2K9SA

Solution structure of dna binding domain of e. coli arac
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
MDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arabinose operon regulatory protein
publication title Solution structure of the DNA binding domain of AraC protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2008-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2k9sA00
4XK4A 4DYCA 2K9QA 5J1UA 1POGA 4IHVA 2VI6A 5E3LA 4A3KJ 3OOUA 3ZQHA 2ZB9A 2K9SA 2LR8A 1PUFA 3OIOA 4M3GA 3ZQLA 1ETXA 4MFEA 1Y1VJ 2EH3A 1MBJA 4A3JJ 2ID6A 4A3DJ 3D1NI 2R5YA 2E19A 2FJ1A 2L7FP 3S1RJ 2HQ5A 4W1UA 2DA2A 1U8BA 1Y1WJ 2DMPA 3K2AA 5FLMJ 5EZHA 2AHQA 2L7MP 1H8AC 3Q3SA 3GTKJ 3HDDA 3BTLA 2O7OA 2O8KA 2WB1N 4A3BJ 3BQYA 4BKXA 1I50J 1ETYA 3HKZN 5EZGA 4C3JJ 2OF7A 5J1YA 1UMQA 3LOCA 9ANTA 1LE8A 1WI3A 2LK2A 3G1LA 4A3FJ 1R9TJ 1IDYA 5IP7J 3BG5A 2KDZA 5C44J 2NVXJ 3BR0A 3IH4A 1GVDA 4JP0A 1IC8A 3LSGA 1H89C 3Q0VA 1ZKGA 4W97A 4I76A 1MBKA 3BG9A 1B8IA 5K7ZA 3OSFA 1AU7A 4DZJA 5FKOA 4AUXA 1SANA 3PO3J 1I3QJ 2DA5A 2ECCA 4M3BA 5F0FA 3NARA 5FKLA 5GPAA 3RQIA 4D5CA 3FKIJ 2Y31A 5J1RA 1OCPA 1UG2A 4AYBN 3BQZA 3LSJA 1ETWA 3ZQGA 3IH2A 1ETKA 1ZK8A 5IP6A 1TWGJ 4BBRJ 2MGQA 3BG3A 1TWFJ 3LNQA 2LLKA 1ZQ3P 1MBFA 3MKLA 3BTIA 1F36A 2CJJA 4JX6A 3QPSA 1MH4A 1JKRC 1ETQA 1JKOC 1GV2A 2DMTA 1GUUA 5HODA 5M5XJ 1DU0A 1MSEC 4C3HJ 2D5VA 2E2IJ 2DTZA 1PUFB 2R93J 5IOZA 2B63J 1ETOA 2L9RA 2W48A 1A6IA 3HM5A 4M6VA 4IHXA 1JT0A 1MNMC 1F43A 3NAUA 4HNVA 2XPVA 4I6ZA 2L7ZA 2XB5A 2R5ZA 2HXIA 2GBYA 5E3MA 1GDTA 1Q1VA 2DA6A 5EGOB 4RDUA 3SJMA 4A3CJ 1JJ6C 5C3EJ 3PM1A 2DA1A 1B72A 3A01A 4NDLA 3TP3A 3LSPA 2HXOA 1FJLA 4FISA 2DA4A 1RETA 1UHSA 2NS8A 4IHWA 3RZOJ 4BXXJ 1IDZA 4Y52J 2JWTA 2TCTA 3S2HJ 4D7MA 1TWAJ 4XRMA 3JREA 2DA3A 1U78A 1ZR2A 2MSYA 4DYQA 2VUMJ 1ITYA 1BA5A 2DA7A 4BY1J 2M34A 2K9NA 3GTGJ 2YS9A 4IHYA 1ETVA 3QPLA 1K61A 2VKEA 1K83J 1HDPA 4AC0A 1B8IB 2XPWA 3TW6A 5EGOA 3H0GJ 3I4MJ 3JRHA 1LFUP 5FKNA 2NVTJ 2LTPA 4IEJA 2HI3A 2XPUA 5F0HA 2YU9J 1FTZA 2DJNA 2ME6A 2X48A 5IPAA 2M2EA 1HF0A 2O9LA 3SFIA 5EEAA 3TEDA 3JR9A 2HOTA 4UUSA 3B6CA 1FIPA 5EYRA 1APLC 3IH3A 1JTXA 1JUSA 3UKGA 1IGNA 3JRCA 3F0CA 3ZQIA 1DU6A 2E1OA 1WH7A 4BBSJ 2DMUA 1MBHA 3O8HA 4M3EA 4B4CA 2ID3A 1Z0XA 4FCYA 2FX0A 4XRSA 2R7ZJ 5M3MJ 1GV5A 4C3IJ 1MBGA 1OFCX 1RR7A 5F08A 3WHCA 2XB0X 2DMNA 1FIAA 4A3GJ 2VPRA 3JRAA 5IYCJ 2M0CA 3A02A 1BW6A 4A3MJ 5EG0A 2R5ZB 5IOYA 4FE4A 1OCTC 5M5WJ 1BJZA 1U9NA 1HLVA 2EZIA 1B72B 3A01B 2YUSA 1JUMA 1JTYA 2NVYJ 5JLXA 2NOGA 2HOAA 2CUFA 5E3OA 2E2HJ 3O8GA 1A5JA 3JRIA 5BNGA 2FQ4A 2VKVA 1JKPC 3HBLA 4MO7A 1ZR4A 4X6AJ 1FTTA 1RKWA 3CMYA 2IEKA 1G2HA 2HOSA 3CCYA 3DCFA 5GP9A 3GTLJ 2G0EA 4S0HB 3S15J 4L5EA 4GFBA 1IRZA 2N8GA 3BTJA 1TWHJ 4DW6A 1ORKA 3HOXJ 1E3OC 1H88C 5J3LA 4C2MJ 4LOCA 3ZQCA 2Y9ZA 1VF9A 4RBOA 5K7HA 3S1MJ 3GTMJ 1VFCA 2X9DA 2JA6J 3G1OA 2H1KA 2Y30A 3B6AA 3S2DJ 1NTCA 3BTCA 1D5YA 4DYRA 3HGGA 5IYBJ 2DMQA 1RPWA 4UUSB 5C4XJ 1W0TA 2GM4A 5E3NA 3HEFA 3JRFA 2QF7A 1QVTA 4Y7NJ 4XRSG 3RKQA 2GLOA 2EZLA 5FLVA 4A93J 3FIWA 5EDNA 1U9OA 3QQAA 1HOMA 3JRGA 2EQRA 2CQXA 2I10A 4EEFG 2WV1A 2KT0A 3HOVJ 2XGCA 2JA5J 2H8RA 3RZDJ 4MFDA 3Q0UA 4ABZA 4CYCB 1XS9A 3CDLA 1AHDP 1TC3C 2ECBA 3SDGA 5GPCA 4BY7J 3HOUJ 4A69C 2LD5A 5EG0B 1O4XA 1MSFC 1VI0A 5FKMA 1X2NA 4G12A 1RKTA 1LFBA 1HCRA 2CU7A 3A03A 1MBEA 2HYJA 5C4JJ 1JGGA 3BR3A 2LFBA 2JA8J 1QPIA 3DEWA 3E7LA 4QIWN 3PO2J 4M3DA 3WHBA 2CQQA 4FE7A 4JX5A 5M5YJ 2ELKA 4JYKA 5F04A 1JT6A 3JRBA 5IP9J 3I4NJ 1YRNA 2TRTA 2COBA 2Y0SN 2CUEA 4A3IJ 1TWCJ 2NS7A 3VPRA 1T56A 4DZPA 3JRDA 3S1QJ 2IBDA 1RESA 3BR6A 1IJWC 2K40A 1X58A 2R92J 3HOWJ 2OPTA 4FTHA 3GTQJ 1GT0C 2QCOA 3IV5A 4D5FA 4CYCA 2M8GX 2XRLA 3G1MA 1S7EA 5FJ8J 4J19A 1WH5A 5DS9A 3H3VK 3L1PA 5K7FA 4A3LJ 1SFOJ 3ZOBA 3HOYJ 1EF4A 3GBGA 1WCMJ 2MG4A 3MN2A 4XICA 2WAQN 5F27A 3TW7A 1JKQC 2DN0A 1AKHB 1JJ8C 1P7IA 2EZHA 3HB9A 1T33A 4V2GA 1BW5A 3M3YJ 1QRYA 4MIMA 2XSDC 2HDDA 3W6VA 2EBIA 3FK7A 3OSGA 1XG1A 1FEXA 2X6OA 4B3AA 2E2JJ 3M4OJ 1XC5A 4D7NA 5JLWA 1X2MA 3GTJJ 1NK2P 3S16J 4V2FA 1ZTRA 2LP0A 4MLOA 2RAEA 5IYDJ 2M9HA 2Y2ZA 2XGDA 3HGYA 1ENHA 1IV6A 3C2BA 3FISA 5DTDA 2PMZN 2MW8A 2JMWA 3BT9A 3BR1A 2LKXA 2IAIA 2JJ7A 4A3EJ 2EZKA 4B1RA 1WPKA 1OJLA 5FKKA 3K7AJ 3GTPJ 2FD5A 4XIDA 2JK3A 1IG7A 3MVPA 5M3FJ 4UUTA 2R0QC 1AKHA 1CQTA 3Q0WA 5EF6A 3LSRA 1Z77A 2L0KA 3S17J 1I6HJ 1JUPA 1P7JA 2ME0A 3ZQFA 2JA7J 2Y9YA 3S14J 3BR5A 3GTOJ 2R5YB 1MH3A 1HDDC 3S1NJ 1VNDA 1W0UA 1IUFA 2CRGA 1YRNB 1NK3P 2P81A 3HOZJ 4QTRA 2JN6A 1WGXA 1BL0A 3CQZJ 4M3FA 3BR2A 5F1JA 2LVSA 2AO9A 2XGEA 4QSHA 1QVUA 2LY9A 4X1EA 4JX4A 3TP0A 1ZGWA 5F0CA 3FK6A 1LE8B 2NVQJ
chains in the Genus database with same CATH superfamily
4BHPA 4XK4A 3QYBA 3C2HA 4BGDA 3CCJI 3FXJA 3MQ0A 2EWNA 4LIVA 4HQMA 4A3KJ 3OOUA 2CWEA 2NRAC 3ZQHA 5L3FA 1J9IA 2ZB9A 4CCJA 1PUFA 3CLQA 2L9NA 3ERMA 1MJ9A 2V7FA 2A6EF 5LRSA 5GTHC 3WGIA 3JAMZ 3NWTA 4C2TA 3A0BC 2NNYA 3S1RJ 1FPQA 3JSPA 3L9FA 1UHWA 4OAYA 1JXSA 3DP7A 2JZYA 2AHQA 4KMFA 3Q3SA 4CSWA 4ZDPA 5TISC 2O7OA 2WB1N 2XSJC 2FEZA 2FBKA 3BQYA 2HYGD 5EZGA 1H0MA 1UMQA 5BPIA 2QSGX 4A6EA 2QZ8A 2WAEA 4XNFA 2H94A 3L00A 3F21A 2ZFUA 1IDYA 2BBYA 2FBIA 3KEOA 6PAXA 3K2ZA 1Y6IA 2NVXJ 1TZLA 2EV0A 4BU2A 2G7HA 3PUBA 1H89C 2A6TA 2XV4S 3Q0VA 1ZKGA 4RAZA 2XASA 4BXFA 2E7XA 3COAC 4BE0A 2E36A 5K7ZA 1E3HA 4DZJA 2LRDA 1Z67A 2DODA 1SANA 5FFZA 4LITA 2V4JC 2XVCA 1F1ZA 2RDPA 5FKLA 1LJ9A 2Y31A 2DOAA 4M9SA 2IT0A 3BCBA 3IAS2 5IP6A 4XONA 1Z3YA 3C3WA 1D3YA 2VQGA 1LFPA 3L7WA 4WXCA 1VQ4I 1ZQ3P 1O7FA 4BL0B 1SC7A 3MKLA 2XHKA 1ZELA 4Y33A 2DFIA 3MFKA 2BGCA 3DV8A 1JKOC 2Y69H 4HA8A 3CCLI 5LEJA 1UELB 5ILUA 1GUUA 5HODA 1DU0A 1QA6A 1JGSA 2D5VA 2E2IJ 2P7VB 2WY8Q 2DDBA 2FMYA 4ENMA 3R4KA 1D8JA 4Q48A 2B63J 1ETOA 4XN0A 3CC7I 2FF4A 2VC1A 2VPLA 1LUJB 2LBFA 1JT0A 1F43A 4ZYAA 4I6ZA 2JT1A 4ZDLA 2IGOA 2L7ZA 1BR2A 2R5ZA 4A3CJ 2DA6A 2ESHA 3NQOA 3GYHX 5LBQA 2R7FA 4XSZF 1LVAA 2DA1A 3R6SA 2PFBA 3ASOH 1FNNA 1D1BA 4FISA 1CGPA 1RETA 2ISYA 3O3KA 4PFOA 1X4PA 4ZZLA 5B5EC 2ESNA 3L2UA 4ITVA 3I71A 3L2CA 3RDIA 2QQ8A 2DA3A 1RC9A 2MABA 4NUBA 1L0OC 4DGWB 3NRVA 2A68F 2V9VA 2EFPA 4U0WA 3BY6A 5TGTA 5H6QA 4L9NA 2JSPA 2DJIA 1LDJA 2NNNA 4BY1J 2YX7A 4ZJZA 2GXAA 2YS9A 1XMAA 4IHYA 1VQ5I 5FFXA 2JPBA 2NAZA 1ZN2A 2MBFA 1HDPA 4G6QA 1R5GA 3FDYA 2VB6A 4AC0A 4E7SA 4EVIA 5FGMA 3QU6A 5EGOA 4L9TA 3G2BA 4PJLA 4XORA 3BG6A 2EIMH 5FKNA 2CQ7A 4IEJA 4E7HA 2XPUA 1KA8A 3BP8A 3OMYA 5IPAA 2H6BA 5DM6F 5EEAA 4EATA 3W6JB 4HRIA 1T98A 3HZJA 3JR9A 2HOTA 1WI9A 3B6CA 3K9TA 3TQNA 4EMSA 4OIQF 1UB9A 1OPCA 3C7JA 4OMYA 3U1KA 1K6OA 2P5KA 4QPQA 3TO9A 1ZRCA 3SEZA 1SVOA 2ETHA 4Y13A 3W2AA 4QLCU 2DMUA 4BBSJ 3R61A 1Y8QB 5K1YA 3HUGA 4HPQA 4A12A 1G59A 1Z0XA 1VQNI 5IT9K 2PJRA 1WWXA 4I01A 5KNLA 3LSKA 2KL4A 2NXNB 5FD5A 5HLGA 2G9WA 2R7ZJ 4DJAA 