1EDLA 1NTKE 4L75A 1FJKA 2YO2A 1BCCD 5H2FH 1S2EA 2FKWB 4PD4D 1SFCA 3H32B 4KHXA 1FZEA 1GZLA 2OYIA 2GA1A 1P84E 1JNMA 5B5EE 1DH3A 3S4RA 5KKZB 3HD7C 4GOFA 1TU3F 3CX5E 2JWAA 1T2KC 5KTBA 1HF9A 1NTZD 3GHGA 2N1TC 4KJMA 2KUBA 1SQXG 1EDJA 2PGDA 1AFOA 3L70E 3H1HD 2WT7B 2O1JA 2WMMA 2BASA 1VL2A 2ZT9C 1L0NG 2LR2A 1PP9E 2HYNA 2YKOA 5APUA 3WU2H 4JBZA 3ZDMA 2RKLA 2FFDC 2ZYGA 2QSIA 4N6JA 1NU1E 3AEAC 2J59M 2UWJE 2R3SA 2O01H
chains in the Genus database with same CATH topology
2K9JA 2M3EA 2KNCA 2K1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9J A;  2M3E A;  2KNC A;  2K1A A; 
#chains in the Genus database with same CATH topology
 3PHL A;  1X79 B;  3S1K A;  1BCC G;  3QWO C;  2D2C B;  1L4A A;  2V4H A;  1UIX A;  3TNU A;  1KIL E;  4UB8 E;  2OTL P;  1GL2 C;  3JSV C;  3V4Q A;  1OXZ A;  3H1I D;  1IZN B;  2XV5 A;  1SQB E;  2WIT A;  3L73 E;  1Y8A A;  4W80 A;  1NTZ G;  4QMA A;  5TJH A;  1XTC C;  3H1H G;  3RK3 C;  2WPR A;  1RE4 A;  1SQX J;  2WSC H;  5APW A;  4U7J A;  1J1E B;  1VDF A;  2XDJ A;  1L0N J;  2WSF J;  3BRV B;  2IZ0 A;  2G8Y A;  3Q5P A;  5KLV K;  1BDC A;  3O8Z A;  3S9O A;  3CPW O;  2NPS A;  3AE2 C;  4PJ0 E;  4YTP C;  1G2C A;  1NHL A;  2YNY A;  2PRR A;  1BCC J;  1L0L K;  2M3B A;  3G9R A;  1M57 D;  1S5L X;  4M3L A;  1VQ4 P;  1HUC A;  1PIX A;  2W6J H;  2YIU B;  3H1I G;  5CMZ A;  2E74 D;  2WQY C;  1Q2N A;  2CK3 H;  5AW6 B;  4A7P A;  3SFD C;  4HB1 A;  3D70 A;  3H6P A;  2H43 A;  1W5C E;  2Y0D A;  1NTZ J;  3Q2Y A;  4HKZ H;  3EFF K;  1DD4 A;  2AXT H;  2ZYA A;  3R2P A;  3H1H J;  5KLI C;  3A0B E;  3H32 A;  2R44 A;  3D6Z A;  1LWU B;  5AVU B;  1FZC C;  1N73 B;  2P67 A;  2K3R A;  4GDO A;  3H25 A;  2C9L Y;  2H88 C;  4HYT B;  4D6T D;  4YXW H;  1SFC C;  5AVW B;  2K88 A;  2B89 A;  2J58 A;  2YXR B;  4H0L C;  2WT7 A;  5AVS B;  2E76 C;  2FXP A;  5EFW B;  1AV1 A;  3KZI H;  1LTJ B;  2FXO A;  1YIJ P;  2IBZ E;  1SQV E;  4PD4 I;  2FYN C;  4N78 E;  1KC8 Q;  4H13 D;  3VOP A;  3O6Q A;  3PJS K;  3TDK A;  3H1I J;  3D6Y A;  1L0N E;  3HUS B;  3L71 D;  2XZR A;  3V2P A;  1H0T B;  1JY2 P;  5KJ7 A;  1RQV A;  3B5N D;  2V7Q H;  1DX7 A;  1XTG B;  2BCC D;  1EQ7 A;  3CWB E;  5KAF H;  3P8C D;  2H8P D;  1VQ8 P;  4ZNC