2K9JA

Integrin alphaiib-beta3 transmembrane complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
42
structure length
42
Chain Sequence
GALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb light chain
publication title The structure of the integrin alphaIIbbeta3 transmembrane complex explains integrin transmembrane signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 11
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2008-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.930 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bicelle-embedded integrin alpha(iib) transmembrane segment 2k9jA00
2M3EA 2K1AA 2K9JA 2KNCA
chains in the Genus database with same CATH superfamily
2E76B 3CWBD 5AW5B 5B66H 3U1AA 5AW2B 3MUDC 4RKUJ 2QG4A 3C9IA 1KQGB 4HH2A 2E5YA 2I1JA 3KDPB 1JNMA 1LWUC 1BCCD 3GHGC 1BE3J 2M5AB 1IO4A 3L75D 2Q5UA 1SQQJ 3FXDA 3CXHE 1VDFA 1N7SB 2L91A 1BGYE 2OTKE 2QEXP 3H1LG 4WY4B 3CCVP 2KYVA 1VQPP 2E5TA 3NMDA 2KNCA 3RK3D 3M9QA 2HODA 3RBZA 1KYOI 4ZKPA 4PJ0E 3Q5PA 3JSVC 1UIXA 1M7LA 1SS1A 3AE5C 4AYCA 2QJPC 1SQBE 2KSEA 1NYHA 5AVTB 4TLFA 4O9BA 1JEKA 1L0NG 3SWFA 3AEFC 5KAFE 2BCCD 2FYUG 2WT7B 2ITAA 1JMBA 3FXEA 1N73B 4NPFX 1L0LG 1S9KD 3L74D 1NAFA 3PHLA 1YQ4C 4C7NB 3CD6P 2UWJE 3KZIH 3CCLP 2A06D 2IPPA 2V4HA 2DW3A 3A0BE 3V2NA 4PV1D 1KTMA 3CC7P 3MHVA 3H6PA 1OVUA 1BGYJ 1SQPD 1EZVI 3GG2A 1Z56A 3C1LA 1EDJA 3PJSK 1Q82Q 3AE6C 1X9VA 4L76A 4XA4A 4IFDK 1KORA 1W2EA 1KQSO 3HE4A 2LXCB 2E76C 2HPCB 4HYTB 1OW6A 3JCUE 1L4AA 3HD7A 2YKQA 1AFOA 4GT1A 2R5DA 2E74B 1FU1A 4PD4E 1SQBJ 1Y47A 2O01N 3II6A 2HLOA 1JY2N 1P84D 1AVYA 3D71A 3CPWO 2Q1KA 3CX5E 1N7SC 1G2CA 1GK4A 1N7SD 1RH5B 2KS1B 2XDJA 2WTYA 3L70E 1JY2O 1JB0J 3AEEC 2E42A 2I1KA 5AVXB 4WY4C 3CCEP 2FBWC 4H13C 1GTWA 4H13D 5KJ7C 2R44A 4RESB 1RE3A 3SWKA 2XNXA 2IBZE 1WMKA 1LTIC 2N1TA 3FWNA 2P58A 3VP9A 1NTKG 1DD3A 1CI6B 1IFDA 3WMM0 3A3YB 1KQLA 5CCHD 1OW8A 2BEQD 1K9MQ 2KZJA 1DH3A 2NPSB 2W6JH 4ZNCA 5AW0B 1KILD 1L0LJ 5APWA 3CCMP 1PV3A 4WVZA 3H1KG 4JYCA 1N73C 2ZVNB 3M0DC 3RL0g 5EFWB 3MD0A 1OFCX 1OXZA 1DIPA 1VPCA 1YJ9P 3K5BA 1E79H 1DEBA 3H1IG 3GW6A 4D6TG 1AQ5A 3U1CA 2HG5D 3ABVC 2CPSA 1FZBA 1SQVE 3L70J 2P67A 4UB6E 4NPEA 4I6MC 1L4AB 1PPJD 4RO0A 1M56D 3CMEP 4C7RA 1LTBC 3RK2B 3AE7C 1S2EA 3OJAB 3V4QA 4GIFA 2RKLA 1DX7A 2ZAEB 1G2CB 2CPBA 1S5LE 2E74C 3CMAP 2K9JA 1VQKP 3CWBG 3IR9A 1KYOE 3ITKA 1LTAC 3M91A 2D2CB 3FX0A 2IDBA 3U59A 2O3JA 1CSBA 4OH8B 3SWYA 3L75G 2KZIA 4K3AA 1EZVG 2W6AA 1FBMA 5TJHA 2Y0EA 3L72D 1NTZD 1SVFA 4DCKA 1Q86Q 3A5TA 1NVOA 1VQ5P 1VL2A 3FGAD 1GW3A 1MUUA 3TSIA 1PGJA 3JC22 2A45G 2KB7P 1K73Q 1SQVJ 2R3CA 1EDLA 1KB9H 2WPQA 3EFFK 1N7LA 2K3RA 1H89A 1YI2P 2OYIB 1J1EB 1YIJP 3CCSP 1ZRTE 1N8RQ 2NPSC 3I55P 1VQOP 1D7MA 4JQ0D 