2K9JA

Integrin alphaiib-beta3 transmembrane complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
42
structure length
42
Chain Sequence
GALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the integrin alphaIIbbeta3 transmembrane complex explains integrin transmembrane signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Integrin alpha-IIb light chain
total genus 11
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2008-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.930 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bicelle-embedded integrin alpha(iib) transmembrane segment 2k9jA00
2KNCA 2K9JA 2M3EA 2K1AA
chains in the Genus database with same CATH superfamily
2WPVB 2O3JA 1CSBA 1NU1D 1R5LA 3AEEC 2Q7CA 1JOCA 2N1TC 3AE6C 3B5NB 1W2EA 3B71A 2E5TA 4WWIA 5AVVB 2W6BA 5AVRB 1L0NE 2M3EA 2WMMA 2OYIC 2LXBA 4U3FD 2J59M 4H0LD 3M0AA 3V2RA 4DT0A 1PL5A 1N86A 1PPJG 3RK2C 1ZR2A 1HWTC 2O1KA 1ZMEC 3CWBJ 3H1KJ 1A02J 2ZT9D 1P84D 1GW4A 1AV1A 2KZJA 1E5WA 4M3LA 4H44B 3L74D 5AVSB 2HLOA 3I5CA 3M9BA 5KJ7A 2E42A 4UB6E 4L76A 2Q6QA 1AJYA 4WY4B 1T3UA 1KFMA 3JSVC 5CMZA 1L0LD 1NU1K 1NTKD 2AXCA 3V2PA 3S4RA 1KMIZ 3BCCE 1KILD 1RF0C 5CJ4A 2WPQA 4PD4D 2HPCB 1D7MA 2B87B 1LNQA 2HPCA 3A0HH 3VN0A 3CI9A 2RH0A 1X22A 4H13C 2QJKC 4D6TE 1DD4A 2A06G 1RQVA 4H44D 4OWFA 5AW7B 2G8YA 1HJ0A 3MUDC 1J1DB 3WUUA 1H8AA 2W27A 4JPZB 3RK3D 3CCMP 1HJBA 1T2KC 1R5SA 2FYUE 1DH3A 3KZIH 2YNYA 1Q90D 1FOSF 1NOHA 4IFDK 1EDJA 1VQ8P 1FAVA 2XKMA 3L36A 3JCUH 1NTMD 2FXMA 1RE4A 1NAFA 3AECC 3L74E 2P2UA 1P84E 4Y99C 4C46A 3HUSA 1LTTC 1LTIC 1T6AA 5EFWB 3WUVA 3RL0C 1URQC 2IYOA 5APVA 1VQ6P 2K9JA 3CCVP 1HGZA 2A45I 3D71A 2XNDH 3IF4A 2FKWB 2ZYDA 3GG2A 3RGUA 3CC2P 1FU1A 1L4AA 2H88C 3RK3E 2WSFH 3FXDA 5APQA 3M91A 3IAOA 1PZQA 1L4AC 1QVGO 2O01J 3M06A 2JO1A 2WT7A 2IPPA 5B66E 2KOGA 3CCLP 2I1JA 2HFED 1W2BO 1FDIA 1VF5C 1JCDA 1OW6A 1SQVK 1KFNA 2B87A 2FYNB 2M0BA 3PH0A 1YTZI 5AVUB 1S1CX 3N4XA 3H1LG 1SQQG 3E1RA 1NTZJ 1LT9A 3BCCD 3I55P 1KTMA 1LT9B 1MZ9A 3GHGA 1OVRA 2IBZE 3HTKB 1U7JA 1QEXA 2HR3A 4GIFA 4KJMA 3AE3C 2H43A 4AQRD 3CCJP 3IFMA 2XU6A 1SQBK 1IO4A 4K35A 3V2QA 2DW3A 2P58A 3CXHE 3VOPA 3CCRP 3Q5SA 1U7MA 3VP8A 1QGKB 2GM4A 4EYYQ 2XNXA 2WWWA 2ZYAA 3EQ2A 3HUSB 2Q9IA 2R32A 1CI6B 1RH5B 2IX7C 3TF5A 1VF5B 2FYNC 1DX7A 4MN4C 1G2CA 2E76C 1FDOA 1JY3O 1G2CB 2I1KA 2NPSC 4L73A 1FZAA 3KHUA 2AEMA 4U3FE 2AXTE 1FZCC 2YO3A 1GL2D 1EZVE 3L74J 2V4HA 3QH9A 5BVZA 1BSHA 1NO4A 1GZLA 2A06D 2IDBA 1HTLC 3L75J 3B5NC 1G1JA 1SFCB 2KSEA 1G1IA 3AE5C 5H2FE 1LTGC 5AVZB 1KILA 4YXDC 3VP9A 5CCHC 3U1CA 2KP8A 3BRTB 4TT3H 3FXEA 1KQFB 2O1JA 3EFFK 2JJLA 3L71E 1CZQA 1SQXG 1AQTA 1NGMB 4GDOA 1SQXD 4ASWA 2O01N 3WMM0 1SQQE 1JB0J 3D70A 3CMEP 1N2DC 3G3ZA 4C7RA 1MKMA 