2STTA 3EYIA 1YTYA 1OFCX 3PFYA 3DQVC 2F6CA 3GW2A 3BROA 2ZFWA 1D0XA 2XUBA 3FMSA 4RM3A 5J8CA 1X1AA 2M0CA 3H5AA 2OBPA 2HWVA 5HDNA 1BW6A 5EG0A 2QVOA 4PDKA 5IOYA 2QYOA 1IRXA 2CG4A 2DK8A 3VODA 5ICCA 3FZVA 1HSTA 3P9IA 3DBLB 2MD0A 3GF2A 5D5UB 1B6AA 2DYSH 1DPUA 2F48A 2ZMEC 3CCSI 2EIJH 1XX5A 2ZCWA 3ERED 1IUYA 1OR7C 2FU4A 1S7AA 5E3OA 2B9SA 3O8GA 1ZYRF 1KZHA 5BNGA 1JKPC 4MO7A 3WTZA 2BY0A 3JSOA 3LSTA 1MJAA 3K10A 4P55A 3FXRA 3F8CA 5GP9A 3GTLJ 4LK0F 4B8XA 1IRZA 4RGXA 4IOCF 2ISZA 3HOXJ 4BHBA 2LKSA 3SHFA 3BC8A 2M30A 3LFUA 4Y3OA 3VDXA 1B9NA 3H1CA 3K1MA 2ZJ2A 5J3LA 5K5QA 2BVMA 4LOCA 2CS3A 2ZNZA 3ZQCA 2Y9ZA 1FYLA 2A69F 4D1QA 3MZ8A 4U0VA 3FKJA 1QNTA 1FMWA 2QM3A 4B09A 2XKOA 2X9DA 2JQ7A 4QPOA 2MA3A 2R7OA 3MAJA 2VJ5A 3I58A 3M1EA 2MD5A 5F64A 1PUEE 3B6AA 2A5YB 3ABTA 2VQCA 1VQ9I 4CCLA 2LH9A 2XRNA 4XBFA 3I55I 1D8KA 3HGGA 5IYBJ 2PJPA 2DMQA 4D0PA 1U8RA 1R49A 3AL0C 2VASA 2HQAA 2CGPA 1MW7A 4I0AA 2X1CA 5KCMA 2QF7A 4U7BA 5D5VB 4FX4A 4PSXA 1QVTA 3Q5FA 1J7KA 4XOTA 2IS4A 3RKQA 4ESJA 2JRMA 5JHUA 4A93J 4HNTA 2OZ6A 4G7HF 1BI3A 1YLFA 5LGUA 4MHGA 1LDKB 4KICA 3QQAA 3E6MA 1HOMA 3JRGA 1S8NA 4YEJA 4E7ZA 4XRFA 5FRNA 3KLOA 2A3SA 4MEYF 1XDUA 1X19A 3K4BA 2Z99A 3RYPA 3V7RA 1ERDA 4KMUX 4F55A 4CYCB 5FLXK 1AHDP 1Z7UA 3SDGA 5GPCA 3H35A 3CMMA 3UNGC 4WCGA 2LD5A 4IQJA 3NEUA 4E7JA 1PVEA 1BI2A 1JE8A 4HLYA 1OCRH 2HQNA 3FXQA 1WJBA 3A03A 1MBEA 2H09A 1JGGA 3IUOA 4UVCA 5FROA 2HYFA 1QPIA 4G9YA 3E7LA 2MYSA 3KP3A 5F1RA 3WGHA 4EM1A 2L9SA 4FE7A 4JX5A 2QSHX 5D6FA 4BQAA 1YJ9I 4XLEA 4PGGA 4FETA 4IHSA 3M07A 4JYKA 3K4KA 5LGNA 1JT6A 1S29A 5HVQC 5CVUA 2HPMA 4BJ6C 3J80Z 4KIFA 2COBA 1YIJI 4A3IJ 1P6RA 2XAJA 2GAUA 2FE3A 1T56A 5A2QK 1X1PA 3BR6A 4ON0A 3H9QA 4B47A 1ZARA 3GTQJ 1R5ID 1R4NB 3ABUA 2VN2A 4D5FA 3BLYA 2XRLA 3E5XA 2HDWA 1MZBA 2JVGA 1BJAA 2KRCA 3G71I 5DS9A 5B3SH 3KZYA 4AIHA 2CUJA 1GLNA 3P7NA 5IY5H 1T0FA 3WG7H 1GXQA 3P5JA 1WCMJ 2K86A 2LYCA 2MG4A 2ZSIB 5ILSA 3OS1A 3CLOA 4IZZA 3LAPA 1JJ8C 1REPC 1MMDA 4NHJA 5ERIA 4IF4A 3Q9VA 4XLNF 1Z6TA 2CQKA 4V2GA 1EH7A 1W36C 2HDDA 2DQLA 4ZYGA 2VLAA 4OOIA 2VXZA 4LK1F 5HS9A 2GIZA 3OSGA 1XG1A 3QP6A 2DDAA 4CH7A 4B3AA 3WG9A 2E2JJ 1J5YA 2BY3A 3M8FA 3P9KA 1YS6A 2A5WA 3U2RA 1CF7B 2LY1A 2K85A 3PQJA 3MKZA 1G8XA 2LP0A 2KKOA 4E7LA 3OR2C 4C30A 1A36A 3HGYA 3HRUA 1SFKA 2O6GE 4GXOA 1WZ2A 2GOMA 2MW8A 3E5QA 3KYLA 4DIQA 1R1TA 2RV8A 4EM2A 3HKZA 2EV5A 4HX4A 2EZKA 4HSRA 1X3UA 2Q2EB 5CPRB 1WPKA 3E6DA 5FKKA 1YHQI 2FD5A 1IG7A 2JK3A 4IKFA 1R22A 3I53A 1OQYA 5M3FJ 3ABLH 4KT5C 3FMRA 3ZMDA 2R0QC 1K7AA 1STZA 4O6JA 2R7XA 1Z77A 4NQWA 1TL8A 1HSJA 5D6EA 1IO2A 1JUPA 4L0ZB 1YI2I 1UAAA 3K4JA 2JA7J 3GTOJ 3W2WA 2AQFA 3S1NJ 1W0UA 2DLLA 5DCMB 3OV8A 5HLTA 5E1WA 2P81A 3K4LA 2W24A 4E4HA 1BL0A 1T08B 3T8RA 5EEHA 4OAZA 2K9LA 5D4RA 3BR2A 1V54H 4H0EA 3CZ6A 3EDPA 1ZGJA 4YIIA 2W4SA 1I1SA 3TP0A 1ZGWA 2CV2A 4E7KA 2NVQJ 4DYCA 4V19K 5HNHA 1EV7A 1K78A 4BQQA 3V8KA 2Z9OA 3IWZA 2VI6A 1FY7A 3CP8A 4XLAA 4D9JA 5BQTA 4IHVA 1X1DA 2CYYA 2K9SA 3P9CA 1BM9A 2LR8A 5H20A 5KVRA 3OIOA 2QEXI 4IVNA 5BS6A 4L18B 4GO1A 2RNGA 2EFOA 3U9GA 1ETXA 1P9QC 1Y1VJ 2EH3A 1MBJA 2MLKA 3E0JB 4XLPF 2ID6A 3EUHC 4ENJA 1UZCA 4A3DJ 5LEKA 2R5YA 4I7HA 3RI4A 2P7CB 1FX7A 2BYVE 1Y0NA 2FSWA 1Y1WJ 4EGYA 2DMPA 1QQIA 1V5GA 3RKXA 1SFEA 5EZHA 5FLMJ 2JVHA 1ZLJA 4EM0B 2BY2A 3MZYA 3CMAI 3GTKJ 1SVMA 4M6YA 2M87A 4A3BJ 2HZDA 3OOPA 2K27A 2QUFA 1ETYA 1PJRA 3LOCA 1LE8A 2HVSA 2V1DA 1PP7U 3CDHA 4A0XA 1TQMA 2IXSA 4B43A 4HF2A 3M8EA 1ZG5A 4Q5SF 2F4IA 1TP4A 5LGTA 1KYWA 3HTSB 3EQLF 1RUNA 2LDUA 1K4SA 4GCVA 1FLIA 3C2GA 3OS2A 3OL3A 4HDUA 2FMLA 2HVRA 3BR0A 3IH4A 4JP0A 4M71A 3LSGA 2E71A 4W97A 1IAWA 2M3AA 4F93B 2DYRH 1IXSB 1YO5C 4U7DA 3HRTA 3LQQA 3OSFA 2QQAA 3DBRB 1U5TC 2BXZA 1R58A 4OMZA 1SAUA 4KT6A 1IN8A 3I9V2 2XF7A 5F0FA 4ZDOA 4YIFA 3FKIJ 3K4NA 4AYBN 3BQZA 3LSJA 1FOWA 2DT7B 1NG6A 3QWLA 4IX7A 4BBRJ 3BG3A 1TWFJ 3WTXC 3ZN1A 3LNQA 5FB2A 1WKMA 2LLKA 3ASNH 2AXLA 2QQ9A 3V7CA 4S05A 2BOLA 5B1AH 1FSEA 2E60A 1HBXG 1OISA 3VSLA 1MH4A 1JKRC 1GV2A 1U2WA 2OCCH 2JUCA 1MDMB 2UWMA 3MKYB 2IVMA 1G4DA 3OWTA 4U88A 1B59A 5M5XJ 1MSEC 4Q47A 2UXXA 4CCKA 3RIRA 4HX8A 4CO8A 4HEA2 3J81K 3HPHA 1Q1HA 2LREA 2BVLA 2R93J 1F5TA 3A2KA 1W1WE 2W48A 2L9RA 3HM5A 4IHXA 2FA5A 3CC4I 2EIKH 2HXIA 1GDTA 4PJMA 4RDUA 3OYEA 1TW2A 2J5OA 1JJ6C 3ZMTA 5C3EJ 3ABKH 1XB4A 4BE2A 2XAGA 2H1LA 3DPTA 1DQUA 4RAGA 4XKWA 3TP3A 2X85A 1FJLA 1TT5B 2BE5F 2X4HA 3S32A 2JA2A 5GAGJ 3KEYA 1O57A 1LPQA 1UHSA 3ZGKA 2JSCA 2OUMA 3QAHA 1SD6A 2TCTA 1UFMA 4CCNA 1TWAJ 3H0DA 2DPDA 3LSHA 4XRMA 3JREA 1U78A 3CTAA 3VYRB 1O3RA 3GZ6A 1T8IA 2VUMJ 1SFXA 3CCQI 4ESFA 2LKPA 3U1DA 3QODA 2M34A 3GTGJ 3NWSA 4RB3C 1ETVA 2HFHA 3QPLA 3DKWA 2GIVA 2W00A 2VKEA 1R7JA 3ZMZA 3OYFA 1A31A 2XPWA 2DFFA 1LQ1A 2IGMA 2E1NA 2LMDA 2L02A 2HVQA 2NVTJ 2LTPA 1KGSA 4B48A 4ANJA 5F0HA 1FTZA 1IN4A 2FOWA 4NC7A 2X48A 5LFAA 2ACJA 2HR3A 3SFIA 2CFOA 3WTVC 3J7ZI 1MJBA 1D0YA 3HSFA 4KJZA 3TEDA 2VQLA 3TMOA 1J59A 2CFXA 4IPAA 5EYRA 1APLC 3DPUA 1VQOI 2X6XA 2VODA 1JUSA 1ON1A 2XAHA 3KP4A 2L01A 3JRCA 3G6EI 3ZQIA 1R1VA 3RPUD 1MBHA 4M3EA 4RAYA 2K02A 1FBUA 3CESA 4B4CA 3BOQA 5EEGA 4FCYA 3ELKA 3PIPF 2M4GA 3O2PE 4MQ9F 2ZKZA 3GFLA 3K1NA 3TDUC 1MBGA 2EA2A 2PMHA 1RR7A 3EPZA 5E18F 1T95A 1FSHA 3ZMSA 1MNDA 2VPRA 3ZMUA 2R7QA 2EV6A 3VB2A 2Z2SB 3V8JA 4KUMA 1UCRA 1O7LA 4FE4A 2P0WA 5M5WJ 4KYWA 2CSOA 1U9NA 4N9HA 2IJLA 2EZIA 3LA3A 4P1WA 4Z6YA 4IRIA 1Z3XA 3K4MA 3WGGA 4B3XA 1B72B 1R71A 2YUSA 4M72A 5JLXA 2E2HJ 2CUFA 3FHNA 5AIQA 2E35A 4M74A 1G3YA 3H9GA 2PLYA 2FQ4A 3HBLA 2ZJRF 4X6AJ 4RGUA 1QO0D 1FTTA 3I59B 5E20A 3VWBA 2PN6A 1RKWA 4FASD 3CMYA 3OYAA 2IEKA 1ZH5A 4I98B 1G2HA 5FD6A 1ZLKA 3QPTA 3CCEI 1T6SA 4HAMA 2VT2A 3CJQB 4L5EA 4GFBA 2N8GA 2VKHA 4UV9A 2F4OB 2ELJA 3ZN0A 1ORKA 1E3OC 2E7WA 1H88C 2E1CA 3MD2A 2VJJA 4Q4ZF 1NH3A 2EFQA 4E6KG 2CH0A 2XAQA 3CCUI 4YG2F 1VF9A 4ZTFA 3EUKL 4CZCA 5K7HA 1I5ZA 1ONVA 2K4BA 4AWXB 4IHTA 4KISA 1W5TA 2H1KA 3LSIA 3E97A 2M7BA 4BUPA 2KDOA 3S2DJ 1NTCA 3N05A 3KCCA 2B0LA 3ZCOA 4GGGA 2V26A 1KQ0A 2NS0A 2BHYA 1MGTA 2WC2A 3FX3A 1LNWA 3HEFA 3AG2H 4ASNA 2WAQA 4PK4A 4XRSG 2GLOA 2DCEA 2KMUA 1SMTA 1U9OA 2A07F 4M9ZA 1BOBA 2I10A 1CF7A 2WV1A 2RC4A 2XGCA 3SFZA 5JI6A 1TNSA 3RZDJ 3N97A 1YX3A 2IA1A 4XMYA 2LF7A 1EH6A 1YYVA 3H9JA 3Q0UA 5KAIC 3CCVI 1J2XA 4ABZA 3S3NA 4RGRA 1XS9A 1D1AA 2VIXA 3V8LA 3CO7C 3WTYC 1TC3C 4DOZA 2KFDA 1S3JA 3LAJA 4BY7J 1G3SA 4O3MA 3HOUJ 3SDBA 4A69C 3K70C 1Y8RB 3RSNA 1HW2A 1ON2A 1VI0A 3GCMA 1BC7C 5FKMA 3GMEA 1X2NA 2Q2EA 3K69A 2CU7A 2WWYA 5C4JJ 2ZO4A 4ZYEA 1FBQA 4MTEA 3DFGA 1I39A 3DEWA 1ZRDA 4QIWN 2KHMA 1IZ1A 1EJ9A 4M3DA 1BI1A 3WHBA 3PO2J 5M5YJ 2ELKA 1N75A 2FXAA 2R7UA 5L3CA 1EH8A 1E17A 2O03A 2A05A 2PG4A 5DCMA 2FBHA 2TRTA 4B44A 2PI0A 1D5VA 2NS7A 2NOJB 2R92J 5HDKA 1YX5A 3KYDB 1YITI 3IV5A 3M9AA 2RVCA 3KX2A 5ILVA 