1KMIZ 2PFXA 1J2JB 1EZVE 5CJ4A 1NTZK 1A02F 2GUSA 3AE4C 3P8CD 4HKZH 2PRRA 4WBAA 2BCCG 2FXOA 4KT0J 1NGMB 3H1HE 1HH0A 1EC5A 1GD2E 3L74G 3RK3E 2A45H 4EOTA 2M5AA 2B87B 2IFMA 3CI9A 2BEZF 2W6BA 1IFMA 1R5LA 2LKMA 1QL2A 1KFNA 2O01H 2RN0A 1L4AC 1NHLA 2ZT9C 1L4AD 2ZT9D 3HD7D 2A06G 2Z5HA 2CK3H 2NZ2A 2WITA 5C39A 3RK2C 1SQPG 4WY4A 2GA1A 3BCCD 1JY3N 5KJ7A 4U3FD 2WSFJ 3KYQA 2FYZA 1JY3O 2IYOA 4L73A 5APUA 2IFNA 1ZLLA 5KLVD 1VQ7P 2D2CC 2D2CD 4GOFA 1PP9G 1FJKA 1RE3C 5KTBA 3IF4A 1YITP 2OYHB 1SQXG 1LTSC 2N1TD 1W5CE 3VOPA 2WT7A 3SFEC 2JKVA 5AW7B 3CC4P 4W7YA 1GK6A 2B89A 1N73A 3H1HJ 1NTMD 2Z5IA 1HGVA 1S4XA 1VF5B 1RE4C 3CCRP 1M1KQ 4UB8E 2JO1A 1EQ7A 1R8EA 2Q9IA 3PH0A 5APQA 4WB4A 4C7NA 3B71A 1ZR2A 2OYIC 5KLVK 5B66E 1GL2A 1T3UA 1PP9E 1N86A 2M8RA 2W83C 1SQXE 1NU1G 2JEEA 1ZOYC 3L73E 1OZHA 1RHZB 5KAIE 4JF7A 1JY2P 1P84H 1NTMK 2HPCA 4NPDA 3L71D 3IN6A 1KV4A 4Y99C 5KAIH 4DZOA 1M90Q 1YJWP 5K5GB 3B8EB 2FY8A 4L75A 1LGHB 3NTNA 1OVRA 3VMZA 4KJMA 2WPVB 1NKNA 1WRGA 5CCGC 2POHA 3TGUE 2GUVA 2KS1A 1NU1E 5L8RJ 2WSSH 1HJBA 5TISH 3PP5A 3A0HH 3H1JD 3D6YA 1PFIA 2K1AA 1HVVA 2IZ0A 2OTJP 1PL5A 1FS0E 1YTZT 1PP9J 2JDIH 1MZ9A 4QMAA 3VMXA 1W2BO 1CI6A 1SQXJ 3H1LE 1LT1A 2N9YB 5AVVB 1GU5A 2OYHC 3L73J 4MN4C 1VQ4P 1KB9I 5H2FH 3G6EP 2NPSA 2P10A 3WUUA 1JOCA 3KZIE 3BATA 1VQ6P 3EQ2A 1X22A 2YXRB 1BE3D 1VF5C 1GL2B 5DJTB 3L72G 2WVRA 1SQQD 1ZW0A 1M57D 4CPGA 1L0NE 2FYUE 3TGUJ 2K37A 1FDOA 4EYYQ 1HF9A 1NU1J 1ZV8A 1NAYA 3VMYA 2C0WA 1L0LE 3T97B 3BVHA 2E76D 1MKMA 2A45I 5AVWB 3BASA 1YTZI 4BXLA 2KOGA 1NOHA 1J1DB 2XZRA 4I7ZB 1H0TB 3Q5RA 1T2KC 2PP6A 1T2KD 1QLED 4A7PA 2JWAA 3TK1A 3E1IA 3LIDA 1QEXA 4W7ZA 3M9HA 1SQQK 1QVFO 3H1LJ 2E43A 2OQQA 3AE9C 3B5NA 2WQYC 4OGQB 2QRXA 4WY4D 1OX3A 1U7MA 3TNUB 1G1JA 1M1JB 5KJ7D 2ZXXA 1QX8A 3TYYA 2NRGA 3Q3DA 3N4XA 2KK7A 3OAKA 1ZR4A 5E79H 3CXHD 1EDKA 2AXTH 3I5CA 1L0NJ 2KI7B 2FYUJ 2ZYAA 1VQ9P 1NH4A 1BGYD 1RE4A 5B5EH 3O6QB 3M06A 3BCCG 3HE5B 2QJKB 3MGNA 1FZCB 4U3FG 3UIAA 2OYIA 3V2RA 1NO4A 2H43A 4N78E 3HRNA 4H44B 4BRYB 1FOSE 2B88A 3QWOC 5KLVG 1VQMP 3V2QA 3CC2P 2P2UA 1FZFA 2R32A 2WMMA 1NTKE 4GDOA 2W90A 1NWQA 1IFNA 1GL2C 4C46A 1SQBD 2KSJA 1QGKB 3L36A 3P7KA 3F5HA 2J58A 4N3YB 1XTGB 3CCJP 3CL3D 3BCCE 1P84I 2HYNA 1NTMG 4W80A 3R4YA 3H25A 1DEEG 4JPZB 2B87A 3H1KE 4IOIH 1KD1Q 5GTHH 2IYPA 1JCDA 1JY3P 5CCGA 2GM4A 3TDKA 1J1DC 4I7ZC 2WWWA 2YKPA 3RL0B 3AE1C 3H1IE 1T3JA 3B5NB 2E74D 4D6TE 1BDDA 1SQBK 2KUBA 4LLHA 2KIKA 2QSIA 1BDCA 5KLIB 2IX7C 1K05A 3LIEA 1BCCG 4IFFA 2PGDA 3L71G 4OGQC 3G4SP 3NFQA 1AVOA 1M1JC 3Q5SA 2OYHA 1NTKJ 1YBKA 1KB9E 2XV5A 3R2PA 4PD4D 1X79B 5AW6B 3V2PA 1FOSF 1EXJA 1LNQA 1IK7A 2E75B 1S5LX 3CWBE 3S4RA 3MZWB 4LGDE 3CX5D 2KP8A 3LW5H 1A02J 3BCCJ 3L70D 5CMZA 2QIWA 1LTGC 2YO3A 4GKGA 5GTIH 1BCCE 3GF3A 3H1JG 