1N8RQ 2B88A 3F5HA 1L0LG 1NTZE 2Q1KA 3KXDA 1OW7A 2OQQA 2PGDA 2WSCH 3CL3D 1LWUB 3H1JE 1Y47A 2WITA 2WVRA 1M8OB 2QM8A 3HE5B 3NMDA 1L0NG 2CPSA 1NU1J 1AA0A 2N1TA 2QRXA 3TNUB 5BU8B 3A0BH 3TGUG 3MHVA 2LXCB 1PPJE 4O9BA 1L0LK 5APWA 2K88A 3CLQA 3D6ZA 2KLUA 1K8AQ 1AVOA 3V4QA 3EFGA 2Y0DA 4BWNA 4UB8H 3G9RA 3CXHI 4U3FG 3C1LA 3O6QB 1J1EB 1LTJC 3AE9C 2KI7B 2K3RA 3H32B 1BGYJ 4I6MC 3VYIA 1QVFO 1DEEG 2M8RA 1LJ2A 2ZVOB 1LTSC 3HTKA 3P8MC 2VRSA 3JC22 3UIAA 1M1JB 2C9NY 2AEJA 3KYQA 4PJ0E 2WSEH 2L5GB 2R44A 1YJ9P 3H1IG 3L4FA 4EI2A 1VF5D 1L0LJ 5AW0B 1BE3E 1PV3A 2H7HA 4I2LC 4JYBA 5B66H 1DD3A 2YMKA 5BU5A 3CCUP 4PJ0H 3L72D 2K1AA 3M0DA 1L0NK 3G6EP 3FGAD 1SFCD 4PD4H 1URQD 1NTZK 3L70J 5KLIB 3ABVC 1LP1B 3O6QA 5KLVG 2IFNA 2FFDB 3PLNA 3E7KA 2XDJA 3L73D 1M1KQ 1M1JC 1Q86Q 1PPJD 1MFTA 2H89C 1PGJA 4L75A 1N7SC 1JMBA 1L2PA 1ZRTE 2R5BA 1SQPK 1GL2B 2IFMA 3R4YA 1LTJA 4W80A 2OYHB 3KDPB 3ITKA 1KYOI 2K9JB 2UWJE 1BE3J 2YXRB 1LT9C 4IOIH 1IZNB 5KAFH 1RF1C 2WSSH 4I7ZC 3HRNA 3NXSA 1SQXE 4XE5B 3CWBE 1X9VA 3H1KE 1U57A 3GW6A 1WRGA 4W7ZA 3AE7C 1SQBD 2ZAEB 3B4SA 3N7NA 2KYVA 3TSIA 4I1LA 3HUSC 2Z4EA 1HBWA 1VQ5P 5H2FH 1H89A 3RK3B 2WQYC 1K73Q 4HJGH 4YTPC 1EZVD 1M56D 1SQBE 1EZVI 1OXZA 3KPEA 4A7PA 2PFXA 1WT6A 5AVQB 3S1KA 1PFIA 3VMXA 4NPEA 2KS1A 3M0DC 1JNMA 2WZ7A 4EIJA 1M1JA 2MJZA 2YIUC 1RE3A 4I7ZB 5DJTB 2AXTH 3H25A 1PGQA 1SFCC 1YJNP 2ZXEB 3CMAP 2W83C 1S72P 1Q82Q 3OA7A 3SFDC 1SQVE 2R3CA 4ZNCA 1FE6A 3Q1MA 3L70G 3MGNA 3ZDMA 3I56P 3V2NA 1FBMA 2K9YA 2N9BA 2KSJA 3CPWO 2GUVA 5E79E 2V7QJ 3RK3C 2QG4A 3L35A 2CK3H 2QJKB 3L73E 2IBZD 2QJYC 4TLFA 2C9LY 2JR8A 3B5NA 1OFCX 3AE2C 2P67A 3FWLA 4GOFA 5C39A 1KB9E 4UB8E 5GTHH 3V5BA 3RBZA 4Z1MH 1NU1G 2XZRA 2QIWA 1QL1A 3CX5E 3PRJA 3SWKA 4K3AA 3W67A 2Q3EA 5B5EE 2Z5IA 2JWDA 2OYOA 5AW8B 1SQPE 2KNCA 2KNCB 2NZ2A 2JWAA 2YKQA 1KB9H 1S5LX 3A0BE 3GHGC 3TK1A 4N78E 1URQB 2M5AB 3H1LD 3L71J 5APYA 3T97B 1SQVJ 3RL0D 5B5EH 3A0HE 3B8EB 2BCCG 1YITP 2FYUK 1KC8Q 1BCCG 1SQQJ 1KD1Q 1BDCA 2ZJSE 4DZOA 3H1JG 2P7JA 2W6AA 3A3YB 5CJ0A 1YI2P 1GU5A 1VQ7P 3PTZA 1AQ5A 1JO5A 5APSA 1Q2NA 2RMZA 5AW6B 3L70D 2R5DA 2Z5HA 1VQ4P 1OX3A 2KUBA 1H0TA 1QL2A 3M9HA 2POHA 1S9KE 1Y8AA 1YBKA 3JCUE 1VQMP 3G71P 3CCEP 1OZHA 1X79B 2E74B 4N3YB 2FYUD 3HD7D 2HG5D 4NPDA 4OVNF 5AW1B 2BCCJ 3O8ZA 2PP6A 2RN0A 1FZFA 1FC2C 5KLVD 2KS1B 2LR2A 3H1HJ 1QLED 4RKUJ 1GU4A 3BVHA 1RE4C 3NTNA 1VL2A 4JBZA 1X8YA 2K37A 1BGYE 4WBAA 4ZKPA 2Y0EA 4JQ0D 3RK2B 2Q5UA 1FZGA 2FFDC 4PD4E 3H1IE 3P8CD 4DJGA 1P84I 1N7SA 3LIDA 4LGDE 2OARA 4QMAA 1XTCC 2BCCD 3R2PA 5AW2B 1NTKE 1DEBA 5CCGD 1L0LE 2FXOA 1IFJA 3L75E 3T97A 2OYHC 1EDKA 3WU2E 1JTHB 2E74D 2JEEA 2NPSB 2PAJA 4WY4C 3CCSP 1GD2E 2OTLP 3CC4P 4BXLA 5CHXA 4WY4A 4R4MA 3F89A 1JY2N 1RF0A 3A2AA 2WT7B 3OW2O 4Y28J 3WU2H 1UIIA 1EDIA 