2OC6A 2FNAA 2PBIA 2AS5F 4AVPA 1R5HA 2I5UA 3S93A 1U6GA 3TDZC 1A04A 4KNYA 3CUQA 1I27A 2FNPA 3HOYJ 1EF4A 1B9MA 3VEPA 3KE2A 3FXUA 4BEHB 3BJOA 4HBLA 3WTSC 4JBAA 2VQHA 2D2WA 2A6HF 3DLAA 4HOBA 1VZ0A 2RQQA 1OCCH 2EZHA 1JHFA 3HB9A 4ZH4F 1Z21A 1BW5A 3GLXA 1IN5A 4LG0B 4XLHA 4IL6C 2PQ8A 2L7KA 3LA7A 4ZYDA 1FEXA 2X6OA 4XOPA 5BMZA 5JLWA 3GXOA 1RR8C 4PJNA 1NK2P 4YRVA 4V2FA 3S16J 4MLOA 1KYZA 2L4AA 2RAEA 5GTIC 1SVLA 5IYDJ 1QGPA 1V55H 2K4JA 2Y2ZA 1XDSA 3IWFA 1HA8A 3C2BA 3FISA 4XSXF 2V6EA 5DV5A 1GVJA 2ZJQF 3AKZA 3GFJA 3BR1A 4EQQA 4HSTA 2LKXA 2IAIA 2VE8A 1DP3A 4A3EJ 1G6NA 4HG2A 3AG1H 1F9NA 2Z3YA 2XROA 2IGKA 5EJCA 1OJLA 4NB5A 1HC8A 2VBWA 4WF2A 4BYYA 4YFKF 4F91B 4XIDA 1WJCA 3PNVA 4UUTA 1N77A 3L2RA 1AKHA 3Q0WA 5TJJA 5EF6A 4DNCA 3H3ZA 1YJNI 1I3AA 3HPGA 2VE9A 1XCVA 3ZQFA 3S14J 5K5OA 3CMEI 1KU2A 3HTUA 2DK5A 1MH3A 2BW3B 1HDDC 2B7EA 2ZMEB 3GZ5A 3G73A 1RRJA 1FMVA 2ZJPF 4GYIA 3OYCA 2JN6A 1XGOA 5DM7F 3GUDA 2EJRA 4M3FA 3WU0A 3DXJF 2D1HA 2M45A 1QU3A 2FRHA 2X0LA 2CUZA 3E1SA 2XGEA 2EPFA 1AA7A 3SZPA 3DEUA 3IKTA 2LY2A 4A0YA 3E3VA 3KP2A 3RQ4A 2Y48A 2FQ3A 2K9QA 3FHZA 3IKVA 1MDMA 1FP1D 4RB2C 4XM3A 5LLQA 5HOOA 2ZBKA 1K6YA 4N9IA 3UR3C 4KN4X 1W5CC 4M3GA 2R4GA 3ZQLA 5J47A 1KU9A 4IRGA 4MFEA 3K6GA 2OJED 5KK1A 1QPMA 1FC3A 4A3JJ 2JRTA 1P4WA 3D1NI 2HGCA 4BXUA 2FJ1A 2L7FP 4W1UA 2DA2A 1U8BA 2F2EA 1MMGA 4I09A 1X3WB 4IRHA 4RB0A 3G4SI 1Z05A 3AL0B 3KP5A 2R7SA 2KP6A 1NG7A 5JFRA 4AD9A 3HDDA 3BTLA 4YFXF 1ZRFA 2O8KA 3VOEA 1R23A 1NHAA 1E3PA 1YG2A 3HKZN 2OF7A 4KDPA 2GXGA 3T8TA 4Y4RA 2V1NA 2GOXB 1WI3A 1LDDA 2LK2A 3G1LA 1R9TJ 1VQMI 4UVAA 5IP7J 5CLSA 2KDZA 3B73A 2L9VA 1P4XA 5E8IA 3QU3A 4BH9A 5D8LB 4LG3A 1W36D 3A1YA 3BDDA 4LGWA 3LA2A 4I76A 3LSMA 4L9JA 4XKBA 4RMNA 3RTRA 2KIQA 3PFIA 5FKOA 4LD5A 1I3QJ 2HQRA 4D5CA 2OTJI 2W82A 4CDGA 5J1RA 1IN7A 3KP7A 1OCPA 2NVUB 3ZQGA 1A35A 2UUZA 2I8DA 5E8GA 2QQBA 3JTGA 5LHGA 1QHGA 1V3FA 4BE1A 1VQLI 4CCOA 4HV5A 2AQEA 2VT3A 1U0JA 3ZRGA 4N0BA 3J7AY 1DP7P 2CJJA 2WA0A 4JX6A 3DWLE 1JHHA 3QPSA 3DTEA 1ETQA 5E1XA 1XMXA 2ZNYA 2D45A 2QGUA 2EB7A 3ISPA 4F7ZA 1ZG1A 1HW1A 3VFZA 5D5XB 1G3WA 2CW0F 5KAFC 2DTZA 3I3LA 4DBRA 1GHCA 5IOZA 4PGHA 4M6VA 3ONQA 2DFHA 2O5RA 1MNMC 1XCBA 4HNVA 2VJ4A 3AG4H 2Z33A 2XB5A 4I02A 4NC6A 5CVJA 3HL2A 2GBYA 3I56I 5EGOB 3FF5A 4R8HA 3GO5A 5JVTA 1VTNC 1ACIA 3GWZA 2LC2A 1S72I 3I4PA 1B72A 3L09A 3PUFA 4NDLA 2HXOA 3CD6I 3V4GA 3DKYA 4BQNA 2DA4A 3D5LA 2NS8A 3RZOJ 4BXXJ 3RJPA 5ICEA 4Y52J 2JWTA 4C2UA 3S2HJ 4D7MA 2IRFG 3CF5F 2F5DA 4A2UA 1OYWA 3QOEA 1MKMA 2QLZA 1B4AA 1TW3A 1ITYA 4DQ2A 1KU7A 1BA5A 3RPQA 1FZPB 2KQRA 3HUGB 1Z91A 1Z7LA 5DUKA 4AIKA 5HLHA 1RUOA 2K9NA 2A61A 1UJ8A 3ZXSA 2OQRA 4TV7A 1K61A 4GRIA 3GZNB 4O5VA 3REOA 3GVAA 1K83J 2KIUA 5HNFA 3BZ6A 4YELA 4HF1A 1FWZA 1B8IB 3SXYA 2W7NA 3TW6A 1ZHFA 2DW4A 1XN7A 2OZUA 3I4MJ 2TDXA 3L2VA 1LFUP 1H9TA 3RPUA 2E5ZA 2HI3A 3H5RA 4PJ0C 2M1BA 3H36A 4RM2A 2MFZA 3RYRA 2R7TA 2DJNA 1HKSA 2ME6A 3ZPLA 1J0RA 2M2EA 2P8TA 1HF0A 2IP2A 2CQNA 1YQAA 2X1DA 4XR6A 5E17F 3IH3A 1JTXA 2PX9A 3DU6A 4KN7X 1H9GA 3HG9A 3UKGA 1IGNA 4KIGA 4RAFA 5L3BA 3MZHA 1DU6A 2E1OA 4OWRB 3TOAA 2ID3A 3RKYA 1SEUA 2R7WA 4RLQA 1SAXA 2EK5A 4XRSA 1WFXA 5M3MJ 1GV5A 4C3IJ 1USTA 1D0ZA 2OA4A 1YJWI 3KEQA 2XB0X 3LMMA 3F9KA 4RA2A 4A3GJ 4HYEA 5IYCJ 3C1DA 1W7PD 3S2WA 4BDZA 2STWA 3WU1B 3IC7A 2Z16A 3OY9A 1Y39A 3H92A 4P9FA 2VBXA 2BV6A 3A01B 3GEZA 1JUMA 2NVYJ 1G3TA 2VBZA 1I6XA 2HOAA 2NOGA 5IT9Z 3CP2A 1A5JA 4PSWA 2VOOA 2VKVA 4OU0A 3KYCB 1ZR4A 3TO7A 1P4AA 1Z1DA 3KIOA 3EYYA 3OYHA 5JR3A 4BAYA 2VXDA 3KP6A 1VQ7I 1EKEA 3DU5A 1QZZA 2X51A 3HIFA 5H2FC 2ELHA 1KONA 4U0YA 5CVVA 3S15J 3ESWB 5CKTA 1DUXC 1YW7A 3BTJA 3SZTA 4DW6A 1T0FC 1WRJA 2KJCA 2Y0SA 3A4CA 4II3A 4M73A 4WWCA 2L4MA 3S3MA 4C2MJ 3DKXA 1OMIA 3BJ6A 2G7UA 1OCZH 3S1MJ 3GTMJ 1QZYA 4PJJA 2JA6J 3CF2A 3G1OA 2Y30A 4EJOA 4BEHA 1PYVA 1XSVA 4J00A 2L2OA 3ROUA 5E79C 1SFUA 3HC7A 1OLTA 4HW0A 4PUSA 3TO6A 1U5TB 4UUSB 2WV0A 5C4XJ 4P5OA 2H8WA 4UVBA 1W0TA 2GM4A 2IPQX 2MLGA 5E3NA 3AAFA 1AWCA 2HPIA 3OR1C 4I99C 3JRFA 1SD4A 3W2VA 1IRGA 4LG0A 2MC3A 3VYSB 4RB1A 2DAOA 3HHHA 1W7PB 4G8XA 2EZLA 2HKXA 4LB6B 5FLVA 3FIWA 2IS1A 5EDNA 3OIPA 1ODDA 3M7GA 4I2OA 3FBNB 4LIUA 1TT0A 3F72A 3PSIA 3D5SC 4M9XA 2EQRA 1YS7A 4LLNA 4EEFG 2KT0A 2JTVA 4CA0A 2HTSA 4BS9A 3HOVJ 4IQ4A 4N4OB 3QYEA 1VQPI 3J80K 2QKLB 2CMPA 2RKHA 2ZXHA 2KLOA 3VYUB 4EV0A 2YPRA 5HLIA 4G7OF 4BACA 1V4RA 5DUIA 1LEBA 4RS8A 3FXKA 4LLLA 1RKTA 3G3ZA 3OYKA 5CVRA 1HCRA 1QZEA 3T5XA 2PMZA 3HJEA 2J5PA 3Q9SA 2LFBA 1ZGAA 2JA8J 2EILH 5CJ9A 2LNBA 2DQRA 4C9YA 5J40A 5FO5A 3JW4A 4FQGA 2BW3A 5H6RA 4UNOA 3WTWC 3E6CC 3I4NJ 2ZMEA 4MTDA 1SD7A 4IOAF 4E70A 1FYMA 3K0LA 2V1UA 1OR7A 3IHUA 5FLXZ 4F92B 4KA4A 3VPRA 4DZPA 4S04A 3JRDA 2IBDA 1LEAA 1RESA 4DBQA 1YOVB 2DI3A 1X58A 2K40A 3FXLA 4FTHA 4BHCA 3BJAA 2XAUA 1GT0C 2QCOA 5D4SA 4CYCA 2ZXIA 2HU9A 2XAFA 1FOYA 5CYVA 4J19A 1TQPA 1WH5A 2KPMA 3H3VK 3KFWX 3L1PA 3CJTB 4Y15A 4UV8A 1Z6RA 2DFEA 3H3UA 4NBQA 3R60A 3SEQA 3ZOBA 5JHFA 3GLLA 1MNEA 2WY7Q 1T2KA 1L3LA 3LWFA 3MN2A 4XICA 2WAQN 3IL2A 5F27A 1WJEA 5L3DA 3TW7A 1QBJA 4XLCA 5J6XA 1P7IA 3PJRA 2CV0A 2HTJA 4NQWB 5A2QZ 3BG7A 1BR1A 2DPUA 1DPRA 3M3YJ 3DF8A 3ZMVA 2XSDC 4MIMA 4EJTA 3FK7A 1ZG3A 3H5NA 4FHTA 2GWRA 1WVRA 2HOEA 2V9PA 2WBMA 3ABMH 2W25A 4K2EA 5CVIA 1XC5A 4D7NA 3M4OJ 1X2MA 1XGSA 2OCEA 1S9HA 3GTJJ 5DD8A 1J09A 3WTUC 1HXDA 4UUVA 4R79A 1TLHB 2P4WA 3EETA 1ZTRA 2QBYB 2QENA 2GXBA 1WJDA 2M9HA 2F5EA 2XGDA 1S5LC 1ENHA 3KZIC 2MC4A 2KIFA 4N4NB 3F8BA 5DCFA 4AU7A 2ZC2A 2ADUA 2WB1A 5FRMA 4CHUA 3F23A 3BT9A 3PQKA 1EA3A 2JJ7A 1K78B 3BWGA 4NC8A 1IRFA 2DOFA 4B1RA 1GXPA 2KIMA 5ICGA 4XKVA 1K79A 2HS5A 1WJFA 4OIRF 4A5NA 2OAZA 2ZSHB 2DT5A 3BZKA 2Y0MA 1I6HJ 1P7JA 2VONA 4P9UA 4A6DA 3QOPA 5L3EA 3BR5A 2E34A 3F3XA 2UXNA 2R5YB 2XDVA 1XMKA 1VQKI 1OCOH 1VNDA 3OIQA 4F52A 1O3TA 1YRNB 3AG3H 3S8PA 2OQGA 1NK3P 3WU2C 4QTRA 2FUG2 1BR4A 1N78A 1UG0A 1VQ6I 2LF8A 2V6CA 3CO6C 2M7AA 4L5JA 3CQZJ 2C6YA 2BY1A 3K70D 2PEXA 2JPCA 2Y75A 2VBYA 2LY9A 2F4MB 3LQRA 4GYGA 4JX4A 2XF5A 2UV1A 5F0CA 3FK6A 3MWMA 1LE8B 4UHTA 1V5EA 5DDGA 3HOTA 3KLNA 5J1UA 1POGA 4WX9A 1KQ9A 3F6VA 5E3LA 3QYFA 3TKYA 2R7DA 1MD0A 2VL8A 3BCAA 3LFKA 2MH9A 2R7RA 3D0SA 4AM3A 3DPLC 1OKRA 4HDVA 1BOAA 4BDYA 2E19A 2DOEA 4FT8A 1XGMA 2HQ5A 1E0EA 1C0WA 4LMYA 4YFNF 1R4MB 3K2AA 1N25A 4HV6A 3MEXA 2F5VA 2L7MP 1H8AC 4ENKA 2X6YA 5HDGA 1D1CA 3N4MA 4PFPA 2M4KA 4BKXA 1I50J 1IW7F 5J1YA 4C3JJ 1A6QA 2E1MC 4L9VA 4CXFA 9ANTA 4LJZF 5CQGA 4A3FJ 2BXYA 2QA4I 3FXMA 3BG5A 4ESBA 5C44J 3OS0A 5AONA 3L2QA 5D5WB 2Z1DA 4ZYHA 4AVZA 4XKCA 1GVDA 1RNLA 4FX0A 1IC8A 3T1BA 4E7IA 5E1ZB 1KU3A 1S6LA 4MEXF 1MBKA 3BG9A 2DTRA 1B8IA 3ZR8X 2COMA 1O3QA 1AU7A 2QKMB 4G7ZF 1HKTA 1YIOA 2CV1A 4AUXA 4G94A 3J7AO 2IA0A 3PO3J 3TOBA 2DA5A 2ECCA 4M3BA 5GPAA 3RQIA 3NARA 3W6KB 3OYBA 