A;  2PP6 A;  3CXH H;  1GK4 A;  2W90 A;  1A02 F;  4WY4 A;  1YIT P;  2QJP B;  3AEF C;  4H44 C;  5CCH A;  4D6T G;  3WUU A;  3WUV A;  2FXM A;  3E7K A;  2E74 B;  5AW7 B;  2QJK C;  3FX0 A;  1AA0 A;  1GMJ A;  2HOD A;  2A06 D;  2L91 A;  3GF7 A;  2O01 J;  3I55 P;  3Q1M A;  3VN0 A;  1DD3 A;  1EC5 A;  3H1H E;  4RES B;  3C9I A;  3HTK B;  5APT A;  2PFX A;  1NOH A;  3BCC D;  3M9H A;  2Q3I A;  1RE4 C;  2K9Y A;  3CD6 P;  1YTZ I;  2XND H;  1X8Y A;  5AVT B;  1KIL C;  1KV4 A;  1U7J A;  2OYO A;  3WUT A;  3HD7 A;  1HWT C;  2R5D A;  2YXQ B;  3H1J D;  2BCC G;  1RF1 B;  1ZV8 A;  2R32 A;  4GKG A;  2JP3 A;  3FGA D;  1NJI Q;  2WSC J;  2SPZ A;  2B87 A;  1BGY D;  2NPS C;  1M1J B;  3AE3 C;  2W8Z A;  3AEC C;  3CXH D;  4XA4 A;  3U1A A;  2WSS H;  4R4M A;  3QH9 A;  3E1I A;  3CCQ P;  4H13 B;  4D6T J;  1VQN P;  2E75 C;  1VF5 C;  2A06 G;  1IFI A;  3L75 D;  1WT6 A;  1OVR A;  5M1B A;  5BU8 B;  2C0W A;  3RK3 E;  1LWU A;  2FYU D;  2H89 C;  4LC1 A;  5GTI E;  3B5N B;  3BCC G;  1K04 A;  2J5U A;  4XE5 B;  5CCG D;  1AQ5 A;  3B8E B;  3SSU A;  1NTM K;  1VQL P;  1N7S D;  1W2E A;  3H1J G;  4DZO A;  1LTJ A;  1IFP A;  1S72 P;  5KKZ C;  2BCC J;  3PTZ A;  3OA7 A;  2GUS A;  1LT9 B;  2ZVO B;  1M8O B;  1BGY G;  3LW5 J;  4Z1M H;  1USD A;  2KXP B;  3V2Q A;  1M7L A;  4MN4 C;  1YJ9 P;  3N4X A;  4DCK A;  1D7M A;  1U57 A;  3JC2 2;  3L75 G;  1Y9B A;  1LTA C;  1SQP E;  3RL0 g;  1SVF A;  1SQQ K;  2FYU G;  4OGQ B;  2B88 A;  3SFE C;  5KJ7 C;  3GG2 A;  2D2C C;  3CLQ A;  2Y9Y A;  3JCU E;  3BCC J;  2KB7 P;  1FDM A;  2E42 A;  2R5B A;  2A45 H;  1PPJ D;  1KFN A;  3H1J J;  2RH0 A;  3SWF A;  3CL3 D;  5CCH C;  1KYO H;  5E79 E;  2V7Q J;  3OJA B;  4GOD A;  4ASV A;  4PV1 D;  1BGY J;  1MFT A;  3G6E P;  2P7J A;  1S9K D;  3Q5S A;  4IL6 H;  1FZC A;  1NYH A;  4HH2 A;  5TIS H;  4XFJ A;  1J1E C;  1RE3 C;  1LTT C;  1ZR2 A;  2HPC A;  3IFM A;  4L74 A;  1KQL A;  1OVU A;  3L71 E;  2ZFC A;  5AW8 B;  1RF1 A;  3L75 J;  5KLV D;  5GTH E;  1N7S B;  4NPF X;  5AW5 B;  3M9Q A;  2FYU J;  2QG4 A;  2NRG A;  2OYH B;  3MP7 B;  2I8D A;  1YQ3 C;  1L0L D;  1SS1 A;  1PPJ G;  3CC4 P;  1JMB A;  2YIU C;  1OIP A;  3A0H H;  3RL0 B;  3EWK A;  2G3A A;  2N1T D;  1Q7Y Q;  3AEG