1N73A 1BCCJ 3L72J 1N73B 2HODB 2LKMA 3H1HG 2ZVNB 5GTIE 1YTZT 3EWKA 4H13B 1IK7A 3HD7A 1YQ4C 2J58A 1SLQA 1AVYA 1FS0E 1RF1A 1NU1E 2N9YB 1LP1A 1NTKJ 2QEXP 4IL6X 2M3BA 2NPSD 3C9IA 1JCCA 1IK9A 2GA1A 1BDDA 1JTHA 3K5BA 1M90Q 4AYCA 4NPFX 1JY3N 1BCCD 4ZMDA 2PRRA 1VQNP 2ITAA 1SQPJ 4OGQD 4Y99B 1RHZB 1ZW0A 2RKLA 4PV1D 2BCCE 2QE7H 3TDKA 3FWNA 3RL0B 5GTHE 1GK6A 3H1ID 2YO2A 1PP9J 2WSEJ 3L71G 1YJWP 1PP9G 1VQOP 1BGYD 1BCCE 5L8RJ 1K04A 5AVWB 1VDFA 1NJIQ 1KQGB 2C0XA 2G3AA 5CCGC 3H1LJ 1NHLA 5AW4B 2XV5A 5KLVK 2FYUG 2YKOA 1L4AB 1SQBJ 3M9QA 1H88A 2H8PD 5E79H 1IC2A 2W8ZA 3RK2D 3TGUJ 3WUTA 1T2KD 1SQQK 2ZT9C 5AVTB 4N6JA 3TNUA 2FFDA 3HD7B 2B9BA 2HODA 4OGQB 2QM7A 2R3SA 4JF7A 3GF7A 4UB6H 1KQSO 1JY2O 4PV1B 1WMKA 3CX5H 1A02F 1T3JA 3VMYA 4GODA 1LTAC 3L70E 4B86A 3GHGB 4RESB 1SQXK 2P10A 1KN7A 1KYOD 2D2CC 1NTME 3VMZA 1JUNA 4RJTA 1NTMG 3A5TA 1LWUA 2OYIB 4YPCA 3L73J 3PJSK 4W7YA 5KLIC 3TYYA 2Q3IA 1PGOA 3H1IJ 3L75D 3H1LE 1PP9D 3A7OA 5CCHD 3L75G 3Q5PA 1L0NJ 4D6TD 1VQPP 2HYNA 1NTKG 5K5GB 3SWYA 3P8CE 2WPSA 1SQBG 2YXQB 4OGQC 1OVVA 3AEAC 4C7NA 1VQLP 2BEZF 4PV1C 2KZIA 1FZEA 1SQXJ 3Q3DA 1KB9D 3C8VA 1KILE 1KB9I 2D2CB 2MKVA 5TJHA 2ZYGA 3SFEC 2J5UA 3VTPC 5KLVE 3GLMA 1RF1B 5KKZC 1EXIA 1P84H 2WSCJ 4LLHA 3CD6P 3QWOC 3TGUE 1T8ZA 2OYIA 1VQKP 1KILC 1JY3P 5CCHA 1S9KD 4H0LB 3LIEA 3L74G 4L74A 1NAYA 1N7SD 2KLVA 5APXA 1M7LA 5CBOA 1VQ9P 1J1DC 2KXPB 3VMAA 2QA4P 1OWAA 1MV8A 1N7LA 4LC1A 2IBZI 2JDIH 4R4LA 1BSNA 1GTWA 1IFMA 1GDTA 1L0ND 3OJAB 2NRGA 4U7JA 1LWUC 1TU3F 4D6TJ 4XFJA 1PIXA 5KAFE 2AEFA 4AUWA 4GOEA 5KKZB 3V6IA 4WY4D 1KV4A 4C7NB 4N78D 1HGVA 2FYUJ 1QX8A 3SSUA 1SFCA 2IYPA 2FXPA 3HE5A 1KYOH 1NTMJ 1SQPD 1KILB 1HH0A 3CX5I 5TISH 1R8EA 2I8DA 3CX5D 3CWBD 3H1KD 1J2JB 2ZXXA 1EDLA 1NTZG 1OVUA 3KQGA 5AW3B 1J1EC 1LTJB 5GTIH 1IFDA 1NH4A 3H32A 1FJPA 4EDFA 1RY3A 2E75C 5TISE 4WB4A 2OGUA 3LW5J 3AEFC 1FOSE 1GMJA 3AEDC 1OMIA 1ZRTD 1NTKK 2C0WA 1HVVA 3MD0A 1H0TB 1SQVD 4DOJA 1M57D 2IZ0A 5DJUB 1SQVG 2IZ1A 3AE1C 1S2EA 4GKGA 3USSA 1NWQA 3AE4C 3RL0g 2L91A 4HB1A 2P1JA 2N1TB 2O01H 2Y9YA 3H1HE 3HE4A 3L72G 5M1BA 3PHLA 4IFMA 1CW5A 1FDMA 1IFIA 4IL6H 1JM0A 3U59A 2QJPB 1SQPG 2WSFJ 3P32A 3AE8C 1JMMA 3E1IA 1EZVG 2QSIA 3D6YA 1LGHB 3MTUE 5APUA 3MIWA 3HD7C 3OAKA 4IL6E 4ASVA 1N7SB 1ZXGA 3BATA 1GL2C 1FZCB 2WPRA 4RO0A 3BASA 4JYCA 1SS1A 1S4XA 1URQA 3LW5H 2E76D 1FZBA 3MUDA 1SVFA 3GMAA 5AVXB 1UIXA 1SP4A 1ZOYC 4IFFA 4CPGA 1E79H 2E5YA 5CCGA 5CBNA 2QJPC 3CC7P 1MFZA 1NYHA 2JP3A 3GF3A 2E43A 3B5ND 4EOTA 2WTYA 1HF9A 2FY8A 4H13D 1AFOA 4PD4I 5APTA 3TGUD 1CI6A 1Q7YQ 2E75D 2OTJP 2KK7A 3HE4B 4GT1A 1HUCA 2SPZA 2YKPA 3II6A 3MP7B 1VPCA 2V7QH 3V4WA 4KHXA 2M5AA 1Z56A 2FYZA 1GL2A 3G4SP 2OTKE 4KT0J 1EQ7A 1NTZD 1NTMK 1ZV8A 2BASA 2BEQD 2YIUB 3CWBG 3FX0A 3H1KG 3H6PA 5AVYB 3L72E 