2RMZA 2NPSD 1Q81Q 4OVNF 3H1KJ 3L75E 1FZCC 1L0LK 3ZDMA 2IBZD 4H44C 3CCUP 1SFCB 1RF0C 3H1IJ 4ASVA 4D6TJ 4EI2A 4IL6H 4JBZA 4DJGA 2KLVA 1S3JA 1G1IA 1S72P 3S1KA 4OWFA 3IAOA 1IFJA 1PGOA 1LWUB 1JM0A 3I56P 1ZN5A 1FDMA 1AV1A 4IL6X 1BE3G 4ASWA 1JTHA 1R5SA 2YXQB 1SQQG 2WSCH 1H8AA 3RK2D 2AEJA 3AE2C 2ZVOB 2KXPB 3AEGC 2BCCE 2M3EA 3PTZA 3H32B 2FXMA 3CWBJ 3RK3B 3B5NC 3B5ND 1HUCA 1SQVD 1VQNP 1S9KE 3L74E 1LTTC 4WWIA 1GU4A 3WUVA 1RQVA 1X0TA 1BCCJ 3RGUA 5KLIC 3L75J 5CBNA 2A06E 4HJGH 1MFZA 4H0LB 2HFED 1SQPE 3E1RA 3MIWA 1L2PA 3USSA 1USEA 2SPZA 2MKVA 3HTKA 2Q3IA 1LT9B 3M0AA 2QE7H 2O01J 2W27A 2ZFCA 5BU5A 1ZMEC 1KYOD 1PGPA 1TU3F 2I8DA 1USDA 1SQVK 2E75C 2LXBA 4R4LA 2XU6A 1K04A 2WSCJ 1J1EC 3E7KA 3GLMA 3G9RA 4PV1B 2FXPA 3A2AA 2P7JA 2G3AA 1HTLC 1KZUB 5KKZB 1P84E 2BCCJ 1SP4A 1GDTA 1BGYG 1SFCC 1T6AA 2AEFA 3T97A 5AW4B 5APTA 1FZGA 3L74J 3V5BA 1U7JA 1FJPA 1H0TA 5APYA 1LP1B 1GZLA 1JTHB 1ZRTD 3EFGA 2JWDA 4I1LA 2FFDB 2QJYB 1SLQA 2G8YA 1NKZB 1WT6A 1EZVD 1XTCC 5CCGD 3A7OA 1KQFB 1PZQA 1SQPJ 2YMYA 5TISE 1SQBG 3A0HE 2W8ZA 4HB1A 1X8YA 3AEAC 1S1CX 3CXHH 3TNUA 1PPJG 3H1HD 2C9NY 1KILE 1M1JA 1GW4A 4H13B 2WPSA 3KPEA 1Y9BA 3RK3C 2Y0CA 3L4FA 3M9BA 2K9YA 3Q1MA 1IK9A 3W68A 2H88C 5H2FE 3SFDC 5BVZA 4I2LC 2H89C 3HTKB 4ZMDA 1KFMA 4PJ0H 1LTJB 3O6QA 4H0LC 4TT3H 4H0LD 5BU8B 2QM7A 3HE5A 1FZCA 1KILB 2PAJA 3GF7A 3HUSB 3KQGA 1MV8A 3IFMA 1LT9C 1PPJE 2Z4EA 4BRYA 1YHQP 1VF5D 5KAFH 1VQ8P 1NTZG 1BSNA 1RF0A 1VQLP 2OYOA 3KHUA 1FAVA 4EDFA 3EWKA 4RJTA 2M3BA 4PV1C 1EXIA 1PGQA 4R4MA 2FKWB 1IJDB 5AVSB 1IZNB 1JMMA 5KKZC 2C0XA 3VTPC 4YXWH 1M8OB 3A0BH 3L70G 2LR2A 3V6IA 1CW5A 3F89A 3MTUE 3L72E 1NTZE 2Q6QA 2IBZG 1OIPA 1PP9D 2FFDC 4L74A 3JCUH 1U57A 2QJYC 3OA7A 1SQXD 1OW7A 2YIUB 3GMAA 2WPRA 3L73D 1JCCA 1SQPK 5CBOA 2KNCB 4PD4H 2Q7CA 2L5GB 5E79E 2AXTE 1FE6A 2HODB 3CX5H 3L37A 5B5EE 1IFIA 3BRVB 3KXDA 4AUWA 3P8CE 2XKMA 3Q2YA 1GMJA 3TGUD 5APVA 1SQXK 2ZYDA 1RF1A 1NU1D 4YTPC 5CCHC 1SQVG 1LTJC 3SSUA 5AVQB 4GODA 2YO2A 4K35A 2WSEH 1KILC 3HUSC 1URQA 1OWAA 4DOJA 2BASA 3L72J 1NTZJ 3N7NA 4U7JA 5DJUB 5AVRB 1GL2D 1SFCA 3AEBC 3AEDC 1FDIA 2K88A 3H1LD 3P8MC 1ZP0C 3MUDA 5GTHE 1QVGO 4U3FE 1RY3A 3FWLA 5CJ0A 1LWUA 1NU1K 2OGUA 3GHGA 2B9BA 3HE4B 1IC2A 1UIIA 1Q90D 3AE3C 4DT0A 5KLVE 3TF5A 2J5UA 2ZT9B 3WU2E 2H8PD 3HD7B 3PLNA 2RH0A 3CCQP 2KLUA 4UB6H 1YYCA 3WU2H 2V7QH 5AVYB 2Q3EA 3H32A 1L0ND 4LC1A 3CXHI 2FYUD 5APSA 1E5WA 1K8AQ 1HWTC 2JR8A 1NTME 1YJNP 2WSEJ 4XFJA 4OGQD 3WUTA 1L0LD 1EDIA 1MFTA 2N9BA 1N2DC 2YIUC 1S5LH 1T8ZA 5AW9B 1FC2C 1PIXA 2JJLA 5M1BA 1KYOH 3D70A 3B4SA 2N1TB 2FYNB 3AE8C 2Y9YA 2MJZA 3G3ZA 4IFMA 1HGZA 5GTIE 4N6JA 1HBWA 3O8ZA 4XE5B 4EIJA 2O1KA 1RF1B 2OARA 3PRJA 1LT9A 1L0NK 2FYUK 3D6ZA 4U3FJ 4Z1MH 3L71E 5AW3B 3H1HG 2QJKC 4AQRD 2Y9ZA 1URQB 1Q2NA 2R5BA 