4UY8I 3JTHA 2L5QA 1UG2A 2MH2A 3SYTA 1ETWA 4OIPF 4H4KC 3IH2A 1ETKA 1ZK8A 1TWGJ 2MGQA 3SQNA 3OL4A 1RZ4A 2IA2A 3QRFF 2R7VA 4HF0A 1MBFA 1XGNA 3ML6A 3M8JA 3ZP5A 1LVKA 3BTIA 4G6DA 1F36A 5HS7A 3CJRB 2IS2A 1MIJA 2O61A 1MMAA 4L0YB 3K1PA 3BPXA 2DMTA 1PDNC 3F22A 5IT3A 3F8FA 3RKWA 2BHZA 2D1VA 4C3HJ 3HOSA 2ZXWH 2E1MB 4XL9A 1PUFB 4QWQA 2YSRA 3E6BA 3CDIA 1A6IA 1R1UA 3HSEA 4AIDA 4KFCA 3IRRA 3NAUA 2RREA 3F8MA 2XPVA 3HHGA 3ZQQA 3OYMA 4EJWA 2OU2A 1BI0A 2K7LA 2V9KA 3F8NA 5E3MA 1Q1VA 3FBIB 3SJMA 2CO5A 1P92A 1LB2A 4MNUA 4X0GA 3OYIA 3X2QH 2K3FA 3DEEA 3PM1A 4JOMA 3A01A 2CW7A 1B1BA 3JAMK 4UB6C 3LSPA 1BIAA 1IXRC 2F5FA 3EUHA 5F6FA 4IHWA 2IS6A 1QHHD 1IDZA 5TRDA 1LKXA 4G6TB 3CUOA 1O3SA 2O3FA 2H6CA 2DBBA 3W3CA 1V5FA 4CYDA 3I5UA 2XC7A 1ZR2A 2MSYA 1TNTA 3J81Z 4DYQA 3CCRI 1BIBA 2E5NA 1P2FA 3E5UA 2EFNA 2LOOA 4J01A 2DA7A 4A0ZA 4HQEA 4L5IA 4JK1X 4GDFA 1ZAOA 3DLLF 1RIOH 2HDCA 5LHHA 4UXNA 1HQCA 3H0GJ 1IV8A 4Y17A 2K9MA 3EUAA 1PP8F 3JRHA 4WXHA 1SD5A 1ULYA 2YU9J 4CUGA 4IO9F 1U3EM 2O9LA 2W1OA 2M8EA 4II2A 2P6TA 1U5TA 1IN6A 4UUSA 1FIPA 4M6XA 1X4OA 2ICWG 4EGZA 3F0CA 3D5RC 1W7PA 1WH7A 4JQFA 1W4MA 3O8HA 1TTYA 2XKPA 1MMSA 3WODF 2W84A 4EJUA 4ZC3A 3WE3A 2F5CA 2FX0A 4IXAA 1FOXA 1F4KA 1FYKA 4P96A 5F08A 3WHCA 3HSRA 3TBIA 1T39A 3HYIA 4RLFA 3OYNA 1XPXA 3I54A 2DMNA 2PMUA 1FIAA 1S7OA 1M1EB 3JRAA 2VC0A 1DGRM 2QSFX 2LBFB 1WHUA 3J7YJ 3A02A 2HKOA 4A3MJ 2Q1ZB 1YW9A 3TL4X 2WAFA 2R5ZB 1OCTC 3C18A 2KISA 4F3QA 3V7SA 1BJZA 5B1BH 5DYMA 1HLVA 3IAM2 5BOXA 2XF6A 4HNUA 3TGNA 2YU3A 2YX4A 1JTYA 3MKWB 1TBXA 4HLXA 5LD2C 3BPVA 1XD7A 3JRIA 2NYXA 3GX4X 2QWWA 3B02A 2UZKA 2AXTC 4EJVA 4CZZA 5BPDA 1KQ8A 2O8XA 3S3OA 3OYGA 2VJIA 5ICFA 3RCOA 2HOSA 2DT6A 3BZCA 3CCYA 3DCFA 2G0EA 4S0HB 1WJAA 4CICA 1FT9A 1TWHJ 5GAHJ 3CUQC 3CC2I 2HEOA 1WSUA 4HX7A 1J75A 2V79A 2KZGA 1E2XA 3IP4B 3VYTB 4RBOA 2EINH 2ZXJA 2GA2A 1VFCA 2X1EA 2KJBA 3KPHA 3DTKA 3ULQB 4YIRX 3BTCA 1D5YA 4LB5A 2VOPA 4AIJA 4DYRA 3KZZA 3K4CA 1RPWA 3GFMA 1FOKA 1YE9A 1XTAA 1XSXA 3I59A 3VSKA 3DBHB 5K5RA 4Y7NJ 2LSOA 2IGNA 3AFHA 4RGSA 4XLFA 5DEQA 4WK8F 3OYLA 2V1XA 4WXDA 2PJRB 1ZREA 2CQXA 4IJAA 1X3ZB 2RNJA 2XIGA 2L54A 3I64A 4BJ5C 3CCMI 3O6BB 4OINF 2DXIA 2JA5J 1OYIA 4I0BA 2H8RA 2QBYA 2XGXA 3OYDA 4MFDA 2BZTA 1Y0UA 3CDLA 4ZTJA 2ECBA 1R6RA 4MQVA 1WJ5A 3FXOA 3HRMA 3L2WA 1MSFC 5EG0B 1HW5A 1O4XA 2H27A 1BBYA 2VKDA 2RN7A 4G12A 1LFBA 3CUQB 3HXLA 2HYJA 1HKQA 3BR3A 4U87A 4ETSA 2HNHA 2BEOA 4BNCA 3QP5A 2JUGA 3U21A 1AOYA 2CQQA 3A0HC 2RQPA 5HS8A 2R3SA 2X6WA 5F04A 3ZQ7A 4R1HA 3JRBA 3R0JA 5LHIA 3MCZA 5JVGF 1WQ2A 4CGZA 5IP9J 1YRNA 2O0YA 2DO7A 2KRHA 4LFUA 2Y0SN 3ECOA 3HRSA 2CUEA 3F6OA 4NNJA 2W57A 1TWCJ 5KHDA 1I1GA 3S1QJ 2K3PA 1IXCA 2WADA 1R00A 4ZZDA 1IJWC 1UHMA 3HOWJ 2OPTA 2P5VA 1XSDA 2RGVA 2M8GX 2EFWA 3G1MA 3SZGA 1S7EA 5FJ8J 3GFIA 3WTTC 4ENNA 3JCUC 5K7FA 3LL7A 3T0YA 2OD5A 1X1CA 3MMYB 1W5SA 3FWEA 4A3LJ 1SFOJ 1RI7A 3GBGA 2FOKA 2M0MA 1YW8A 5AIPA 1OYYA 2KZVA 2HZTA 3PSFA 1JKQC 2DN0A 1AKHB 4KIBA 1YFHA 1DGWY 3I0TA 3V42A 3DTIA 1T33A 5GAEJ 4XQFA 2DU9A 2K5CA 4A5MA 3FM5A 1QRYA 3W6VA 5B66C 2EBIA 4BQOA 4HZFA 5L3GA 4BJTA 1VQ8I 3R0AA 5GADJ 1IF1A 2OTLI 2Q8KA 2LG4A 3PIOF 1R36A 5ED4A 5J4YA 2YR2A 4XN3A 5CQEA 3KETA 1IV6A 2Z5UA 5DTDA 2GQQA 2PMZN 2JMWA 5J4VA 1T38A 3IRQA 1JI8A 1MMNA 4PZJA 4LLGF 1SMYF 3CJNA 4PCQA 5LRRA 1USSA 2GA1A 3K7AJ 3GTPJ 3M1CA 3MVPA 1CQTA 3LSRA 3WE2A 1K4TA 4UB8C 1DDNA 2L0KA 3PNYA 3S17J 1FP2A 4MGRA 2ME0A 4CCMA 2Y9YA 3OYJA 1FBSA 1IUFA 2CRGA 5D8KB 3FM3A 2W85A 4Z2YA 3HOZJ 2CW8A 3PL8A 4OIOF 1WGXA 2Q0OA 3ECHA 1Y56A 2M5WA 1Z9CA 1BC8C 1TQIA 2P6SA 3PNTA 5F1JA 2WTEA 2LVSA 2AO9A 4AYBA 4KITB 3FMQA 4QSHA 2L3DA 1QVUA 1BN5A 3QPHA 2OV7A 2IW5A 5J8FA 2EA4A 4X1EA 5DD4A 2GZWA 1X1BA 2KRFA 2P5LC
chains in the Genus database with same CATH topology
4XK4A 4DYCA 2K9QA 5J1UA 1POGA 4IHVA 2VI6A 5E3LA 4A3KJ 3OOUA 3ZQHA 2ZB9A 2K9SA 2LR8A 1PUFA 3OIOA 4M3GA 3ZQLA 1ETXA 4MFEA 1Y1VJ 2EH3A 1MBJA 4A3JJ 2ID6A 4A3DJ 3D1NI 2R5YA 2E19A 2FJ1A 2L7FP 3S1RJ 2HQ5A 4W1UA 2DA2A 1U8BA 1Y1WJ 2DMPA 3K2AA 5FLMJ 5EZHA 2AHQA 2L7MP 1H8AC 3Q3SA 3GTKJ 3HDDA 3BTLA 2O7OA 2O8KA 2WB1N 4A3BJ 3BQYA 4BKXA 1I50J 1ETYA 3HKZN 5EZGA 4C3JJ 2OF7A 5J1YA 1UMQA 3LOCA 9ANTA 1LE8A 1WI3A 2LK2A 3G1LA 4A3FJ 1R9TJ 1IDYA 5IP7J 3BG5A 2KDZA 5C44J 2NVXJ 3BR0A 3IH4A 1GVDA 4JP0A 1IC8A 3LSGA 1H89C 3Q0VA 1ZKGA 4W97A 4I76A 1MBKA 3BG9A 1B8IA 5K7ZA 3OSFA 1AU7A 4DZJA 5FKOA 4AUXA 1SANA 3PO3J 1I3QJ 2DA5A 2ECCA 4M3BA 5F0FA 3NARA 5FKLA 5GPAA 3RQIA 4D5CA 3FKIJ 2Y31A 5J1RA 1OCPA 1UG2A 4AYBN 3BQZA 3LSJA 1ETWA 3ZQGA 3IH2A 1ETKA 1ZK8A 5IP6A 1TWGJ 4BBRJ 2MGQA 3BG3A 1TWFJ 3LNQA 2LLKA 1ZQ3P 1MBFA 3MKLA 3BTIA 1F36A 2CJJA 4JX6A 3QPSA 1MH4A 1JKRC 1ETQA 1JKOC 1GV2A 2DMTA 1GUUA 5HODA 5M5XJ 1DU0A 1MSEC 4C3HJ 2D5VA 2E2IJ 2DTZA 1PUFB 2R93J 5IOZA 2B63J 1ETOA 2L9RA 2W48A 1A6IA 3HM5A 4M6VA 4IHXA 1JT0A 1MNMC 1F43A 3NAUA 4HNVA 2XPVA 4I6ZA 2L7ZA 2XB5A 2R5ZA 2HXIA 2GBYA 5E3MA 1GDTA 1Q1VA 2DA6A 5EGOB 4RDUA 3SJMA 4A3CJ 1JJ6C 5C3EJ 3PM1A 2DA1A 1B72A 3A01A 4NDLA 3TP3A 3LSPA 2HXOA 1FJLA 4FISA 2DA4A 1RETA 1UHSA 2NS8A 4IHWA 3RZOJ 4BXXJ 1IDZA 4Y52J 2JWTA 2TCTA 3S2HJ 4D7MA 1TWAJ 4XRMA 3JREA 2DA3A 1U78A 1ZR2A 2MSYA 4DYQA 2VUMJ 1ITYA 1BA5A 2DA7A 4BY1J 2M34A 2K9NA 3GTGJ 2YS9A 4IHYA 1ETVA 3QPLA 1K61A 2VKEA 1K83J 1HDPA 4AC0A 1B8IB 2XPWA 3TW6A 5EGOA 3H0GJ 3I4MJ 3JRHA 1LFUP 5FKNA 2NVTJ 2LTPA 4IEJA 2HI3A 2XPUA 5F0HA 2YU9J 1FTZA 2DJNA 2ME6A 2X48A 5IPAA 2M2EA 1HF0A 2O9LA 3SFIA 5EEAA 3TEDA 3JR9A 2HOTA 4UUSA 3B6CA 1FIPA 5EYRA 1APLC 3IH3A 1JTXA 1JUSA 3UKGA 1IGNA 3JRCA 3F0CA 3ZQIA 1DU6A 2E1OA 1WH7A 4BBSJ 2DMUA 1MBHA 3O8HA 4M3EA 4B4CA 2ID3A 1Z0XA 4FCYA 2FX0A 4XRSA 2R7ZJ 5M3MJ 1GV5A 4C3IJ 1MBGA 1OFCX 1RR7A 5F08A 3WHCA 2XB0X 2DMNA 1FIAA 4A3GJ 2VPRA 3JRAA 5IYCJ 2M0CA 3A02A 1BW6A 4A3MJ 5EG0A 2R5ZB 5IOYA 4FE4A 1OCTC 5M5WJ 1BJZA 1U9NA 1HLVA 2EZIA 1B72B 3A01B 2YUSA 1JUMA 1JTYA 2NVYJ 5JLXA 2NOGA 2HOAA 2CUFA 5E3OA 2E2HJ 3O8GA 1A5JA 3JRIA 5BNGA 2FQ4A 2VKVA 1JKPC 3HBLA 4MO7A 1ZR4A 4X6AJ 1FTTA 1RKWA 3CMYA 2IEKA 1G2HA 2HOSA 3CCYA 3DCFA 5GP9A 3GTLJ 2G0EA 4S0HB 3S15J 4L5EA 4GFBA 1IRZA 2N8GA 3BTJA 1TWHJ 4DW6A 1ORKA 3HOXJ 1E3OC 1H88C 5J3LA 4C2MJ 4LOCA 3ZQCA 2Y9ZA 1VF9A 4RBOA 5K7HA 3S1MJ 3GTMJ 1VFCA 2X9DA 2JA6J 3G1OA 2H1KA 2Y30A 3B6AA 3S2DJ 1NTCA 3BTCA 1D5YA 4DYRA 3HGGA 5IYBJ 2DMQA 1RPWA 4UUSB 5C4XJ 1W0TA 2GM4A 5E3NA 3HEFA 3JRFA 2QF7A 1QVTA 4Y7NJ 4XRSG 3RKQA 2GLOA 2EZLA 5FLVA 4A93J 3FIWA 5EDNA 1U9OA 3QQAA 1HOMA 3JRGA 2EQRA 2CQXA 2I10A 4EEFG 2WV1A 2KT0A 3HOVJ 2XGCA 2JA5J 2H8RA 3RZDJ 4MFDA 3Q0UA 4ABZA 4CYCB 1XS9A 3CDLA 1AHDP 1TC3C 2ECBA 3SDGA 5GPCA 4BY7J 3HOUJ 4A69C 2LD5A 5EG0B 1O4XA 1MSFC 1VI0A 5FKMA 1X2NA 4G12A 1RKTA 1LFBA 1HCRA 2CU7A 3A03A 1MBEA 2HYJA 5C4JJ 1JGGA 3BR3A 2LFBA 2JA8J 1QPIA 3DEWA 3E7LA 4QIWN 3PO2J 4M3DA 