1SQQD 3H1JJ 5KJ7D 2ZFCA 3Q2YA 3BRVB 1PGPA 4ZKUA 2B89A 3BCCJ 2KIKA 1PP9E 1BE3D 1X0TA 4BRYA 2GUSA 5KTBA 1BE3G 1ZR4A 1N73C 3PP5A 1ZP0C 2FBWC 2N1TD 1KZUB 4H0LC 5KJ7C 2QVAA 1L4AD 2CPBA 1KORA 3KZIE 2Y0CA 2A45G 2IBZG 4HYTB 1OW8A 4YXWH 4HH2A 1KYOE 1GW3A 2A06E 1RQUA 1NKNA 2QJYB 3AEGC 1YYCA 3IN6A 5AW9B 4HKZH 1S3JA 1NKZB 5KLVJ 5KAIH 3SWFA 1DIPA 1YQ3C 3H1HD 1LTBC 2Y9ZA 3IR9A 3CCQP 1EXJA 1KQLA 1ZN5A 3L73G 4U3FJ 4WVZA 4XA4A 3S9OA 1IFNA 3L37A 1Q81Q 1Y9BA 2JKVA 3CXHD 1K9MQ 4OH8B 5KAIE 1IFPA 1EC5A 3CXHH 1FZCA 1S5LE 5AW5B 1JEKA 3BCCG 2OYHA 3H1JD 1IJDB 4DCKA 1FJKA 3P7KA 1USEA 3MZWB 1ZLLA 2W90A 1USDA 1XTGB 2E75B 1GK4A 2ZT9B 1RE3C 1S5LH 1YHQP 1YIJP 3W68A 3Q5RA 4D6TG 1JY2P 3L71D 1K05A 1MUUA 4H44C 4BRYB 2E76B 1W5CE 1BGYG 1NVOA 1OIPA 2NPSA 2A45H 2D2CD 2KB7P 2W6JH 1LT1A 2YMYA 3AEBC 2E74C 3NFQA 3U1AA 3RBXA
chains in the Genus database with same CATH topology
2KNCA 2K9JA 2M3EA 2K1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNC A;  2K9J A;  2M3E A;  2K1A A; 
#chains in the Genus database with same CATH topology
 2WPV B;  2O3J A;  1CSB A;  1NU1 D;  1R5L A;  3AEE C;  2Q7C A;  1JOC A;  2N1T C;  3AE6 C;  3B5N B;  1W2E A;  3B71 A;  2E5T A;  4WWI A;  5AVV B;  2W6B A;  5AVR B;  1L0N E;  2M3E A;  2WMM A;  2OYI C;  2LXB A;  4U3F D;  2J59 M;  4H0L D;  3M0A A;  3V2R A;  4DT0 A;  1PL5 A;  1N86 A;  1PPJ G;  3RK2 C;  1ZR2 A;  1HWT C;  2O1K A;  1ZME C;  3CWB J;  3H1K J;  1A02 J;  2ZT9 D;  1P84 D;  1GW4 A;  1AV1 A;  2KZJ A;  1E5W A;  4M3L A;  4H44 B;  3L74 D;  5AVS B;  2HLO A;  3I5C A;  3M9B A;  5KJ7 A;  2E42 A;  4UB6 E;  4L76 A;  2Q6Q A;  1AJY A;  4WY4 B;  1T3U A;  1KFM A;  3JSV C;  5CMZ A;  1L0L D;  1NU1 K;  1NTK D;  2AXC A;  3V2P A;  3S4R A;  1KMI Z;  3BCC E;  1KIL D;  1RF0 C;  5CJ4 A;  2WPQ A;  4PD4 D;  2HPC B;  1D7M A;  2B87 B;  1LNQ A;  2HPC A;  3A0H H;  3VN0 A;  3CI9 A;  2RH0 A;  1X22 A;  4H13 C;  2QJK C;  4D6T E;  1DD4 A;  2A06 G;  1RQV A;  4H44 D;  4OWF A;  5AW7 B;  2G8Y A;  1HJ0 A;  3MUD C;  1J1D B;  3WUU A;  1H8A A;  2W27 A;  4JPZ B;  3RK3 D;  3CCM P;  1HJB A;  1T2K C;  1R5S A;  2FYU E;  1DH3 A;  3KZI H;  2YNY A;  1Q90 D;  1FOS F;  1NOH A;  4IFD K;  1EDJ A;  1VQ8 P;  1FAV A;  2XKM A;  3L36 A;  3JCU H;  1NTM D;  2FXM A;  1RE4 A;  1NAF A;  3AEC C;  3L74 E;  2P2U A;  1P84 E;  4Y99 C;  4C46 A;  3HUS A;  1LTT C;  1LTI C;  1T6A A;  5EFW B;  3WUV A;  3RL0 C;  1URQ C;  2IYO A;  5APV A;  1VQ6 P;  2K9J A;  3CCV P;  1HGZ A;  2A45 I;  3D71 A;  2XND H;  3IF4 A;  2FKW B;  2ZYD A;  3GG2 A;  3RGU A;  3CC2 P;  1FU1 A;  1L4A A;  2H88 C;  3RK3 E;  2WSF H;  3FXD A;  5APQ A;  3M91 A;  3IAO A;  1PZQ A;  1L4A C;  1QVG O;  2O01 J;  3M06 A;  2JO1 A;  2WT7 A;  2IPP A;  5B66 E;  2KOG A;  3CCL P;  