C;  1JOC A;  1X9V A;  3GF3 A;  2Q7C A;  1KB9 H;  1VQ7 P;  2W6B A;  3CCV P;  1BE3 E;  1KYO D;  2ZT9 D;  2HLO A;  4BWN A;  3KPE A;  4GIF A;  4UB6 H;  1WMK A;  3CXH I;  1LTS C;  2ZAE B;  1LWU C;  2KS1 B;  3H1L D;  4RKU J;  1KMI Z;  4BRY B;  1T6A A;  1M56 D;  2HG5 D;  2LXC B;  5KLV G;  2BEQ D;  3AED C;  4EIJ A;  2P2U A;  1FDO A;  1S5L H;  1LT9 A;  1LP1 A;  3NTN A;  2O1K A;  3EFG A;  3CCR P;  3BAS A;  4I6M C;  1SQV K;  1LTJ C;  5AVR B;  5C39 A;  3KQG A;  1GL2 D;  3L4F A;  1L0L G;  1X22 A;  1JY3 P;  1JM0 A;  4PV1 B;  2POH A;  1KTM A;  1ZR4 A;  1KIL A;  2I1J A;  3CCL P;  3CI9 A;  3HUS C;  4OWF A;  1EZV G;  3C8V A;  1HGV A;  3KXD A;  3U1C A;  1FZA A;  1KB9 D;  3G4S P;  1JEK A;  1R5S A;  1Q82 Q;  2OGU A;  3H1L G;  2FYZ A;  4YXD C;  1OW8 A;  3L74 G;  5CJ4 A;  3K5B A;  2QJP C;  3HE4 B;  3GLM A;  1CI6 B;  1Q81 Q;  2KSE A;  1BSN A;  2WVR A;  3SWY A;  2GM4 A;  5KAI E;  5KLV J;  3LID A;  2E74 C;  1FZG A;  3A2A A;  3L37 A;  4C7N B;  1EXJ A;  2ZXX A;  1ZRT E;  1AQT A;  1QLE D;  2YMK A;  2WWW A;  4O9B A;  2N9B A;  1R5L A;  1S4X A;  1L0L J;  5DJU B;  2XKM A;  2ZJS E;  1N7L A;  1JY2 N;  1P84 H;  5B5E H;  1JO5 A;  3CX5 H;  1YJW P;  4ASW A;  2KOG A;  1RF1 C;  5BU5 A;  2HFE D;  1YQ4 C;  3P32 A;  4N3Y B;  1HJB A;  2WSE J;  1OVV A;  4W7Y A;  1M1J C;  3H1L J;  3VYI A;  4OVN F;  5BVZ A;  1SFC D;  1SQX E;  1G1J A;  3OW2 O;  3L74 J;  3IR9 A;  2JJL A;  3OAK A;  2KLV A;  2E76 D;  4Y28 J;  4H13 C;  1WRG A;  1JMM A;  1JTH B;  1Y47 A;  2ZVN B;  5APY A;  3TK1 A;  2QE7 H;  2QJY B;  4BRY A;  3B5N C;  1S9K E;  4UB8 H;  2KZI A;  3H1K D;  2CPS A;  1LT1 A;  1GW4 A;  3RGU A;  3Q5R A;  3BRT B;  1BCC E;  2K9J B;  4PD4 E;  2AXC A;  1H8A A;  1EZV I;  1QVF O;  1U7M A;  1NTM D;  3RK2 C;  1KYO I;  3CX5 D;  2JEE A;  3T97 B;  3MGN A;  1LT9 C;  3A5T A;  1HH0 A;  3L70 D;  2Q6Q A;  1L4A D;  1N86 A;  1NTZ E;  2WZ7 A;  1RE3 A;  1YJN P;  1PP9 D;  1R8E A;  3D71 A;  5AVZ B;  4JYB A;  4EOT A;  1T8Z A;  4NPE A;  3VP8 A;  3B4S A;  1SQP K;  1EDI A;  4KT0 J;  1J1D B;  1PGQ A;  5B66 E;  1NU1 D;  3V4W A;  2E5Y A;  2WPS A;  3E1R A;  4PJ0 H;  5K5G B;  3NFQ A;  2RN0 A;  1SQQ D;  3G3Z A;  4OGQ C;  1VQ6 P;  1MFZ A;  2IFN A;  5AVX