5KLVJ 3QH9A 2V7QJ 4H44D 4IL6E 2R3SA 3NXSA 2WSFH 1FZAA 1RQUA 2AXCA 2YMKA 1YQ3C 5AVZB 1OVVA 1NJIQ 1AA0A 1NTMJ 3GHGB 2M0BA 1LJ2A 1KC8Q 3MP7B 3H1JE 3RBXA 5AW8B 2H7HA 2ZJSE 4Y99B 2XNDH 4M3LA 3S9OA 1LP1A 2P1JA 4N78D 3V4WA 1ZXGA 2Y0DA 2FFDA 5AW1B 1QL1A 4Y28J 3LW5J 3VP8A 1BSHA 1NTKD 4BWNA 3VMAA 3HD7C 1N7SA 2VRSA 2O1JA 2ZYGA 3RL0C 3RL0D 2OTLP 1KN7A 5APXA 1OMIA 2K9JB 2QM8A 1H88A 3BRTB 4PD4I 1JO5A 3OW2O 4ZKUA 3L71J 1JUNA 3CX5I 2JP3A 1BE3E 4YXDC 3H1KD 2QJPB 4GOEA 2ZXEB 1Q7YQ 1DD4A 1SQQE 3P32A 4YPCA 3VYIA 2YKOA 5CCHA 1AQTA 1LTJA 2IBZI 3H1ID 1NTKK 1IFPA 3CLQA 4D6TD 1AJYA 2N1TC 2FYNC 3L73G 5CHXA 1FZEA 1KILA 4KHXA 2E75D 3HUSA 1RF1C 3H1JJ 2WZ7A 2HR3A 3AECC 2QA4P 3M0DA 3W67A 1CZQA 2YNYA 4JYBA 1URQC 2AEMA 1URQD 2C9LY 2QVAA 3G71P 2J59M 4B86A 4UB8H 2IZ1A 3C8VA 3VN0A 1KB9D 3L35A 1SFCD 5AVUB 1HJ0A 1Y8AA 3TGUG
chains in the Genus database with same CATH topology
2M3EA 2K1AA 2K9JA 2KNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3E A;  2K1A A;  2K9J A;  2KNC A; 
#chains in the Genus database with same CATH topology
 2E76 B;  3CWB D;  5AW5 B;  5B66 H;  3U1A A;  5AW2 B;  3MUD C;  4RKU J;  2QG4 A;  3C9I A;  1KQG B;  4HH2 A;  2E5Y A;  2I1J A;  3KDP B;  1JNM A;  1LWU C;  1BCC D;  3GHG C;  1BE3 J;  2M5A B;  1IO4 A;  3L75 D;  2Q5U A;  1SQQ J;  3FXD A;  3CXH E;  1VDF A;  1N7S B;  2L91 A;  1BGY E;  2OTK E;  2QEX P;  3H1L G;  4WY4 B;  3CCV P;  2KYV A;  1VQP P;  2E5T A;  3NMD A;  2KNC A;  3RK3 D;  3M9Q A;  2HOD A;  3RBZ A;  1KYO I;  4ZKP A;  4PJ0 E;  3Q5P A;  3JSV C;  1UIX A;  1M7L A;  1SS1 A;  3AE5 C;  4AYC A;  2QJP C;  1SQB E;  2KSE A;  1NYH A;  5AVT B;  4TLF A;  4O9B A;  1JEK A;  1L0N G;  3SWF A;  3AEF C;  5KAF E;  2BCC D;  2FYU G;  2WT7 B;  2ITA A;  1JMB A;  3FXE A;  1N73 B;  4NPF X;  1L0L G;  1S9K D;  3L74 D;  1NAF A;  3PHL A;  1YQ4 C;  4C7N B;  3CD6 P;  2UWJ E;  3KZI H;  3CCL P;  2A06 D;  2IPP A;  2V4H A;  2DW3 A;  3A0B E;  3V2N A;  4PV1 D;  1KTM A;  3CC7 P;  3MHV A;  3H6P A;  1OVU A;  1BGY J;  1SQP D;  1EZV I;  3GG2 A;  1Z56 A;  3C1L A;  1EDJ A;  3PJS K;  1Q82 Q;  3AE6 C;  1X9V A;  4L76 A;  4XA4 A;  4IFD K;  1KOR A;  1W2E A;  1KQS O;  3HE4 A;  2LXC B;  2E76 C;  2HPC B;  4HYT B;  1OW6 A;  3JCU E;  1L4A A;  3HD7 A;  2YKQ A;  1AFO A;  4GT1 A;  2R5D A;  2E74 B;  1FU1 A;  4PD4 E;  1SQB J;  1Y47 A;  2O01 N;  3II6 A;  2HLO A;  1JY2 N;  1P84 D;  1AVY A;  3D71 A;  3CPW O;  2Q1K A;  3CX5 E;  1N7S C;  1G2C A;  1GK4 A;  1N7S D;  1RH5 B;  2KS1 B;  2XDJ A;  2WTY A;  3L70 E;  1JY2 O;  1JB0 J;  3AEE C;  2E42 A;  2I1K A;  5AVX B;  4WY4 C;  3CCE P;  2FBW C;  4H13 C;  1GTW A;  4H13 D;  5KJ7 C;  2R44 A;  4RES B;  1RE3 A;  3SWK A;  2XNX A;  2IBZ E;  1WMK A;  1LTI C;  2N1T A;  3FWN A;  2P58 