2I1J A;  2HFE D;  1W2B O;  1FDI A;  1VF5 C;  1JCD A;  1OW6 A;  1SQV K;  1KFN A;  2B87 A;  2FYN B;  2M0B A;  3PH0 A;  1YTZ I;  5AVU B;  1S1C X;  3N4X A;  3H1L G;  1SQQ G;  3E1R A;  1NTZ J;  1LT9 A;  3BCC D;  3I55 P;  1KTM A;  1LT9 B;  1MZ9 A;  3GHG A;  1OVR A;  2IBZ E;  3HTK B;  1U7J A;  1QEX A;  2HR3 A;  4GIF A;  4KJM A;  3AE3 C;  2H43 A;  4AQR D;  3CCJ P;  3IFM A;  2XU6 A;  1SQB K;  1IO4 A;  4K35 A;  3V2Q A;  2DW3 A;  2P58 A;  3CXH E;  3VOP A;  3CCR P;  3Q5S A;  1U7M A;  3VP8 A;  1QGK B;  2GM4 A;  4EYY Q;  2XNX A;  2WWW A;  2ZYA A;  3EQ2 A;  3HUS B;  2Q9I A;  2R32 A;  1CI6 B;  1RH5 B;  2IX7 C;  3TF5 A;  1VF5 B;  2FYN C;  1DX7 A;  4MN4 C;  1G2C A;  2E76 C;  1FDO A;  1JY3 O;  1G2C B;  2I1K A;  2NPS C;  4L73 A;  1FZA A;  3KHU A;  2AEM A;  4U3F E;  2AXT E;  1FZC C;  2YO3 A;  1GL2 D;  1EZV E;  3L74 J;  2V4H A;  3QH9 A;  5BVZ A;  1BSH A;  1NO4 A;  1GZL A;  2A06 D;  2IDB A;  1HTL C;  3L75 J;  3B5N C;  1G1J A;  1SFC B;  2KSE A;  1G1I A;  3AE5 C;  5H2F E;  1LTG C;  5AVZ B;  1KIL A;  4YXD C;  3VP9 A;  5CCH C;  3U1C A;  2KP8 A;  3BRT B;  4TT3 H;  3FXE A;  1KQF B;  2O1J A;  3EFF K;  2JJL A;  3L71 E;  1CZQ A;  1SQX G;  1AQT A;  1NGM B;  4GDO A;  1SQX D;  4ASW A;  2O01 N;  3WMM 0;  1SQQ E;  1JB0 J;  3D70 A;  3CME P;  1N2D C;  3G3Z A;  4C7R A;  1MKM A;  1N8R Q;  2B88 A;  3F5H A;  1L0L G;  1NTZ E;  2Q1K A;  3KXD A;  1OW7 A;  2OQQ A;  2PGD A;  2WSC H;  3CL3 D;  1LWU B;  3H1J E;  1Y47 A;  2WIT A;  2WVR A;  1M8O B;  2QM8 A;  3HE5 B;  3NMD A;  1L0N G;  2CPS A;  1NU1 J;  1AA0 A;  2N1T A;  2QRX A;  3TNU B;  5BU8 B;  3A0B H;  3TGU G;  3MHV A;  2LXC B;  1PPJ E;  4O9B A;  1L0L K;  5APW A;  2K88 A;  3CLQ A;  3D6Z A;  2KLU A;  1K8A Q;  1AVO A;  3V4Q A;  3EFG A;  2Y0D A;  4BWN A;  4UB8 H;  3G9R A;  3CXH I;  4U3F G;  3C1L A;  3O6Q B;  1J1E B;  1LTJ C;  3AE9 C;  2KI7 B;  2K3R A;  3H32 B;  1BGY J;  4I6M C;  3VYI A;  1QVF O;  1DEE G;  2M8R A;  1LJ2 A;  2ZVO B;  1LTS C;  3HTK A;  3P8M C;  2VRS A;  3JC2 2;  3UIA A;  1M1J B;  2C9N Y;  2AEJ A;  3KYQ A;  4PJ0 E;  2WSE H;  2L5G B;  2R44 A;  1YJ9 P;  3H1I G;  3L4F A;  4EI2 A;  1VF5 D;  1L0L J;  5AW0 B;  1BE3 E;  1PV3 A;  2H7H A;  4I2L C;  4JYB A;  5B66 H;  1DD3 A;  2YMK A;  5BU5 A;  3CCU P;  4PJ0 H;  3L72 D;  2K1A A;  3M0D A;  1L0N K;  3G6E P;  3FGA D;  1SFC D;  4PD4 H;  1URQ D;  1NTZ K;  3L70 J;  5KLI B;  3ABV C;  1LP1 B;  3O6Q A;  5KLV G;  2IFN A;  2FFD B;  3PLN A;  3E7K A;  2XDJ A;  3L73 D;  1M1K Q;  1M1J C;  1Q86 Q;  1PPJ D;  1MFT A;  2H89 C;  1PGJ A;  4L75 A;  1N7S C;  1JMB A;  1L2P A;  1ZRT E;  2R5B A;  1SQP K;  1GL2 B;  2IFM A;  3R4Y A;  1LTJ A;  4W80 A;  2OYH B;  3KDP B;  3ITK A;  1KYO I;  2K9J B;  2UWJ E;  1BE3 J;  2YXR B;  