3WHBA 2CQQA 4FE7A 4JX5A 5M5YJ 2ELKA 4JYKA 5F04A 1JT6A 3JRBA 5IP9J 3I4NJ 1YRNA 2TRTA 2COBA 2Y0SN 2CUEA 4A3IJ 1TWCJ 2NS7A 3VPRA 1T56A 4DZPA 3JRDA 3S1QJ 2IBDA 1RESA 3BR6A 1IJWC 2K40A 1X58A 2R92J 3HOWJ 2OPTA 4FTHA 3GTQJ 1GT0C 2QCOA 3IV5A 4D5FA 4CYCA 2M8GX 2XRLA 3G1MA 1S7EA 5FJ8J 4J19A 1WH5A 5DS9A 3H3VK 3L1PA 5K7FA 4A3LJ 1SFOJ 3ZOBA 3HOYJ 1EF4A 3GBGA 1WCMJ 2MG4A 3MN2A 4XICA 2WAQN 5F27A 3TW7A 1JKQC 2DN0A 1AKHB 1JJ8C 1P7IA 2EZHA 3HB9A 1T33A 4V2GA 1BW5A 3M3YJ 1QRYA 4MIMA 2XSDC 2HDDA 3W6VA 2EBIA 3FK7A 3OSGA 1XG1A 1FEXA 2X6OA 4B3AA 2E2JJ 3M4OJ 1XC5A 4D7NA 5JLWA 1X2MA 3GTJJ 1NK2P 3S16J 4V2FA 1ZTRA 2LP0A 4MLOA 2RAEA 5IYDJ 2M9HA 2Y2ZA 2XGDA 3HGYA 1ENHA 1IV6A 3C2BA 3FISA 5DTDA 2PMZN 2MW8A 2JMWA 3BT9A 3BR1A 2LKXA 2IAIA 2JJ7A 4A3EJ 2EZKA 4B1RA 1WPKA 1OJLA 5FKKA 3K7AJ 3GTPJ 2FD5A 4XIDA 2JK3A 1IG7A 3MVPA 5M3FJ 4UUTA 2R0QC 1AKHA 1CQTA 3Q0WA 5EF6A 3LSRA 1Z77A 2L0KA 3S17J 1I6HJ 1JUPA 1P7JA 2ME0A 3ZQFA 2JA7J 2Y9YA 3S14J 3BR5A 3GTOJ 2R5YB 1MH3A 1HDDC 3S1NJ 1VNDA 1W0UA 1IUFA 2CRGA 1YRNB 1NK3P 2P81A 3HOZJ 4QTRA 2JN6A 1WGXA 1BL0A 3CQZJ 4M3FA 3BR2A 5F1JA 2LVSA 2AO9A 2XGEA 4QSHA 1QVUA 2LY9A 4X1EA 4JX4A 3TP0A 1ZGWA 5F0CA 3FK6A 1LE8B 2NVQJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XK4 A;  4DYC A;  2K9Q A;  5J1U A;  1POG A;  4IHV A;  2VI6 A;  5E3L A;  4A3K J;  3OOU A;  3ZQH A;  2ZB9 A;  2K9S A;  2LR8 A;  1PUF A;  3OIO A;  4M3G A;  3ZQL A;  1ETX A;  4MFE A;  1Y1V J;  2EH3 A;  1MBJ A;  4A3J J;  2ID6 A;  4A3D J;  3D1N I;  2R5Y A;  2E19 A;  2FJ1 A;  2L7F P;  3S1R J;  2HQ5 A;  4W1U A;  2DA2 A;  1U8B A;  1Y1W J;  2DMP A;  3K2A A;  5FLM J;  5EZH A;  2AHQ A;  2L7M P;  1H8A C;  3Q3S A;  3GTK J;  3HDD A;  3BTL A;  2O7O A;  2O8K A;  2WB1 N;  4A3B J;  3BQY A;  4BKX A;  1I50 J;  1ETY A;  3HKZ N;  5EZG A;  4C3J J;  2OF7 A;  5J1Y A;  1UMQ A;  3LOC A;  9ANT A;  1LE8 A;  1WI3 A;  2LK2 A;  3G1L A;  4A3F J;  1R9T J;  1IDY A;  5IP7 J;  3BG5 A;  2KDZ A;  5C44 J;  2NVX J;  3BR0 A;  3IH4 A;  1GVD A;  4JP0 A;  1IC8 A;  3LSG A;  1H89 C;  3Q0V A;  1ZKG A;  4W97 A;  4I76 A;  1MBK A;  3BG9 A;  1B8I A;  5K7Z A;  3OSF A;  1AU7 A;  4DZJ A;  5FKO A;  4AUX A;  1SAN A;  3PO3 J;  1I3Q J;  2DA5 A;  2ECC A;  4M3B A;  5F0F A;  3NAR A;  5FKL A;  5GPA A;  3RQI A;  4D5C A;  3FKI J;  2Y31 A;  5J1R A;  1OCP A;  1UG2 A;  4AYB N;  3BQZ A;  3LSJ A;  1ETW A;  3ZQG A;  3IH2 A;  1ETK A;  1ZK8 A;  5IP6 A;  1TWG J;  4BBR J;  2MGQ A;  3BG3 A;  1TWF J;  3LNQ A;  2LLK A;  1ZQ3 P;  1MBF A;  3MKL A;  3BTI A;  1F36 A;  2CJJ A;  4JX6 A;  3QPS A;  1MH4 A;  1JKR C;  1ETQ A;  1JKO C;  1GV2 A;  2DMT A;  1GUU A;  5HOD A;  5M5X J;  1DU0 A;  1MSE C;  4C3H J;  2D5V A;  2E2I J;  2DTZ A;  1PUF B;  2R93 J;  5IOZ A;  2B63 J;  1ETO A;  2L9R A;  2W48 A;  1A6I A;  3HM5 A;  4M6V A;  4IHX A;  1JT0 A;  1MNM C;  1F43 A;  3NAU A;  4HNV A;  2XPV A;  4I6Z A;  2L7Z A;  2XB5 A;  2R5Z A;  2HXI A;  2GBY A;  5E3M A;  1GDT A;  1Q1V A;  2DA6 A;  5EGO B;  4RDU A;  3SJM A;  4A3C J;  1JJ6 C;  5C3E J;  3PM1 A;  2DA1 A;  1B72 A;  3A01 A;  4NDL A;  3TP3 A;  3LSP A;  2HXO A;  1FJL A;  4FIS A;  2DA4 A;  1RET A;  1UHS A;  2NS8 A;  4IHW A;  3RZO J;  4BXX J;  1IDZ A;  4Y52 J;  2JWT A;  2TCT A;  3S2H J;  4D7M A;  1TWA J;  4XRM A;  3JRE A;  2DA3 A;  1U78 A;  1ZR2 A;  2MSY A;  4DYQ A;  2VUM J;  1ITY A;  1BA5 A;  2DA7 A;  4BY1 J;  2M34 A;  2K9N A;  3GTG J;  2YS9 A;  4IHY A;  1ETV A;  3QPL A;  1K61 A;  2VKE A;  1K83 J;  1HDP A;  4AC0 A;  1B8I B;  2XPW A;  3TW6 A;  5EGO A;  3H0G J;  3I4M J;  3JRH A;  1LFU P;  5FKN A;  2NVT J;  2LTP A;  4IEJ A;  2HI3 A;  2XPU A;  5F0H A;  2YU9 J;  1FTZ A;  2DJN A;  2ME6 A;  2X48 A;  5IPA A;  2M2E A;  1HF0 A;  2O9L A;  3SFI A;  5EEA A;  3TED A;  3JR9 A;  2HOT A;  4UUS A;  3B6C A;  1FIP A;  5EYR A;  1APL C;  3IH3 A;  1JTX A;  1JUS A;  3UKG A;  1IGN A;  3JRC A;  3F0C A;  3ZQI A;  1DU6 A;  2E1O A;  1WH7 A;  4BBS J;  2DMU A;  1MBH A;  3O8H A;  4M3E A;  4B4C A;  2ID3 A;  1Z0X A;  4FCY A;  2FX0 A;  4XRS A;  2R7Z J;  5M3M J;  1GV5 A;  4C3I J;  1MBG A;  1OFC X;  1RR7 A;  5F08 A;  3WHC A;  2XB0 X;  2DMN A;  1FIA A;  4A3G J;  2VPR A;  3JRA A;  5IYC J;  2M0C A;  3A02 A;  1BW6 A;  4A3M J;  5EG0 A;  2R5Z B;  5IOY A;  4FE4 A;  1OCT C;  5M5W J;  1BJZ A;  1U9N A;  1HLV A;  2EZI A;  1B72 B;  3A01 B;  2YUS A;  1JUM A;  1JTY A;  2NVY J;  5JLX A;  2NOG A;  2HOA A;  2CUF A;  5E3O A;  2E2H J;  3O8G A;  1A5J A;  3JRI A;  5BNG A;  2FQ4 A;  2VKV A;  1JKP C;  3HBL A;  4MO7 A;  1ZR4 A;  4X6A J;  1FTT A;  1RKW A;  3CMY A;  2IEK A;  1G2H A;  2HOS A;  3CCY A;  3DCF A;  5GP9 A;  3GTL J;  2G0E A;  4S0H B;  3S15 J;  4L5E A;  4GFB A;  1IRZ A;  2N8G A;  3BTJ A;  1TWH J;  4DW6 A;  1ORK A;  3HOX J;  1E3O C;  1H88 C;  5J3L A;  4C2M J;  4LOC A;  3ZQC A;  2Y9Z A;  1VF9 A;  4RBO A;  5K7H A;  3S1M J;  3GTM J;  1VFC A;  2X9D A;  2JA6 J;  3G1O A;  2H1K A;  2Y30 A;  3B6A A;  3S2D J;  1NTC A;  3BTC A;  1D5Y A;  4DYR A;  3HGG A;  5IYB J;  2DMQ A;  1RPW A;  4UUS B;  5C4X J;  1W0T A;  2GM4 A;  5E3N A;  3HEF A;  3JRF A;  2QF7 A;  1QVT A;  4Y7N J;  4XRS G;  3RKQ A;  2GLO A;  2EZL A;  5FLV A;  4A93 J;  3FIW A;  5EDN A;  1U9O A;  3QQA A;  1HOM A;  3JRG A;  2EQR A;  2CQX A;  2I10 A;  4EEF G;  2WV1 A;  2KT0 A;  3HOV J;  2XGC A;  2JA5 J;  2H8R A;  3RZD J;  4MFD A;  3Q0U A;  4ABZ A;  4CYC B;  1XS9 A;  3CDL A;  1AHD P;  1TC3 C;  2ECB A;  3SDG A;  5GPC A;  4BY7 J;  3HOU J;  4A69 C;  2LD5 A;  5EG0 B;  1O4X A;  1MSF C;  1VI0 A;  5FKM A;  1X2N A;  4G12 A;  1RKT A;  1LFB A;  1HCR A;  2CU7 A;  3A03 A;  1MBE A;  2HYJ A;  5C4J J;  1JGG A;  3BR3 A;  2LFB A;  2JA8 J;  1QPI A;  3DEW A;  3E7L A;  4QIW N;  3PO2 J;  4M3D A;  3WHB A;  2CQQ A;  4FE7 A;  4JX5 A;  5M5Y J;  2ELK A;  4JYK A;  5F04 A;  1JT6 A;  3JRB A;  5IP9 J;  3I4N J;  1YRN A;  2TRT A;  2COB A;  2Y0S N;  2CUE A;  4A3I J;  1TWC J;  2NS7 A;  3VPR A;  1T56 A;  4DZP A;  3JRD A;  3S1Q J;  2IBD A;  1RES A;  3BR6 A;  1IJW C;  2K40 A;  1X58 A;  2R92 J;  3HOW J;  2OPT A;  4FTH A;  3GTQ J;  1GT0 C;  2QCO A;  3IV5 A;  4D5F A;  4CYC A;  2M8G X;  2XRL A;  3G1M A;  1S7E A;  5FJ8 J;  4J19 A;  1WH5 A;  5DS9 A;  3H3V K;  3L1P A;  5K7F A;  4A3L J;  1SFO J;  3ZOB A;  3HOY J;  1EF4 A;  3GBG A;  1WCM J;  2MG4 A;  3MN2 A;  4XIC A;  2WAQ N;  5F27 A;  3TW7 A;  1JKQ C;  2DN0 A;  1AKH B;  1JJ8 C;  1P7I A;  2EZH A;  3HB9 A;  1T33 A;  4V2G A;  1BW5 A;  3M3Y J;  1QRY A;  4MIM A;  2XSD C;  2HDD A;  3W6V A;  2EBI A;  3FK7 A;  3OSG A;  1XG1 A;  1FEX A;  2X6O A;  4B3A A;  2E2J J;  3M4O J;  1XC5 A;  4D7N A;  5JLW A;  1X2M A;  3GTJ J;  1NK2 P;  3S16 J;  4V2F A;  1ZTR A;  2LP0 A;  4MLO A;  2RAE A;  5IYD J;  2M9H A;  2Y2Z A;  2XGD A;  3HGY A;  1ENH A;  1IV6 A;  3C2B A;  3FIS A;  5DTD A;  2PMZ N;  2MW8 A;  2JMW A;  3BT9 A;  3BR1 A;  2LKX A;  2IAI A;  2JJ7 A;  4A3E J;  2EZK A;  4B1R A;  1WPK A;  1OJL A;  5FKK A;  3K7A J;  3GTP J;  2FD5 A;  4XID A;  2JK3 A;  1IG7 A;  3MVP A;  5M3F J;  4UUT A;  2R0Q C;  1AKH A;  1CQT A;  3Q0W A;  5EF6 A;  3LSR A;  1Z77 A;  2L0K A;  3S17 J;  1I6H J;  1JUP A;  1P7J A;  2ME0 A;  3ZQF A;  2JA7 J;  2Y9Y A;  3S14 J;  3BR5 A;  3GTO J;  2R5Y B;  1MH3 A;  1HDD C;  3S1N J;  1VND A;  1W0U A;  1IUF A;  2CRG A;  1YRN B;  1NK3 P;  2P81 A;  3HOZ J;  4QTR A;  2JN6 A;  1WGX A;  1BL0 A;  3CQZ J;  4M3F A;  3BR2 A;  5F1J A;  2LVS A;  2AO9 A;  2XGE A;  4QSH A;  1QVU A;  2LY9 A;  4X1E A;  4JX4 A;  3TP0 A;  1ZGW A;  5F0C A;  3FK6 A;  1LE8 B;  2NVQ J; 