B;  1DEB A;  3H1K G;  1GK6 A;  3HE4 A;  5AW0 B;  1CI6 A;  4Y99 B;  2Z5I A;  2DW3 A;  3MTU E;  3CC2 P;  4R4L A;  4U3F D;  3L36 A;  1DIP A;  1NTM G;  4C7N A;  3TF5 A;  2E43 A;  2ZXE B;  5H2F E;  1KB9 I;  1NAF A;  1E79 H;  3L73 D;  1FZB A;  1ZME C;  4LLH A;  2OYI B;  3H1I E;  2NPS D;  2KP8 A;  3L70 G;  3A0B H;  2XU6 A;  5CBO A;  1NH4 A;  3I5C A;  2I1K A;  3GHG B;  1PP9 G;  1NTK K;  3KHU A;  4WBA A;  1N73 A;  1RQU A;  4WVZ A;  1AJY A;  3W68 A;  3VTP C;  1FDI A;  1NU1 G;  1RY3 A;  3MHV A;  2K37 A;  3CCS P;  2KZJ A;  4OH8 B;  1SQQ G;  3WU2 E;  3V5B A;  1N7S C;  1IFD A;  1SP4 A;  1GU5 A;  3PLN A;  1OMI A;  4IOI H;  2OYH C;  4U3F G;  3WMM 0;  3H1K J;  5L8R J;  5CHX A;  1T3U A;  2O01 N;  1L4A B;  2WSF H;  5AVY B;  3HUS A;  3L73 G;  3HE5 B;  1K73 Q;  1NTM J;  1UII A;  1OW7 A;  3RL0 C;  2K1A A;  2MKV A;  3HRN A;  1H0T A;  4DJG A;  1HVV A;  5APX A;  3Q3D A;  1NU1 K;  3RBZ A;  3MUD A;  3L70 J;  3AEE C;  2AEF A;  3B71 A;  1YYC A;  4TLF A;  2K9J A;  1PP9 J;  1YHQ P;  1VQM P;  1N8R Q;  2KSJ A;  2JWD A;  1BDD A;  4AQR D;  3AE9 C;  3RBX A;  1IFN A;  2P58 A;  1FBM A;  1S3J A;  3F5H A;  5APS A;  1NU1 J;  3U59 A;  1CSB A;  5KJ7 D;  1LTB C;  1SQB K;  3TSI A;  2D2C D;  1Q90 D;  1SQQ J;  4D6T E;  1IFJ A;  1H89 A;  2KNC B;  3L35 A;  1PGP A;  2IBZ D;  1SQV D;  2NPS B;  2KI7 B;  3HTK A;  2W6A A;  3NMD A;  1NKZ B;  4U3F J;  1Q86 Q;  4WY4 D;  3TGU D;  1P84 I;  4PV1 C;  1JY3 O;  3CX5 I;  1URQ D;  3L73 J;  2AEM A;  4I1L A;  2GUV A;  2WPV B;  3VP9 A;  3BAT A;  2C9N Y;  3CWB D;  1KQF B;  1M1J A;  3CCU P;  2BCC E;  4IFD K;  4I7Z B;  3P8C E;  3H1K E;  1RHZ B;  2OQQ A;  3GW6 A;  2AXT E;  2ZYD A;  2MJZ A;  2IYP A;  3M0D A;  1USE A;  3TYY A;  1MKM A;  2WTY A;  1JCD A;  3HD7 D;  2XNX A;  2FBW C;  1NTM E;  3G71 P;  1T2K D;  2B9B A;  5APV A;  1JY3 N;  2IBZ G;  1SQV G;  3L72 D;  5GTI H;  1ZP0 C;  1EZV D;  3B5N A;  5DJT B;  2A06 E;  3TGU G;  5CJ0 A;  1RF0 A;  2Q1K A;  3KZI E;  3BVH A;  3II6 A;  3MZW B;  5AW4 B;  4CPG A;  2FY8 A;  1GU4 A;  3BCC E;  2IYO A;  1PGJ A;  3O6Q B;  1N73 C;  3ABV C;  3L74 D;  1KQG B;  3CWB G;  2JKV A;  1JB0 J;  4AUW A;  1SQQ E;  3H1J E;  4ZMD A;  3KYQ A;  1QL1 A;  4WWI A;  1SQX