1LT9 C;  4IOI H;  1IZN B;  5KAF H;  1RF1 C;  2WSS H;  4I7Z C;  3HRN A;  3NXS A;  1SQX E;  4XE5 B;  3CWB E;  1X9V A;  3H1K E;  1U57 A;  3GW6 A;  1WRG A;  4W7Z A;  3AE7 C;  1SQB D;  2ZAE B;  3B4S A;  3N7N A;  2KYV A;  3TSI A;  4I1L A;  3HUS C;  2Z4E A;  1HBW A;  1VQ5 P;  5H2F H;  1H89 A;  3RK3 B;  2WQY C;  1K73 Q;  4HJG H;  4YTP C;  1EZV D;  1M56 D;  1SQB E;  1EZV I;  1OXZ A;  3KPE A;  4A7P A;  2PFX A;  1WT6 A;  5AVQ B;  3S1K A;  1PFI A;  3VMX A;  4NPE A;  2KS1 A;  3M0D C;  1JNM A;  2WZ7 A;  4EIJ A;  1M1J A;  2MJZ A;  2YIU C;  1RE3 A;  4I7Z B;  5DJT B;  2AXT H;  3H25 A;  1PGQ A;  1SFC C;  1YJN P;  2ZXE B;  3CMA P;  2W83 C;  1S72 P;  1Q82 Q;  3OA7 A;  3SFD C;  1SQV E;  2R3C A;  4ZNC A;  1FE6 A;  3Q1M A;  3L70 G;  3MGN A;  3ZDM A;  3I56 P;  3V2N A;  1FBM A;  2K9Y A;  2N9B A;  2KSJ A;  3CPW O;  2GUV A;  5E79 E;  2V7Q J;  3RK3 C;  2QG4 A;  3L35 A;  2CK3 H;  2QJK B;  3L73 E;  2IBZ D;  2QJY C;  4TLF A;  2C9L Y;  2JR8 A;  3B5N A;  1OFC X;  3AE2 C;  2P67 A;  3FWL A;  4GOF A;  5C39 A;  1KB9 E;  4UB8 E;  5GTH H;  3V5B A;  3RBZ A;  4Z1M H;  1NU1 G;  2XZR A;  2QIW A;  1QL1 A;  3CX5 E;  3PRJ A;  3SWK A;  4K3A A;  3W67 A;  2Q3E A;  5B5E E;  2Z5I A;  2JWD A;  2OYO A;  5AW8 B;  1SQP E;  2KNC A;  2KNC B;  2NZ2 A;  2JWA A;  2YKQ A;  1KB9 H;  1S5L X;  3A0B E;  3GHG C;  3TK1 A;  4N78 E;  1URQ B;  2M5A B;  3H1L D;  3L71 J;  5APY A;  3T97 B;  1SQV J;  3RL0 D;  5B5E H;  3A0H E;  3B8E B;  2BCC G;  1YIT P;  2FYU K;  1KC8 Q;  1BCC G;  1SQQ J;  1KD1 Q;  1BDC A;  2ZJS E;  4DZO A;  3H1J G;  2P7J A;  2W6A A;  3A3Y B;  5CJ0 A;  1YI2 P;  1GU5 A;  1VQ7 P;  3PTZ A;  1AQ5 A;  1JO5 A;  5APS A;  1Q2N A;  2RMZ A;  5AW6 B;  3L70 D;  2R5D A;  2Z5H A;  1VQ4 P;  1OX3 A;  2KUB A;  1H0T A;  1QL2 A;  3M9H A;  2POH A;  1S9K E;  1Y8A A;  1YBK A;  3JCU E;  1VQM P;  3G71 P;  3CCE P;  1OZH A;  1X79 B;  2E74 B;  4N3Y B;  2FYU D;  3HD7 D;  2HG5 D;  4NPD A;  4OVN F;  5AW1 B;  2BCC J;  3O8Z A;  2PP6 A;  2RN0 A;  1FZF A;  1FC2 C;  5KLV D;  2KS1 B;  2LR2 A;  3H1H J;  1QLE D;  4RKU J;  1GU4 A;  3BVH A;  1RE4 C;  3NTN A;  1VL2 A;  4JBZ A;  1X8Y A;  2K37 A;  1BGY E;  4WBA A;  4ZKP A;  2Y0E A;  4JQ0 D;  3RK2 B;  2Q5U A;  1FZG A;  2FFD C;  4PD4 E;  3H1I E;  3P8C D;  4DJG A;  1P84 I;  1N7S A;  3LID A;  4LGD E;  2OAR A;  4QMA A;  1XTC C;  2BCC D;  3R2P A;  5AW2 B;  1NTK E;  1DEB A;  5CCG D;  1L0L E;  2FXO A;  1IFJ A;  3L75 E;  3T97 A;  2OYH C;  1EDK A;  3WU2 E;  1JTH B;  2E74 D;  2JEE A;  2NPS B;  2PAJ A;  4WY4 C;  3CCS P;  1GD2 E;  2OTL P;  3CC4 P;  4BXL A;  5CHX A;  4WY4 A;  4R4M A;  3F89 A;  1JY2 N;  1RF0 A;  3A2A A;  2WT7 B;  3OW2 O;  4Y28 J;  3WU2 H;  1UII A;  1EDI A;  1N73 A;  1BCC J;  3L72 J;  1N73 B;  