#chains in the Genus database with same CATH topology
 4BHP A;  4XK4 A;  3QYB A;  3C2H A;  4BGD A;  3CCJ I;  3FXJ A;  3MQ0 A;  2EWN A;  4LIV A;  4HQM A;  4A3K J;  3OOU A;  2CWE A;  2NRA C;  3ZQH A;  5L3F A;  1J9I A;  2ZB9 A;  4CCJ A;  1PUF A;  3CLQ A;  2L9N A;  3ERM A;  1MJ9 A;  2V7F A;  2A6E F;  5LRS A;  5GTH C;  3WGI A;  3JAM Z;  3NWT A;  4C2T A;  3A0B C;  2NNY A;  3S1R J;  1FPQ A;  3JSP A;  3L9F A;  1UHW A;  4OAY A;  1JXS A;  3DP7 A;  2JZY A;  2AHQ A;  4KMF A;  3Q3S A;  4CSW A;  4ZDP A;  5TIS C;  2O7O A;  2WB1 N;  2XSJ C;  2FEZ A;  2FBK A;  3BQY A;  2HYG D;  5EZG A;  1H0M A;  1UMQ A;  5BPI A;  2QSG X;  4A6E A;  2QZ8 A;  2WAE A;  4XNF A;  2H94 A;  3L00 A;  3F21 A;  2ZFU A;  1IDY A;  2BBY A;  2FBI A;  3KEO A;  6PAX A;  3K2Z A;  1Y6I A;  2NVX J;  1TZL A;  2EV0 A;  4BU2 A;  2G7H A;  3PUB A;  1H89 C;  2A6T A;  2XV4 S;  3Q0V A;  1ZKG A;  4RAZ A;  2XAS A;  4BXF A;  2E7X A;  3COA C;  4BE0 A;  2E36 A;  5K7Z A;  1E3H A;  4DZJ A;  2LRD A;  1Z67 A;  2DOD A;  1SAN A;  5FFZ A;  4LIT A;  2V4J C;  2XVC A;  1F1Z A;  2RDP A;  5FKL A;  1LJ9 A;  2Y31 A;  2DOA A;  4M9S A;  2IT0 A;  3BCB A;  3IAS 2;  5IP6 A;  4XON A;  1Z3Y A;  3C3W A;  1D3Y A;  2VQG A;  1LFP A;  3L7W A;  4WXC A;  1VQ4 I;  1ZQ3 P;  1O7F A;  4BL0 B;  1SC7 A;  3MKL A;  2XHK A;  1ZEL A;  4Y33 A;  2DFI A;  3MFK A;  2BGC A;  3DV8 A;  1JKO C;  2Y69 H;  4HA8 A;  3CCL I;  5LEJ A;  1UEL B;  5ILU A;  1GUU A;  5HOD A;  1DU0 A;  1QA6 A;  1JGS A;  2D5V A;  2E2I J;  2P7V B;  2WY8 Q;  2DDB A;  2FMY A;  4ENM A;  3R4K A;  1D8J A;  4Q48 A;  2B63 J;  1ETO A;  4XN0 A;  3CC7 I;  2FF4 A;  2VC1 A;  2VPL A;  1LUJ B;  2LBF A;  1JT0 A;  1F43 A;  4ZYA A;  4I6Z A;  2JT1 A;  4ZDL A;  2IGO A;  2L7Z A;  1BR2 A;  2R5Z A;  4A3C J;  2DA6 A;  2ESH A;  3NQO A;  3GYH X;  5LBQ A;  2R7F A;  4XSZ F;  1LVA A;  2DA1 A;  3R6S A;  2PFB A;  3ASO H;  1FNN A;  1D1B A;  4FIS A;  1CGP A;  1RET A;  2ISY A;  3O3K A;  4PFO A;  1X4P A;  4ZZL A;  5B5E C;  2ESN A;  3L2U A;  4ITV A;  3I71 A;  3L2C A;  3RDI A;  2QQ8 A;  2DA3 A;  1RC9 A;  2MAB A;  4NUB A;  1L0O C;  4DGW B;  3NRV A;  2A68 F;  2V9V A;  2EFP A;  4U0W A;  3BY6 A;  5TGT A;  5H6Q A;  4L9N A;  2JSP A;  2DJI A;  1LDJ A;  2NNN A;  4BY1 J;  2YX7 A;  4ZJZ A;  2GXA A;  2YS9 A;  1XMA A;  4IHY A;  1VQ5 I;  5FFX A;  2JPB A;  2NAZ A;  1ZN2 A;  2MBF A;  1HDP A;  4G6Q A;  1R5G A;  3FDY A;  2VB6 A;  4AC0 A;  4E7S A;  4EVI A;  5FGM A;  3QU6 A;  5EGO A;  4L9T A;  3G2B A;  4PJL A;  4XOR A;  3BG6 A;  2EIM H;  5FKN A;  2CQ7 A;  4IEJ A;  4E7H A;  2XPU A;  1KA8 A;  3BP8 A;  3OMY A;  5IPA A;  2H6B A;  5DM6 F;  5EEA A;  4EAT A;  3W6J B;  4HRI A;  1T98 A;  3HZJ A;  3JR9 A;  2HOT A;  1WI9 A;  3B6C A;  3K9T A;  3TQN A;  4EMS A;  4OIQ F;  1UB9 A;  1OPC A;  3C7J A;  4OMY A;  3U1K A;  1K6O A;  2P5K A;  4QPQ A;  3TO9 A;  1ZRC A;  3SEZ A;  1SVO A;  2ETH A;  4Y13 A;  3W2A A;  4QLC U;  2DMU A;  4BBS J;  3R61 A;  1Y8Q B;  5K1Y A;  3HUG A;  4HPQ A;  4A12 A;  1G59 A;  1Z0X A;  1VQN I;  5IT9 K;  2PJR A;  1WWX A;  4I01 A;  5KNL A;  3LSK A;  2KL4 A;  2NXN B;  5FD5 A;  5HLG A;  2G9W A;  2R7Z J;  4DJA A;  2STT A;  3EYI A;  1YTY A;  1OFC X;  3PFY A;  3DQV C;  2F6C A;  3GW2 A;  3BRO A;  2ZFW A;  1D0X A;  2XUB A;  3FMS A;  4RM3 A;  5J8C A;  1X1A A;  2M0C A;  3H5A A;  2OBP A;  2HWV A;  5HDN A;  1BW6 A;  5EG0 A;  2QVO A;  4PDK A;  5IOY A;  2QYO A;  1IRX A;  2CG4 A;  2DK8 A;  3VOD A;  5ICC A;  3FZV A;  1HST A;  3P9I A;  3DBL B;  2MD0 A;  3GF2 A;  5D5U B;  1B6A A;  2DYS H;  1DPU A;  2F48 A;  2ZME C;  3CCS I;  2EIJ H;  1XX5 A;  2ZCW A;  3ERE D;  1IUY A;  1OR7 C;  2FU4 A;  1S7A A;  5E3O A;  2B9S A;  3O8G A;  1ZYR F;  1KZH A;  5BNG A;  1JKP C;  4MO7 A;  3WTZ A;  2BY0 A;  3JSO A;  3LST A;  1MJA A;  3K10 A;  4P55 A;  3FXR A;  3F8C A;  5GP9 A;  3GTL J;  4LK0 F;  4B8X A;  1IRZ A;  4RGX A;  4IOC F;  2ISZ A;  3HOX J;  4BHB A;  2LKS A;  3SHF A;  3BC8 A;  2M30 A;  3LFU A;  4Y3O A;  3VDX A;  1B9N A;  3H1C A;  3K1M A;  2ZJ2 A;  5J3L A;  5K5Q A;  2BVM A;  4LOC A;  2CS3 A;  2ZNZ A;  3ZQC A;  2Y9Z A;  1FYL A;  2A69 F;  4D1Q A;  3MZ8 A;  4U0V A;  3FKJ A;  1QNT A;  1FMW A;  2QM3 A;  4B09 A;  2XKO A;  2X9D A;  2JQ7 A;  4QPO A;  2MA3 A;  2R7O A;  3MAJ A;  2VJ5 A;  3I58 A;  3M1E A;  2MD5 A;  5F64 A;  1PUE E;  3B6A A;  2A5Y B;  3ABT A;  2VQC A;  1VQ9 I;  4CCL A;  2LH9 A;  2XRN A;  4XBF A;  3I55 I;  1D8K A;  3HGG A;  5IYB J;  2PJP A;  2DMQ A;  4D0P A;  1U8R A;  1R49 A;  3AL0 C;  2VAS A;  2HQA A;  2CGP A;  1MW7 A;  4I0A A;  2X1C A;  5KCM A;  2QF7 A;  4U7B A;  5D5V B;  4FX4 A;  4PSX A;  1QVT A;  3Q5F A;  1J7K A;  4XOT A;  2IS4 A;  3RKQ A;  4ESJ A;  2JRM A;  5JHU A;  4A93 J;  4HNT A;  2OZ6 A;  4G7H F;  1BI3 A;  1YLF A;  5LGU A;  4MHG A;  1LDK B;  4KIC A;  3QQA A;  3E6M A;  1HOM A;  3JRG A;  1S8N A;  4YEJ A;  4E7Z A;  4XRF A;  5FRN A;  3KLO A;  2A3S A;  4MEY F;  1XDU A;  1X19 A;  3K4B A;  2Z99 A;  3RYP A;  3V7R A;  1ERD A;  4KMU X;  4F55 A;  4CYC B;  5FLX K;  1AHD P;  1Z7U A;  3SDG A;  5GPC A;  3H35 A;  3CMM A;  3UNG C;  4WCG A;  2LD5 A;  4IQJ A;  3NEU A;  4E7J A;  1PVE A;  1BI2 A;  1JE8 A;  4HLY A;  1OCR H;  2HQN A;  3FXQ A;  1WJB A;  3A03 A;  1MBE A;  2H09 A;  1JGG A;  3IUO A;  4UVC A;  5FRO A;  2HYF A;  1QPI A;  4G9Y A;  3E7L A;  2MYS A;  3KP3 A;  5F1R A;  3WGH A;  4EM1 A;  2L9S A;  4FE7 A;  4JX5 A;  2QSH X;  5D6F A;  4BQA A;  1YJ9 I;  4XLE A;  4PGG A;  4FET A;  4IHS A;  3M07 A;  4JYK A;  3K4K A;  5LGN A;  1JT6 A;  1S29 A;  5HVQ C;  5CVU A;  2HPM A;  4BJ6 C;  3J80 Z;  4KIF A;  2COB A;  1YIJ I;  4A3I J;  1P6R A;  2XAJ A;  2GAU A;  2FE3 A;  1T56 A;  5A2Q K;  1X1P A;  3BR6 A;  4ON0 A;  3H9Q A;  4B47 A;  1ZAR A;  3GTQ J;  1R5I D;  1R4N B;  3ABU A;  2VN2 A;  4D5F A;  3BLY A;  2XRL A;  3E5X A;  2HDW A;  1MZB A;  2JVG A;  1BJA A;  2KRC A;  3G71 I;  5DS9 A;  5B3S H;  3KZY A;  4AIH A;  2CUJ A;  1GLN