A;  3VP9 A;  1NTK G;  1DD3 A;  1CI6 B;  1IFD A;  3WMM 0;  3A3Y B;  1KQL A;  5CCH D;  1OW8 A;  2BEQ D;  1K9M Q;  2KZJ A;  1DH3 A;  2NPS B;  2W6J H;  4ZNC A;  5AW0 B;  1KIL D;  1L0L J;  5APW A;  3CCM P;  1PV3 A;  4WVZ A;  3H1K G;  4JYC A;  1N73 C;  2ZVN B;  3M0D C;  3RL0 g;  5EFW B;  3MD0 A;  1OFC X;  1OXZ A;  1DIP A;  1VPC A;  1YJ9 P;  3K5B A;  1E79 H;  1DEB A;  3H1I G;  3GW6 A;  4D6T G;  1AQ5 A;  3U1C A;  2HG5 D;  3ABV C;  2CPS A;  1FZB A;  1SQV E;  3L70 J;  2P67 A;  4UB6 E;  4NPE A;  4I6M C;  1L4A B;  1PPJ D;  4RO0 A;  1M56 D;  3CME P;  4C7R A;  1LTB C;  3RK2 B;  3AE7 C;  1S2E A;  3OJA B;  3V4Q A;  4GIF A;  2RKL A;  1DX7 A;  2ZAE B;  1G2C B;  2CPB A;  1S5L E;  2E74 C;  3CMA P;  2K9J A;  1VQK P;  3CWB G;  3IR9 A;  1KYO E;  3ITK A;  1LTA C;  3M91 A;  2D2C B;  3FX0 A;  2IDB A;  3U59 A;  2O3J A;  1CSB A;  4OH8 B;  3SWY A;  3L75 G;  2KZI A;  4K3A A;  1EZV G;  2W6A A;  1FBM A;  5TJH A;  2Y0E A;  3L72 D;  1NTZ D;  1SVF A;  4DCK A;  1Q86 Q;  3A5T A;  1NVO A;  1VQ5 P;  1VL2 A;  3FGA D;  1GW3 A;  1MUU A;  3TSI A;  1PGJ A;  3JC2 2;  2A45 G;  2KB7 P;  1K73 Q;  1SQV J;  2R3C A;  1EDL A;  1KB9 H;  2WPQ A;  3EFF K;  1N7L A;  2K3R A;  1H89 A;  1YI2 P;  2OYI B;  1J1E B;  1YIJ P;  3CCS P;  1ZRT E;  1N8R Q;  2NPS C;  3I55 P;  1VQO P;  1D7M A;  4JQ0 D;  1KMI Z;  2PFX A;  1J2J B;  1EZV E;  5CJ4 A;  1NTZ K;  1A02 F;  2GUS A;  3AE4 C;  3P8C D;  4HKZ H;  2PRR A;  4WBA A;  2BCC G;  2FXO A;  4KT0 J;  1NGM B;  3H1H E;  1HH0 A;  1EC5 A;  1GD2 E;  3L74 G;  3RK3 E;  2A45 H;  4EOT A;  2M5A A;  2B87 B;  2IFM A;  3CI9 A;  2BEZ F;  2W6B A;  1IFM A;  1R5L A;  2LKM A;  1QL2 A;  1KFN A;  2O01 H;  2RN0 A;  1L4A C;  1NHL A;  2ZT9 C;  1L4A D;  2ZT9 D;  3HD7 D;  2A06 G;  2Z5H A;  2CK3 H;  2NZ2 A;  2WIT A;  5C39 A;  3RK2 C;  1SQP G;  4WY4 A;  2GA1 A;  3BCC D;  1JY3 N;  5KJ7 A;  4U3F D;  2WSF J;  3KYQ A;  2FYZ A;  1JY3 O;  2IYO A;  4L73 A;  5APU A;  2IFN A;  1ZLL A;  5KLV D;  1VQ7 P;  2D2C C;  2D2C D;  4GOF A;  1PP9 G;  1FJK A;  1RE3 C;  5KTB A;  3IF4 A;  1YIT P;  2OYH B;  1SQX G;  1LTS C;  2N1T D;  1W5C E;  3VOP A;  2WT7 A;  3SFE C;  2JKV A;  5AW7 B;  3CC4 P;  4W7Y A;  1GK6 A;  2B89 A;  1N73 A;  3H1H J;  1NTM D;  2Z5I A;  1HGV A;  1S4X A;  1VF5 B;  1RE4 C;  3CCR P;  1M1K Q;  4UB8 E;  2JO1 A;  1EQ7 A;  1R8E A;  2Q9I A;  3PH0 A;  5APQ A;  4WB4 A;  4C7N A;  3B71 A;  1ZR2 A;  2OYI C;  5KLV K;  5B66 E;  1GL2 A;  1T3U A;  1PP9 E;  1N86 A;  2M8R A;  2W83 C;  1SQX E;  1NU1 G;  2JEE A;  1ZOY C;  3L73 E;  1OZH A;  1RHZ B;  5KAI E;  4JF7 A;  1JY2 P;  1P84 H;  1NTM K;  2HPC A;  4NPD A;  3L71 D;  3IN6 A;  1KV4 A;  4Y99 C;  5KAI H;  4DZO A;  1M90 Q;  1YJW P;  5K5G B;  3B8E B;  2FY8 A;  4L75 A;  1LGH B;  