2HOD B;  2LKM A;  3H1H G;  2ZVN B;  5GTI E;  1YTZ T;  3EWK A;  4H13 B;  1IK7 A;  3HD7 A;  1YQ4 C;  2J58 A;  1SLQ A;  1AVY A;  1FS0 E;  1RF1 A;  1NU1 E;  2N9Y B;  1LP1 A;  1NTK J;  2QEX P;  4IL6 X;  2M3B A;  2NPS D;  3C9I A;  1JCC A;  1IK9 A;  2GA1 A;  1BDD A;  1JTH A;  3K5B A;  1M90 Q;  4AYC A;  4NPF X;  1JY3 N;  1BCC D;  4ZMD A;  2PRR A;  1VQN P;  2ITA A;  1SQP J;  4OGQ D;  4Y99 B;  1RHZ B;  1ZW0 A;  2RKL A;  4PV1 D;  2BCC E;  2QE7 H;  3TDK A;  3FWN A;  3RL0 B;  5GTH E;  1GK6 A;  3H1I D;  2YO2 A;  1PP9 J;  2WSE J;  3L71 G;  1YJW P;  1PP9 G;  1VQO P;  1BGY D;  1BCC E;  5L8R J;  1K04 A;  5AVW B;  1VDF A;  1NJI Q;  1KQG B;  2C0X A;  2G3A A;  5CCG C;  3H1L J;  1NHL A;  5AW4 B;  2XV5 A;  5KLV K;  2FYU G;  2YKO A;  1L4A B;  1SQB J;  3M9Q A;  1H88 A;  2H8P D;  5E79 H;  1IC2 A;  2W8Z A;  3RK2 D;  3TGU J;  3WUT A;  1T2K D;  1SQQ K;  2ZT9 C;  5AVT B;  4N6J A;  3TNU A;  2FFD A;  3HD7 B;  2B9B A;  2HOD A;  4OGQ B;  2QM7 A;  2R3S A;  4JF7 A;  3GF7 A;  4UB6 H;  1KQS O;  1JY2 O;  4PV1 B;  1WMK A;  3CX5 H;  1A02 F;  1T3J A;  3VMY A;  4GOD A;  1LTA C;  3L70 E;  4B86 A;  3GHG B;  4RES B;  1SQX K;  2P10 A;  1KN7 A;  1KYO D;  2D2C C;  1NTM E;  3VMZ A;  1JUN A;  4RJT A;  1NTM G;  3A5T A;  1LWU A;  2OYI B;  4YPC A;  3L73 J;  3PJS K;  4W7Y A;  5KLI C;  3TYY A;  2Q3I A;  1PGO A;  3H1I J;  3L75 D;  3H1L E;  1PP9 D;  3A7O A;  5CCH D;  3L75 G;  3Q5P A;  1L0N J;  4D6T D;  1VQP P;  2HYN A;  1NTK G;  5K5G B;  3SWY A;  3P8C E;  2WPS A;  1SQB G;  2YXQ B;  4OGQ C;  1OVV A;  3AEA C;  4C7N A;  1VQL P;  2BEZ F;  4PV1 C;  2KZI A;  1FZE A;  1SQX J;  3Q3D A;  1KB9 D;  3C8V A;  1KIL E;  1KB9 I;  2D2C B;  2MKV A;  5TJH A;  2ZYG A;  3SFE C;  2J5U A;  3VTP C;  5KLV E;  3GLM A;  1RF1 B;  5KKZ C;  1EXI A;  1P84 H;  2WSC J;  4LLH A;  3CD6 P;  3QWO C;  3TGU E;  1T8Z A;  2OYI A;  1VQK P;  1KIL C;  1JY3 P;  5CCH A;  1S9K D;  4H0L B;  3LIE A;  3L74 G;  4L74 A;  1NAY A;  1N7S D;  2KLV A;  5APX A;  1M7L A;  5CBO A;  1VQ9 P;  1J1D C;  2KXP B;  3VMA A;  2QA4 P;  1OWA A;  1MV8 A;  1N7L A;  4LC1 A;  2IBZ I;  2JDI H;  4R4L A;  1BSN A;  1GTW A;  1IFM A;  1GDT A;  1L0N D;  3OJA B;  2NRG A;  4U7J A;  1LWU C;  1TU3 F;  4D6T J;  4XFJ A;  1PIX A;  5KAF E;  2AEF A;  4AUW A;  4GOE A;  5KKZ B;  3V6I A;  4WY4 D;  1KV4 A;  4C7N B;  4N78 D;  1HGV A;  2FYU J;  1QX8 A;  3SSU A;  1SFC A;  2IYP A;  2FXP A;  3HE5 A;  1KYO H;  1NTM J;  1SQP D;  1KIL B;  1HH0 A;  3CX5 I;  5TIS H;  1R8E A;  2I8D A;  3CX5 D;  3CWB D;  3H1K D;  1J2J B;  2ZXX A;  1EDL A;  1NTZ G;  1OVU A;  3KQG A;  5AW3 B;  1J1E C;  1LTJ B;  5GTI H;  1IFD A;  1NH4 A;  3H32 A;  1FJP A;  4EDF A;  1RY3 A;  2E75 C;  5TIS E;  4WB4 A;  2OGU A;  3LW5 J;  3AEF C;  1FOS