A;  3P7N A;  5IY5 H;  1T0F A;  3WG7 H;  1GXQ A;  3P5J A;  1WCM J;  2K86 A;  2LYC A;  2MG4 A;  2ZSI B;  5ILS A;  3OS1 A;  3CLO A;  4IZZ A;  3LAP A;  1JJ8 C;  1REP C;  1MMD A;  4NHJ A;  5ERI A;  4IF4 A;  3Q9V A;  4XLN F;  1Z6T A;  2CQK A;  4V2G A;  1EH7 A;  1W36 C;  2HDD A;  2DQL A;  4ZYG A;  2VLA A;  4OOI A;  2VXZ A;  4LK1 F;  5HS9 A;  2GIZ A;  3OSG A;  1XG1 A;  3QP6 A;  2DDA A;  4CH7 A;  4B3A A;  3WG9 A;  2E2J J;  1J5Y A;  2BY3 A;  3M8F A;  3P9K A;  1YS6 A;  2A5W A;  3U2R A;  1CF7 B;  2LY1 A;  2K85 A;  3PQJ A;  3MKZ A;  1G8X A;  2LP0 A;  2KKO A;  4E7L A;  3OR2 C;  4C30 A;  1A36 A;  3HGY A;  3HRU A;  1SFK A;  2O6G E;  4GXO A;  1WZ2 A;  2GOM A;  2MW8 A;  3E5Q A;  3KYL A;  4DIQ A;  1R1T A;  2RV8 A;  4EM2 A;  3HKZ A;  2EV5 A;  4HX4 A;  2EZK A;  4HSR A;  1X3U A;  2Q2E B;  5CPR B;  1WPK A;  3E6D A;  5FKK A;  1YHQ I;  2FD5 A;  1IG7 A;  2JK3 A;  4IKF A;  1R22 A;  3I53 A;  1OQY A;  5M3F J;  3ABL H;  4KT5 C;  3FMR A;  3ZMD A;  2R0Q C;  1K7A A;  1STZ A;  4O6J A;  2R7X A;  1Z77 A;  4NQW A;  1TL8 A;  1HSJ A;  5D6E A;  1IO2 A;  1JUP A;  4L0Z B;  1YI2 I;  1UAA A;  3K4J A;  2JA7 J;  3GTO J;  3W2W A;  2AQF A;  3S1N J;  1W0U A;  2DLL A;  5DCM B;  3OV8 A;  5HLT A;  5E1W A;  2P81 A;  3K4L A;  2W24 A;  4E4H A;  1BL0 A;  1T08 B;  3T8R A;  5EEH A;  4OAZ A;  2K9L A;  5D4R A;  3BR2 A;  1V54 H;  4H0E A;  3CZ6 A;  3EDP A;  1ZGJ A;  4YII A;  2W4S A;  1I1S A;  3TP0 A;  1ZGW A;  2CV2 A;  4E7K A;  2NVQ J;  4DYC A;  4V19 K;  5HNH A;  1EV7 A;  1K78 A;  4BQQ A;  3V8K A;  2Z9O A;  3IWZ A;  2VI6 A;  1FY7 A;  3CP8 A;  4XLA A;  4D9J A;  5BQT A;  4IHV A;  1X1D A;  2CYY A;  2K9S A;  3P9C A;  1BM9 A;  2LR8 A;  5H20 A;  5KVR A;  3OIO A;  2QEX I;  4IVN A;  5BS6 A;  4L18 B;  4GO1 A;  2RNG A;  2EFO A;  3U9G A;  1ETX A;  1P9Q C;  1Y1V J;  2EH3 A;  1MBJ A;  2MLK A;  3E0J B;  4XLP F;  2ID6 A;  3EUH C;  4ENJ A;  1UZC A;  4A3D J;  5LEK A;  2R5Y A;  4I7H A;  3RI4 A;  2P7C B;  1FX7 A;  2BYV E;  1Y0N A;  2FSW A;  1Y1W J;  4EGY A;  2DMP A;  1QQI A;  1V5G A;  3RKX A;  1SFE A;  5EZH A;  5FLM J;  2JVH A;  1ZLJ A;  4EM0 B;  2BY2 A;  3MZY A;  3CMA I;  3GTK J;  1SVM A;  4M6Y A;  2M87 A;  4A3B J;  2HZD A;  3OOP A;  2K27 A;  2QUF A;  1ETY A;  1PJR A;  3LOC A;  1LE8 A;  2HVS A;  2V1D A;  1PP7 U;  3CDH A;  4A0X A;  1TQM A;  2IXS A;  4B43 A;  4HF2 A;  3M8E A;  1ZG5 A;  4Q5S F;  2F4I A;  1TP4 A;  5LGT A;  1KYW A;  3HTS B;  3EQL F;  1RUN A;  2LDU A;  1K4S A;  4GCV A;  1FLI A;  3C2G A;  3OS2 A;  3OL3 A;  4HDU A;  2FML A;  2HVR A;  3BR0 A;  3IH4 A;  4JP0 A;  4M71 A;  3LSG A;  2E71 A;  4W97 A;  1IAW A;  2M3A A;  4F93 B;  2DYR H;  1IXS B;  1YO5 C;  4U7D A;  3HRT A;  3LQQ A;  3OSF A;  2QQA A;  3DBR B;  1U5T C;  2BXZ A;  1R58 A;  4OMZ A;  1SAU A;  4KT6 A;  1IN8 A;  3I9V 2;  2XF7 A;  5F0F A;  4ZDO A;  4YIF A;  3FKI J;  3K4N A;  4AYB N;  3BQZ A;  3LSJ A;  1FOW A;  2DT7 B;  1NG6 A;  3QWL A;  4IX7 A;  4BBR J;  3BG3 A;  1TWF J;  3WTX C;  3ZN1 A;  3LNQ A;  5FB2 A;  1WKM A;  2LLK A;  3ASN H;  2AXL A;  2QQ9 A;  3V7C A;  4S05 A;  2BOL A;  5B1A H;  1FSE A;  2E60 A;  1HBX G;  1OIS A;  3VSL A;  1MH4 A;  1JKR C;  1GV2 A;  1U2W A;  2OCC H;  2JUC A;  1MDM B;  2UWM A;  3MKY B;  2IVM A;  1G4D A;  3OWT A;  4U88 A;  1B59 A;  5M5X J;  1MSE C;  4Q47 A;  2UXX A;  4CCK A;  3RIR A;  4HX8 A;  4CO8 A;  4HEA 2;  3J81 K;  3HPH A;  1Q1H A;  2LRE A;  2BVL A;  2R93 J;  1F5T A;  3A2K A;  1W1W E;  2W48 A;  2L9R A;  3HM5 A;  4IHX A;  2FA5 A;  3CC4 I;  2EIK H;  2HXI A;  1GDT A;  4PJM A;  4RDU A;  3OYE A;  1TW2 A;  2J5O A;  1JJ6 C;  3ZMT A;  5C3E J;  3ABK H;  1XB4 A;  4BE2 A;  2XAG A;  2H1L A;  3DPT A;  1DQU A;  4RAG A;  4XKW A;  3TP3 A;  2X85 A;  1FJL A;  1TT5 B;  2BE5 F;  2X4H A;  3S32 A;  2JA2 A;  5GAG J;  3KEY A;  1O57 A;  1LPQ A;  1UHS A;  3ZGK A;  2JSC A;  2OUM A;  3QAH A;  1SD6 A;  2TCT A;  1UFM A;  4CCN A;  1TWA J;  3H0D A;  2DPD A;  3LSH A;  4XRM A;  3JRE A;  1U78 A;  3CTA A;  3VYR B;  1O3R A;  3GZ6 A;  1T8I A;  2VUM J;  1SFX A;  3CCQ I;  4ESF A;  2LKP A;  3U1D A;  3QOD A;  2M34 A;  3GTG J;  3NWS A;  4RB3 C;  1ETV A;  2HFH A;  3QPL A;  3DKW A;  2GIV A;  2W00 A;  2VKE A;  1R7J A;  3ZMZ A;  3OYF A;  1A31 A;  2XPW A;  2DFF A;  1LQ1 A;  2IGM A;  2E1N A;  2LMD A;  2L02 A;  2HVQ A;  2NVT J;  2LTP A;  1KGS A;  4B48 A;  4ANJ A;  5F0H A;  1FTZ A;  1IN4 A;  2FOW A;  4NC7 A;  2X48 A;  5LFA A;  2ACJ A;  2HR3 A;  3SFI A;  2CFO A;  3WTV C;  3J7Z I;  1MJB A;  1D0Y A;  3HSF A;  4KJZ A;  3TED A;  2VQL A;  3TMO A;  1J59 A;  2CFX A;  4IPA A;  5EYR A;  1APL C;  3DPU A;  1VQO I;  2X6X A;  2VOD A;  1JUS A;  1ON1 A;  2XAH A;  3KP4 A;  2L01 A;  3JRC A;  3G6E I;  3ZQI A;  1R1V A;  3RPU D;  1MBH A;  4M3E A;  4RAY A;  2K02 A;  1FBU A;  3CES A;  4B4C A;  3BOQ A;  5EEG A;  4FCY A;  3ELK A;  3PIP F;  2M4G A;  3O2P E;  4MQ9 F;  2ZKZ A;  3GFL A;  3K1N A;  3TDU C;  1MBG A;  2EA2 A;  2PMH A;  1RR7 A;  3EPZ A;  5E18 F;  1T95 A;  1FSH A;  3ZMS A;  1MND A;  2VPR A;  3ZMU A;  2R7Q A;  2EV6 A;  3VB2 A;  2Z2S B;  3V8J A;  4KUM A;  1UCR A;  1O7L A;  4FE4 A;  2P0W A;  5M5W J;  4KYW A;  2CSO A;  1U9N A;  4N9H A;  2IJL A;  2EZI A;  3LA3 A;  4P1W A;  4Z6Y A;  4IRI A;  1Z3X A;  3K4M A;  3WGG A;  4B3X A;  1B72 B;  1R71 A;  2YUS A;  4M72 A;  5JLX A;  2E2H J;  2CUF A;  3FHN A;  5AIQ A;  2E35 A;  4M74 A;  1G3Y A;  3H9G A;  2PLY A;  2FQ4 A;  3HBL A;  2ZJR F;  4X6A J;  4RGU A;  1QO0 D;  1FTT A;  3I59 B;  5E20 A;  3VWB A;  2PN6 A;  1RKW A;  4FAS D;  3CMY A;  3OYA A;  2IEK A;  1ZH5 A;  4I98 B;  1G2H A;  5FD6 A;  1ZLK A;  3QPT A;  3CCE I;  1T6S A;  4HAM A;  2VT2 A;  3CJQ B;  4L5E A;  4GFB A;  2N8G A;  2VKH A;  4UV9 A;  2F4O B;  2ELJ A;  3ZN0 A;  1ORK A;  1E3O C;  2E7W A;  1H88 C;  2E1C A;  3MD2 A;  2VJJ A;  4Q4Z F;  1NH3 A;  2EFQ A;  4E6K G;  2CH0 A;  2XAQ A;  3CCU I;  4YG2 F;  1VF9 A;  4ZTF A;  3EUK L;  4CZC A;  5K7H A;  1I5Z A;  1ONV A;  2K4B A;  4AWX B;  4IHT A;  4KIS A;  1W5T A;  2H1K A;  3LSI A;  3E97 A;  2M7B A;  4BUP A;  2KDO A;  3S2D J;  1NTC A;  3N05 A;  3KCC A;  2B0L A;  3ZCO A;  4GGG A;  2V26 A;  1KQ0 A;  2NS0 A;  2BHY A;  1MGT A;  2WC2 A;  3FX3 A;  1LNW A;  3HEF A;  3AG2 H;  4ASN A;  2WAQ A;  4PK4 A;  4XRS G;  2GLO A;  2DCE A;  2KMU A;  1SMT A;  1U9O A;  2A07 F;  4M9Z A;  1BOB A;  2I10 A;  1CF7 A;  2WV1 A;  2RC4 A;  2XGC A;  3SFZ A;  5JI6 A;  1TNS A;  3RZD J;  3N97 A;  1YX3 A;  2IA1 A;  4XMY A;  2LF7 A;  1EH6 A;  1YYV A;  3H9J A;  3Q0U A;  5KAI C;  3CCV I;  1J2X A;  4ABZ A;  3S3N A;  4RGR A;  1XS9 A;  1D1A A;  2VIX A;  3V8L A;  3CO7 C;  3WTY C;  1TC3 C;  4DOZ A;  2KFD A;  1S3J A;  3LAJ A;  4BY7 J;  1G3S A;  4O3M A;  3HOU J;  3SDB A;  4A69 