3NTN A;  1OVR A;  3VMZ A;  4KJM A;  2WPV B;  1NKN A;  1WRG A;  5CCG C;  2POH A;  3TGU E;  2GUV A;  2KS1 A;  1NU1 E;  5L8R J;  2WSS H;  1HJB A;  5TIS H;  3PP5 A;  3A0H H;  3H1J D;  3D6Y A;  1PFI A;  2K1A A;  1HVV A;  2IZ0 A;  2OTJ P;  1PL5 A;  1FS0 E;  1YTZ T;  1PP9 J;  2JDI H;  1MZ9 A;  4QMA A;  3VMX A;  1W2B O;  1CI6 A;  1SQX J;  3H1L E;  1LT1 A;  2N9Y B;  5AVV B;  1GU5 A;  2OYH C;  3L73 J;  4MN4 C;  1VQ4 P;  1KB9 I;  5H2F H;  3G6E P;  2NPS A;  2P10 A;  3WUU A;  1JOC A;  3KZI E;  3BAT A;  1VQ6 P;  3EQ2 A;  1X22 A;  2YXR B;  1BE3 D;  1VF5 C;  1GL2 B;  5DJT B;  3L72 G;  2WVR A;  1SQQ D;  1ZW0 A;  1M57 D;  4CPG A;  1L0N E;  2FYU E;  3TGU J;  2K37 A;  1FDO A;  4EYY Q;  1HF9 A;  1NU1 J;  1ZV8 A;  1NAY A;  3VMY A;  2C0W A;  1L0L E;  3T97 B;  3BVH A;  2E76 D;  1MKM A;  2A45 I;  5AVW B;  3BAS A;  1YTZ I;  4BXL A;  2KOG A;  1NOH A;  1J1D B;  2XZR A;  4I7Z B;  1H0T B;  3Q5R A;  1T2K C;  2PP6 A;  1T2K D;  1QLE D;  4A7P A;  2JWA A;  3TK1 A;  3E1I A;  3LID A;  1QEX A;  4W7Z A;  3M9H A;  1SQQ K;  1QVF O;  3H1L J;  2E43 A;  2OQQ A;  3AE9 C;  3B5N A;  2WQY C;  4OGQ B;  2QRX A;  4WY4 D;  1OX3 A;  1U7M A;  3TNU B;  1G1J A;  1M1J B;  5KJ7 D;  2ZXX A;  1QX8 A;  3TYY A;  2NRG A;  3Q3D A;  3N4X A;  2KK7 A;  3OAK A;  1ZR4 A;  5E79 H;  3CXH D;  1EDK A;  2AXT H;  3I5C A;  1L0N J;  2KI7 B;  2FYU J;  2ZYA A;  1VQ9 P;  1NH4 A;  1BGY D;  1RE4 A;  5B5E H;  3O6Q B;  3M06 A;  3BCC G;  3HE5 B;  2QJK B;  3MGN A;  1FZC B;  4U3F G;  3UIA A;  2OYI A;  3V2R A;  1NO4 A;  2H43 A;  4N78 E;  3HRN A;  4H44 B;  4BRY B;  1FOS E;  2B88 A;  3QWO C;  5KLV G;  1VQM P;  3V2Q A;  3CC2 P;  2P2U A;  1FZF A;  2R32 A;  2WMM A;  1NTK E;  4GDO A;  2W90 A;  1NWQ A;  1IFN A;  1GL2 C;  4C46 A;  1SQB D;  2KSJ A;  1QGK B;  3L36 A;  3P7K A;  3F5H A;  2J58 A;  4N3Y B;  1XTG B;  3CCJ P;  3CL3 D;  3BCC E;  1P84 I;  2HYN A;  1NTM G;  4W80 A;  3R4Y A;  3H25 A;  1DEE G;  4JPZ B;  2B87 A;  3H1K E;  4IOI H;  1KD1 Q;  5GTH H;  2IYP A;  1JCD A;  1JY3 P;  5CCG A;  2GM4 A;  3TDK A;  1J1D C;  4I7Z C;  2WWW A;  2YKP A;  3RL0 B;  3AE1 C;  3H1I E;  1T3J A;  3B5N B;  2E74 D;  4D6T E;  1BDD A;  1SQB K;  2KUB A;  4LLH A;  2KIK A;  2QSI A;  1BDC A;  5KLI B;  2IX7 C;  1K05 A;  3LIE A;  1BCC G;  4IFF A;  2PGD A;  3L71 G;  4OGQ C;  3G4S P;  3NFQ A;  1AVO A;  1M1J C;  3Q5S A;  2OYH A;  1NTK J;  1YBK A;  1KB9 E;  2XV5 A;  3R2P A;  4PD4 D;  1X79 B;  5AW6 B;  3V2P A;  1FOS F;  1EXJ A;  1LNQ A;  1IK7 A;  2E75 B;  1S5L X;  3CWB E;  3S4R A;  3MZW B;  4LGD E;  3CX5 D;  2KP8 A;  3LW5 H;  1A02 J;  3BCC J;  3L70 D;  5CMZ A;  2QIW A;  1LTG C;  2YO3 A;  4GKG A;  5GTI H;  1BCC E;  3GF3 A;  3H1J G;  2RMZ A;  2NPS D;  1Q81 Q;  4OVN F;  3H1K J;  