E;  1GMJ A;  3AED C;  1OMI A;  1ZRT D;  1NTK K;  2C0W A;  1HVV A;  3MD0 A;  1H0T B;  1SQV D;  4DOJ A;  1M57 D;  2IZ0 A;  5DJU B;  1SQV G;  2IZ1 A;  3AE1 C;  1S2E A;  4GKG A;  3USS A;  1NWQ A;  3AE4 C;  3RL0 g;  2L91 A;  4HB1 A;  2P1J A;  2N1T B;  2O01 H;  2Y9Y A;  3H1H E;  3HE4 A;  3L72 G;  5M1B A;  3PHL A;  4IFM A;  1CW5 A;  1FDM A;  1IFI A;  4IL6 H;  1JM0 A;  3U59 A;  2QJP B;  1SQP G;  2WSF J;  3P32 A;  3AE8 C;  1JMM A;  3E1I A;  1EZV G;  2QSI A;  3D6Y A;  1LGH B;  3MTU E;  5APU A;  3MIW A;  3HD7 C;  3OAK A;  4IL6 E;  4ASV A;  1N7S B;  1ZXG A;  3BAT A;  1GL2 C;  1FZC B;  2WPR A;  4RO0 A;  3BAS A;  4JYC A;  1SS1 A;  1S4X A;  1URQ A;  3LW5 H;  2E76 D;  1FZB A;  3MUD A;  1SVF A;  3GMA A;  5AVX B;  1UIX A;  1SP4 A;  1ZOY C;  4IFF A;  4CPG A;  1E79 H;  2E5Y A;  5CCG A;  5CBN A;  2QJP C;  3CC7 P;  1MFZ A;  1NYH A;  2JP3 A;  3GF3 A;  2E43 A;  3B5N D;  4EOT A;  2WTY A;  1HF9 A;  2FY8 A;  4H13 D;  1AFO A;  4PD4 I;  5APT A;  3TGU D;  1CI6 A;  1Q7Y Q;  2E75 D;  2OTJ P;  2KK7 A;  3HE4 B;  4GT1 A;  1HUC A;  2SPZ A;  2YKP A;  3II6 A;  3MP7 B;  1VPC A;  2V7Q H;  3V4W A;  4KHX A;  2M5A A;  1Z56 A;  2FYZ A;  1GL2 A;  3G4S P;  2OTK E;  4KT0 J;  1EQ7 A;  1NTZ D;  1NTM K;  1ZV8 A;  2BAS A;  2BEQ D;  2YIU B;  3CWB G;  3FX0 A;  3H1K G;  3H6P A;  5AVY B;  3L72 E;  1SQQ D;  3H1J J;  5KJ7 D;  2ZFC A;  3Q2Y A;  3BRV B;  1PGP A;  4ZKU A;  2B89 A;  3BCC J;  2KIK A;  1PP9 E;  1BE3 D;  1X0T A;  4BRY A;  2GUS A;  5KTB A;  1BE3 G;  1ZR4 A;  1N73 C;  3PP5 A;  1ZP0 C;  2FBW C;  2N1T D;  1KZU B;  4H0L C;  5KJ7 C;  2QVA A;  1L4A D;  2CPB A;  1KOR A;  3KZI E;  2Y0C A;  2A45 G;  2IBZ G;  4HYT B;  1OW8 A;  4YXW H;  4HH2 A;  1KYO E;  1GW3 A;  2A06 E;  1RQU A;  1NKN A;  2QJY B;  3AEG C;  1YYC A;  3IN6 A;  5AW9 B;  4HKZ H;  1S3J A;  1NKZ B;  5KLV J;  5KAI H;  3SWF A;  1DIP A;  1YQ3 C;  3H1H D;  1LTB C;  2Y9Z A;  3IR9 A;  3CCQ P;  1EXJ A;  1KQL A;  1ZN5 A;  3L73 G;  4U3F J;  4WVZ A;  4XA4 A;  3S9O A;  1IFN A;  3L37 A;  1Q81 Q;  1Y9B A;  2JKV A;  3CXH D;  1K9M Q;  4OH8 B;  5KAI E;  1IFP A;  1EC5 A;  3CXH H;  1FZC A;  1S5L E;  5AW5 B;  1JEK A;  3BCC G;  2OYH A;  3H1J D;  1IJD B;  4DCK A;  1FJK A;  3P7K A;  1USE A;  3MZW B;  1ZLL A;  2W90 A;  1USD A;  1XTG B;  2E75 B;  1GK4 A;  2ZT9 B;  1RE3 C;  1S5L H;  1YHQ P;  1YIJ P;  3W68 A;  3Q5R A;  4D6T G;  1JY2 P;  3L71 D;  1K05 A;  1MUU A;  4H44 C;  4BRY B;  2E76 B;  1W5C E;  1BGY G;  1NVO A;  1OIP A;  2NPS A;  2A45 H;  2D2C D;  2KB7 P;  2W6J H;  1LT1 A;  2YMY A;  3AEB C;  2E74 C;  3NFQ A;  3U1A A;  3RBX A; 
#chains in the Genus database with same CATH homology
 2KNC A;  2K9J A;  2M3E A;  2K1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...