K;  3HE5 A;  2Y0C A;  1HGZ A;  4I2L C;  4U3F E;  5KAF E;  3FXD A;  4LGD E;  1BGY E;  1FAV A;  3MIW A;  3IAO A;  3CME P;  3CXH E;  4JYC A;  4WY4 B;  2A45 G;  1L0N K;  3UIA A;  3AE1 C;  4W7Z A;  3L72 G;  2QVA A;  1VQK P;  1KZU B;  1URQ B;  3RK3 D;  4BXL A;  1SQV J;  3L75 E;  1G1I A;  2HOD B;  3JCU H;  2QEX P;  2QJY C;  1JY2 O;  1VPC A;  1CW5 A;  1S1C X;  3IF4 A;  3TGU J;  2FYU E;  3MUD C;  2YKQ A;  2BEZ F;  1OX3 A;  2QA4 P;  1JCC A;  3CCM P;  1NWQ A;  3C1L A;  1H88 A;  5E79 H;  2KNC A;  1PV3 A;  1K8A Q;  1AVY A;  5AW3 B;  1PFI A;  5AVQ B;  2RMZ A;  3HD7 B;  3CWB J;  1NTZ K;  4HJG H;  3AE7 C;  2N1T B;  5AW2 B;  4IFM A;  2IPP A;  1IO4 A;  1MV8 A;  1YBK A;  1NO4 A;  3M0A A;  1NKN A;  2B87 B;  4K35 A;  2ZT9 B;  1W2B O;  1OFC X;  4EDF A;  1MZ9 A;  5CCG A;  1ZN5 A;  1OWA A;  1RH5 B;  5GTH H;  1SQP D;  2FFD B;  1J1D C;  5AW9 B;  1N7S A;  3L72 J;  1MUU A;  3AE8 C;  3P8M C;  2IBZ I;  3PH0 A;  4EYY Q;  3LW5 H;  4ZKU A;  1NAY A;  2NZ2 A;  2P10 A;  2OYH A;  3R4Y A;  2LKM A;  2QM7 A;  4Y99 C;  2H7H A;  2M0B A;  2M3E A;  2KYV A;  3SWK A;  1GW3 A;  1KN7 A;  3USS A;  3V2R A;  1Z56 A;  1GL2 B;  4YPC A;  1HBW A;  3N7N A;  1AVO A;  1GDT A;  1FC2 C;  4H0L D;  1PPJ E;  1K05 A;  1IK9 A;  3M0D C;  2OYI C;  2IX7 C;  1M1K Q;  1OW6 A;  1IC2 A;  4ZKP A;  1LTG C;  3PP5 A;  3RK3 B;  1CZQ A;  1K9M Q;  3AE5 C;  3GHG C;  1OZH A;  1JUN A;  2KS1 A;  1NTK D;  3TGU E;  2IFM A;  4TT3 H;  1QL2 A;  4L73 A;  2A45 I;  1SQP G;  3VMZ A;  1RF0 C;  4IFF A;  2QRX A;  1NGM B;  1KFM A;  1FZF A;  1PZQ A;  3FWN A;  1P84 D;  3W67 A;  3VMA A;  2OTK E;  1FS0 E;  2JDI H;  5KLV E;  2JR8 A;  5APQ A;  1A02 J;  4H44 D;  3RK2 D;  1VQ5 P;  2W27 A;  1L4A C;  1L0L E;  2M5A B;  1URQ A;  2KLU A;  3VMY A;  1M90 Q;  4GOE A;  4AYC A;  3AEB C;  2LXB A;  1BE3 D;  3V6I A;  2IDB A;  1LGH B;  3L72 E;  2YMY A;  2R3C A;  1SLQ A;  1EZV E;  2JO1 A;  1NTK G;  1QX8 A;  1ZXG A;  1KYO E;  2HR3 A;  3FWL A;  3ITK A;  5KLI B;  1VQ9 P;  1FU1 A;  1KQS O;  3L71 G;  1KIL D;  5KAI H;  1FZC B;  3M9B A;  1N2D C;  2C0X A;  5AVV B;  3MD0 A;  3H1L E;  4IL6 E;  1T3J A;  5TIS E;  4OGQ D;  1SQP J;  3CCE P;  2HPC B;  1HTL C;  1PL5 A;  5AW1 B;  3L74 E;  2ITA