3L75 E;  1FZC C;  1L0L K;  3ZDM A;  2IBZ D;  4H44 C;  3CCU P;  1SFC B;  1RF0 C;  3H1I J;  4ASV A;  4D6T J;  4EI2 A;  4IL6 H;  4JBZ A;  4DJG A;  2KLV A;  1S3J A;  1G1I A;  1S72 P;  3S1K A;  4OWF A;  3IAO A;  1IFJ A;  1PGO A;  1LWU B;  1JM0 A;  3I56 P;  1ZN5 A;  1FDM A;  1AV1 A;  4IL6 X;  1BE3 G;  4ASW A;  1JTH A;  1R5S A;  2YXQ B;  1SQQ G;  2WSC H;  1H8A A;  3RK2 D;  2AEJ A;  3AE2 C;  2ZVO B;  2KXP B;  3AEG C;  2BCC E;  2M3E A;  3PTZ A;  3H32 B;  2FXM A;  3CWB J;  3RK3 B;  3B5N C;  3B5N D;  1HUC A;  1SQV D;  1VQN P;  1S9K E;  3L74 E;  1LTT C;  4WWI A;  1GU4 A;  3WUV A;  1RQV A;  1X0T A;  1BCC J;  3RGU A;  5KLI C;  3L75 J;  5CBN A;  2A06 E;  4HJG H;  1MFZ A;  4H0L B;  2HFE D;  1SQP E;  3E1R A;  3MIW A;  1L2P A;  3USS A;  1USE A;  2SPZ A;  2MKV A;  3HTK A;  2Q3I A;  1LT9 B;  3M0A A;  2QE7 H;  2O01 J;  2W27 A;  2ZFC A;  5BU5 A;  1ZME C;  1KYO D;  1PGP A;  1TU3 F;  2I8D A;  1USD A;  1SQV K;  2E75 C;  2LXB A;  4R4L A;  2XU6 A;  1K04 A;  2WSC J;  1J1E C;  3E7K A;  3GLM A;  3G9R A;  4PV1 B;  2FXP A;  3A2A A;  2P7J A;  2G3A A;  1HTL C;  1KZU B;  5KKZ B;  1P84 E;  2BCC J;  1SP4 A;  1GDT A;  1BGY G;  1SFC C;  1T6A A;  2AEF A;  3T97 A;  5AW4 B;  5APT A;  1FZG A;  3L74 J;  3V5B A;  1U7J A;  1FJP A;  1H0T A;  5APY A;  1LP1 B;  1GZL A;  1JTH B;  1ZRT D;  3EFG A;  2JWD A;  4I1L A;  2FFD B;  2QJY B;  1SLQ A;  2G8Y A;  1NKZ B;  1WT6 A;  1EZV D;  1XTC C;  5CCG D;  3A7O A;  1KQF B;  1PZQ A;  1SQP J;  2YMY A;  5TIS E;  1SQB G;  3A0H E;  2W8Z A;  4HB1 A;  1X8Y A;  3AEA C;  1S1C X;  3CXH H;  3TNU A;  1PPJ G;  3H1H D;  2C9N Y;  1KIL E;  1M1J A;  1GW4 A;  4H13 B;  2WPS A;  3KPE A;  1Y9B A;  3RK3 C;  2Y0C A;  3L4F A;  3M9B A;  2K9Y A;  3Q1M A;  1IK9 A;  3W68 A;  2H88 C;  5H2F E;  3SFD C;  5BVZ A;  4I2L C;  2H89 C;  3HTK B;  4ZMD A;  1KFM A;  4PJ0 H;  1LTJ B;  3O6Q A;  4H0L C;  4TT3 H;  4H0L D;  5BU8 B;  2QM7 A;  3HE5 A;  1FZC A;  1KIL B;  2PAJ A;  3GF7 A;  3HUS B;  3KQG A;  1MV8 A;  3IFM A;  1LT9 C;  1PPJ E;  2Z4E A;  4BRY A;  1YHQ P;  1VF5 D;  5KAF H;  1VQ8 P;  1NTZ G;  1BSN A;  1RF0 A;  1VQL P;  2OYO A;  3KHU A;  1FAV A;  4EDF A;  3EWK A;  4RJT A;  2M3B A;  4PV1 C;  1EXI A;  1PGQ A;  4R4M A;  2FKW B;  1IJD B;  5AVS B;  1IZN B;  1JMM A;  5KKZ C;  2C0X A;  3VTP C;  4YXW H;  1M8O B;  3A0B H;  3L70 G;  2LR2 A;  3V6I A;  1CW5 A;  3F89 A;  3MTU E;  3L72 E;  1NTZ E;  2Q6Q A;  2IBZ G;  1OIP A;  1PP9 D;  2FFD C;  4L74 A;  3JCU H;  1U57 A;  2QJY C;  3OA7 A;  1SQX D;  1OW7 A;  2YIU B;  3GMA A;  2WPR A;  3L73 D;  1JCC A;  1SQP K;  5CBO A;  2KNC B;  4PD4 H;  2Q7C A;  2L5G B;  5E79 E;  2AXT E;  1FE6 A;  2HOD B;  3CX5 H;  3L37 A;  5B5E E;  1IFI A;  3BRV B;  3KXD A;  4AUW A;  3P8C E;  2XKM