A;  1LJ2 A;  2N1T A;  1SFC B;  1KOR A;  2WPQ A;  1SQB D;  5CBN A;  3LIE A;  1FE6 A;  4H0L B;  4DOJ A;  2E76 B;  4EI2 A;  4L76 A;  2YO3 A;  2FYN B;  2E5T A;  3AE6 C;  4DT0 A;  2PAJ A;  2FFD A;  2E75 D;  1VF5 D;  2N9Y B;  1BE3 G;  2Z5H A;  4NPD A;  1J2J B;  3A0H E;  1FOS F;  2OAR A;  5CCG C;  4IL6 X;  3M06 A;  1KB9 E;  3CC7 P;  2QIW A;  4B86 A;  1NTK J;  1L2P A;  1GL2 A;  4I7Z C;  1YI2 P;  4WB4 A;  1EXI A;  1GD2 E;  1VQP P;  4UB6 E;  3L71 J;  1JTH A;  4H44 B;  3RK2 B;  3FXE A;  1EDK A;  3TNU B;  1SQB G;  1ZW0 A;  1X0T A;  1ZRT D;  2KIK A;  2QJK B;  2AEJ A;  2YKP A;  1LP1 B;  1S5L E;  2Z4E A;  1BSH A;  1GTW A;  1FJP A;  2QM8 A;  2IZ1 A;  1DEE G;  1NVO A;  3RL0 D;  1KD1 Q;  4C7R A;  2Q9I A;  1QVG O;  3NXS A;  4PD4 H;  3V2N A;  3A7O A;  1YTZ T;  1HJ0 A;  1ZOY C;  2Y9Z A;  4RO0 A;  3F89 A;  1KIL B;  2P1J A;  3T97 A;  1BE3 J;  4JF7 A;  1QEX A;  1IJD B;  2O3J A;  3M91 A;  1ZLL A;  4RJT A;  4JQ0 D;  2W83 C;  4C46 A;  1E5W A;  1VQO P;  3PRJ A;  3I56 P;  3CMA P;  2Y0E A;  2M5A A;  3AE4 C;  2Q3E A;  1IFM A;  4JPZ B;  1SQX D;  4N78 D;  1G2C B;  3KDP B;  3CCJ P;  3VMX A;  3P7K A;  2M8R A;  4WY4 C;  1PGO A;  5B66 H;  5CCH D;  1L0N D;  1LTI C;  2E75 B;  3GMA A;  2L5G B;  1SQB J;  1VF5 B;  3IN6 A;  2CPB A;  1QGK B;  3A3Y B;  2Q5U A;  1URQ C;  1FOS E;  2KK7 A;  1LNQ A;  3EQ2 A;  2FYU K;  2WSE H;  1IK7 A;  2OTJ P;  4K3A A;  2VRS A;  4GT1 A;  1EDL A;  1NTK E;  4L75 A;  1FJK A;  2YO2 A;  1BCC D;  5H2F H;  1S2E A;  2FKW B;  4PD4 D;  1SFC A;  3H32 B;  4KHX A;  1FZE A;  1GZL A;  2OYI A;  2GA1 A;  1P84 E;  1JNM A;  5B5E E;  1DH3 A;  3S4R A;  5KKZ B;  3HD7 C;  4GOF A;  1TU3 F;  3CX5 E;  2JWA A;  1T2K C;  5KTB A;  1HF9 A;  1NTZ D;  3GHG A;  2N1T C;  4KJM A;  2KUB A;  1SQX G;  1EDJ A;  2PGD A;  1AFO A;  3L70 E;  3H1H D;  2WT7 B;  2O1J A;  2WMM A;  2BAS A;  1VL2 A;  2ZT9 C;  1L0N G;  2LR2 A;  1PP9 E;  2HYN A;  2YKO A;  5APU A;  3WU2 H;  4JBZ A;  3ZDM A;  2RKL A;  2FFD C;  2ZYG A;  2QSI A;  4N6J A;  1NU1 E;  3AEA C;  2J59 M;  2UWJ E;  2R3S A;  2O01 H; 
#chains in the Genus database with same CATH homology
 2K9J A;  2M3E A;  2KNC A;  2K1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...