A;  3Q2Y A;  1GMJ A;  3TGU D;  5APV A;  1SQX K;  2ZYD A;  1RF1 A;  1NU1 D;  4YTP C;  5CCH C;  1SQV G;  1LTJ C;  3SSU A;  5AVQ B;  4GOD A;  2YO2 A;  4K35 A;  2WSE H;  1KIL C;  3HUS C;  1URQ A;  1OWA A;  4DOJ A;  2BAS A;  3L72 J;  1NTZ J;  3N7N A;  4U7J A;  5DJU B;  5AVR B;  1GL2 D;  1SFC A;  3AEB C;  3AED C;  1FDI A;  2K88 A;  3H1L D;  3P8M C;  1ZP0 C;  3MUD A;  5GTH E;  1QVG O;  4U3F E;  1RY3 A;  3FWL A;  5CJ0 A;  1LWU A;  1NU1 K;  2OGU A;  3GHG A;  2B9B A;  3HE4 B;  1IC2 A;  1UII A;  1Q90 D;  3AE3 C;  4DT0 A;  5KLV E;  3TF5 A;  2J5U A;  2ZT9 B;  3WU2 E;  2H8P D;  3HD7 B;  3PLN A;  2RH0 A;  3CCQ P;  2KLU A;  4UB6 H;  1YYC A;  3WU2 H;  2V7Q H;  5AVY B;  2Q3E A;  3H32 A;  1L0N D;  4LC1 A;  3CXH I;  2FYU D;  5APS A;  1E5W A;  1K8A Q;  1HWT C;  2JR8 A;  1NTM E;  1YJN P;  2WSE J;  4XFJ A;  4OGQ D;  3WUT A;  1L0L D;  1EDI A;  1MFT A;  2N9B A;  1N2D C;  2YIU C;  1S5L H;  1T8Z A;  5AW9 B;  1FC2 C;  1PIX A;  2JJL A;  5M1B A;  1KYO H;  3D70 A;  3B4S A;  2N1T B;  2FYN B;  3AE8 C;  2Y9Y A;  2MJZ A;  3G3Z A;  4IFM A;  1HGZ A;  5GTI E;  4N6J A;  1HBW A;  3O8Z A;  4XE5 B;  4EIJ A;  2O1K A;  1RF1 B;  2OAR A;  3PRJ A;  1LT9 A;  1L0N K;  2FYU K;  3D6Z A;  4U3F J;  4Z1M H;  3L71 E;  5AW3 B;  3H1H G;  2QJK C;  4AQR D;  2Y9Z A;  1URQ B;  1Q2N A;  2R5B A;  5KLV J;  3QH9 A;  2V7Q J;  4H44 D;  4IL6 E;  2R3S A;  3NXS A;  2WSF H;  1FZA A;  1RQU A;  2AXC A;  2YMK A;  1YQ3 C;  5AVZ B;  1OVV A;  1NJI Q;  1AA0 A;  1NTM J;  3GHG B;  2M0B A;  1LJ2 A;  1KC8 Q;  3MP7 B;  3H1J E;  3RBX A;  5AW8 B;  2H7H A;  2ZJS E;  4Y99 B;  2XND H;  4M3L A;  3S9O A;  1LP1 A;  2P1J A;  4N78 D;  3V4W A;  1ZXG A;  2Y0D A;  2FFD A;  5AW1 B;  1QL1 A;  4Y28 J;  3LW5 J;  3VP8 A;  1BSH A;  1NTK D;  4BWN A;  3VMA A;  3HD7 C;  1N7S A;  2VRS A;  2O1J A;  2ZYG A;  3RL0 C;  3RL0 D;  2OTL P;  1KN7 A;  5APX A;  1OMI A;  2K9J B;  2QM8 A;  1H88 A;  3BRT B;  4PD4 I;  1JO5 A;  3OW2 O;  4ZKU A;  3L71 J;  1JUN A;  3CX5 I;  2JP3 A;  1BE3 E;  4YXD C;  3H1K D;  2QJP B;  4GOE A;  2ZXE B;  1Q7Y Q;  1DD4 A;  1SQQ E;  3P32 A;  4YPC A;  3VYI A;  2YKO A;  5CCH A;  1AQT A;  1LTJ A;  2IBZ I;  3H1I D;  1NTK K;  1IFP A;  3CLQ A;  4D6T D;  1AJY A;  2N1T C;  2FYN C;  3L73 G;  5CHX A;  1FZE A;  1KIL A;  4KHX A;  2E75 D;  3HUS A;  1RF1 C;  3H1J J;  2WZ7 A;  2HR3 A;  3AEC C;  2QA4 P;  3M0D A;  3W67 A;  1CZQ A;  2YNY A;  4JYB A;  1URQ C;  2AEM A;  1URQ D;  2C9L Y;  2QVA A;  3G71 P;  2J59 M;  4B86 A;  4UB8 H;  2IZ1 A;  3C8V A;  3VN0 A;  1KB9 D;  3L35 A;  1SFC D;  5AVU B;  1HJ0 A;  1Y8A A;  3TGU G; 
#chains in the Genus database with same CATH homology
 2M3E A;  2K1A A;  2K9J A;  2KNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...