C;  3K70 C;  1Y8R B;  3RSN A;  1HW2 A;  1ON2 A;  1VI0 A;  3GCM A;  1BC7 C;  5FKM A;  3GME A;  1X2N A;  2Q2E A;  3K69 A;  2CU7 A;  2WWY A;  5C4J J;  2ZO4 A;  4ZYE A;  1FBQ A;  4MTE A;  3DFG A;  1I39 A;  3DEW A;  1ZRD A;  4QIW N;  2KHM A;  1IZ1 A;  1EJ9 A;  4M3D A;  1BI1 A;  3WHB A;  3PO2 J;  5M5Y J;  2ELK A;  1N75 A;  2FXA A;  2R7U A;  5L3C A;  1EH8 A;  1E17 A;  2O03 A;  2A05 A;  2PG4 A;  5DCM A;  2FBH A;  2TRT A;  4B44 A;  2PI0 A;  1D5V A;  2NS7 A;  2NOJ B;  2R92 J;  5HDK A;  1YX5 A;  3KYD B;  1YIT I;  3IV5 A;  3M9A A;  2RVC A;  3KX2 A;  5ILV A;  2OC6 A;  2FNA A;  2PBI A;  2AS5 F;  4AVP A;  1R5H A;  2I5U A;  3S93 A;  1U6G A;  3TDZ C;  1A04 A;  4KNY A;  3CUQ A;  1I27 A;  2FNP A;  3HOY J;  1EF4 A;  1B9M A;  3VEP A;  3KE2 A;  3FXU A;  4BEH B;  3BJO A;  4HBL A;  3WTS C;  4JBA A;  2VQH A;  2D2W A;  2A6H F;  3DLA A;  4HOB A;  1VZ0 A;  2RQQ A;  1OCC H;  2EZH A;  1JHF A;  3HB9 A;  4ZH4 F;  1Z21 A;  1BW5 A;  3GLX A;  1IN5 A;  4LG0 B;  4XLH A;  4IL6 C;  2PQ8 A;  2L7K A;  3LA7 A;  4ZYD A;  1FEX A;  2X6O A;  4XOP A;  5BMZ A;  5JLW A;  3GXO A;  1RR8 C;  4PJN A;  1NK2 P;  4YRV A;  4V2F A;  3S16 J;  4MLO A;  1KYZ A;  2L4A A;  2RAE A;  5GTI C;  1SVL A;  5IYD J;  1QGP A;  1V55 H;  2K4J A;  2Y2Z A;  1XDS A;  3IWF A;  1HA8 A;  3C2B A;  3FIS A;  4XSX F;  2V6E A;  5DV5 A;  1GVJ A;  2ZJQ F;  3AKZ A;  3GFJ A;  3BR1 A;  4EQQ A;  4HST A;  2LKX A;  2IAI A;  2VE8 A;  1DP3 A;  4A3E J;  1G6N A;  4HG2 A;  3AG1 H;  1F9N A;  2Z3Y A;  2XRO A;  2IGK A;  5EJC A;  1OJL A;  4NB5 A;  1HC8 A;  2VBW A;  4WF2 A;  4BYY A;  4YFK F;  4F91 B;  4XID A;  1WJC A;  3PNV A;  4UUT A;  1N77 A;  3L2R A;  1AKH A;  3Q0W A;  5TJJ A;  5EF6 A;  4DNC A;  3H3Z A;  1YJN I;  1I3A A;  3HPG A;  2VE9 A;  1XCV A;  3ZQF A;  3S14 J;  5K5O A;  3CME I;  1KU2 A;  3HTU A;  2DK5 A;  1MH3 A;  2BW3 B;  1HDD C;  2B7E A;  2ZME B;  3GZ5 A;  3G73 A;  1RRJ A;  1FMV A;  2ZJP F;  4GYI A;  3OYC A;  2JN6 A;  1XGO A;  5DM7 F;  3GUD A;  2EJR A;  4M3F A;  3WU0 A;  3DXJ F;  2D1H A;  2M45 A;  1QU3 A;  2FRH A;  2X0L A;  2CUZ A;  3E1S A;  2XGE A;  2EPF A;  1AA7 A;  3SZP A;  3DEU A;  3IKT A;  2LY2 A;  4A0Y A;  3E3V A;  3KP2 A;  3RQ4 A;  2Y48 A;  2FQ3 A;  2K9Q A;  3FHZ A;  3IKV A;  1MDM A;  1FP1 D;  4RB2 C;  4XM3 A;  5LLQ A;  5HOO A;  2ZBK A;  1K6Y A;  4N9I A;  3UR3 C;  4KN4 X;  1W5C C;  4M3G A;  2R4G A;  3ZQL A;  5J47 A;  1KU9 A;  4IRG A;  4MFE A;  3K6G A;  2OJE D;  5KK1 A;  1QPM A;  1FC3 A;  4A3J J;  2JRT A;  1P4W A;  3D1N I;  2HGC A;  4BXU A;  2FJ1 A;  2L7F P;  4W1U A;  2DA2 A;  1U8B A;  2F2E A;  1MMG A;  4I09 A;  1X3W B;  4IRH A;  4RB0 A;  3G4S I;  1Z05 A;  3AL0 B;  3KP5 A;  2R7S A;  2KP6 A;  1NG7 A;  5JFR A;  4AD9 A;  3HDD A;  3BTL A;  4YFX F;  1ZRF A;  2O8K A;  3VOE A;  1R23 A;  1NHA A;  1E3P A;  1YG2 A;  3HKZ N;  2OF7 A;  4KDP A;  2GXG A;  3T8T A;  4Y4R A;  2V1N A;  2GOX B;  1WI3 A;  1LDD A;  2LK2 A;  3G1L A;  1R9T J;  1VQM I;  4UVA A;  5IP7 J;  5CLS A;  2KDZ A;  3B73 A;  2L9V A;  1P4X A;  5E8I A;  3QU3 A;  4BH9 A;  5D8L B;  4LG3 A;  1W36 D;  3A1Y A;  3BDD A;  4LGW A;  3LA2 A;  4I76 A;  3LSM A;  4L9J A;  4XKB A;  4RMN A;  3RTR A;  2KIQ A;  3PFI A;  5FKO A;  4LD5 A;  1I3Q J;  2HQR A;  4D5C A;  2OTJ I;  2W82 A;  4CDG A;  5J1R A;  1IN7 A;  3KP7 A;  1OCP A;  2NVU B;  3ZQG A;  1A35 A;  2UUZ A;  2I8D A;  5E8G A;  2QQB A;  3JTG A;  5LHG A;  1QHG A;  1V3F A;  4BE1 A;  1VQL I;  4CCO A;  4HV5 A;  2AQE A;  2VT3 A;  1U0J A;  3ZRG A;  4N0B A;  3J7A Y;  1DP7 P;  2CJJ A;  2WA0 A;  4JX6 A;  3DWL E;  1JHH A;  3QPS A;  3DTE A;  1ETQ A;  5E1X A;  1XMX A;  2ZNY A;  2D45 A;  2QGU A;  2EB7 A;  3ISP A;  4F7Z A;  1ZG1 A;  1HW1 A;  3VFZ A;  5D5X B;  1G3W A;  2CW0 F;  5KAF C;  2DTZ A;  3I3L A;  4DBR A;  1GHC A;  5IOZ A;  4PGH A;  4M6V A;  3ONQ A;  2DFH A;  2O5R A;  1MNM C;  1XCB A;  4HNV A;  2VJ4 A;  3AG4 H;  2Z33 A;  2XB5 A;  4I02 A;  4NC6 A;  5CVJ A;  3HL2 A;  2GBY A;  3I56 I;  5EGO B;  3FF5 A;  4R8H A;  3GO5 A;  5JVT A;  1VTN C;  1ACI A;  3GWZ A;  2LC2 A;  1S72 I;  3I4P A;  1B72 A;  3L09 A;  3PUF A;  4NDL A;  2HXO A;  3CD6 I;  3V4G A;  3DKY A;  4BQN A;  2DA4 A;  3D5L A;  2NS8 A;  3RZO J;  4BXX J;  3RJP A;  5ICE A;  4Y52 J;  2JWT A;  4C2U A;  3S2H J;  4D7M A;  2IRF G;  3CF5 F;  2F5D A;  4A2U A;  1OYW A;  3QOE A;  1MKM A;  2QLZ A;  1B4A A;  1TW3 A;  1ITY A;  4DQ2 A;  1KU7 A;  1BA5 A;  3RPQ A;  1FZP B;  2KQR A;  3HUG B;  1Z91 A;  1Z7L A;  5DUK A;  4AIK A;  5HLH A;  1RUO A;  2K9N A;  2A61 A;  1UJ8 A;  3ZXS A;  2OQR A;  4TV7 A;  1K61 A;  4GRI A;  3GZN B;  4O5V A;  3REO A;  3GVA A;  1K83 J;  2KIU A;  5HNF A;  3BZ6 A;  4YEL A;  4HF1 A;  1FWZ A;  1B8I B;  3SXY A;  2W7N A;  3TW6 A;  1ZHF A;  2DW4 A;  1XN7 A;  2OZU A;  3I4M J;  2TDX A;  3L2V A;  1LFU P;  1H9T A;  3RPU A;  2E5Z A;  2HI3 A;  3H5R A;  4PJ0 C;  2M1B A;  3H36 A;  4RM2 A;  2MFZ A;  3RYR A;  2R7T A;  2DJN A;  1HKS A;  2ME6 A;  3ZPL A;  1J0R A;  2M2E A;  2P8T A;  1HF0 A;  2IP2 A;  2CQN A;  1YQA A;  2X1D A;  4XR6 A;  5E17 F;  3IH3 A;  1JTX A;  2PX9 A;  3DU6 A;  4KN7 X;  1H9G A;  3HG9 A;  3UKG A;  1IGN A;  4KIG A;  4RAF A;  5L3B A;  3MZH A;  1DU6 A;  2E1O A;  4OWR B;  3TOA A;  2ID3 A;  3RKY A;  1SEU A;  2R7W A;  4RLQ A;  1SAX A;  2EK5 A;  4XRS A;  1WFX A;  5M3M J;  1GV5 A;  4C3I J;  1UST A;  1D0Z A;  2OA4 A;  1YJW I;  3KEQ A;  2XB0 X;  3LMM A;  3F9K A;  4RA2 A;  4A3G J;  4HYE A;  5IYC J;  3C1D A;  1W7P D;  3S2W A;  4BDZ A;  2STW A;  3WU1 B;  3IC7 A;  2Z16 A;  3OY9 A;  1Y39 A;  3H92 A;  4P9F A;  2VBX A;  2BV6 A;  3A01 B;  3GEZ A;  1JUM A;  2NVY J;  1G3T A;  2VBZ A;  1I6X A;  2HOA A;  2NOG A;  5IT9 Z;  3CP2 A;  1A5J A;  4PSW A;  2VOO A;  2VKV A;  4OU0 A;  3KYC B;  1ZR4 A;  3TO7 A;  1P4A A;  1Z1D A;  3KIO A;  3EYY A;  3OYH A;  5JR3 A;  4BAY A;  2VXD A;  3KP6 A;  1VQ7 I;  1EKE A;  3DU5 A;  1QZZ A;  2X51 A;  3HIF A;  5H2F C;  2ELH A;  1KON A;  4U0Y A;  5CVV A;  3S15 J;  3ESW B;  5CKT A;  1DUX C;  1YW7 A;  3BTJ A;  3SZT A;  4DW6 A;  1T0F C;  1WRJ A;  2KJC A;  2Y0S A;  3A4C A;  4II3 A;  4M73 A;  4WWC A;  2L4M A;  3S3M A;  4C2M J;  3DKX A;  1OMI A;  3BJ6 A;  2G7U A;  1OCZ H;  3S1M J;  3GTM J;  1QZY A;  4PJJ A;  2JA6 J;  3CF2 A;  3G1O A;  2Y30 A;  4EJO A;  4BEH A;  1PYV A;  1XSV A;  4J00 A;  2L2O A;  3ROU A;  5E79 C;  1SFU A;  3HC7 A;  1OLT A;  4HW0 A;  4PUS A;  3TO6 A;  1U5T B;  4UUS B;  2WV0 A;  5C4X J;  4P5O A;  2H8W A;  4UVB A;  1W0T A;  2GM4 A;  2IPQ X;  2MLG A;  5E3N A;  3AAF A;  1AWC A;  2HPI A;  3OR1 C;  4I99 C;  3JRF A;  1SD4 A;  3W2V A;  1IRG A;  4LG0 A;  2MC3 A;  3VYS B;  4RB1 A;  2DAO A;  3HHH A;  1W7P B;  4G8X A;  2EZL A;  2HKX A;  4LB6 B;  5FLV A;  3FIW A;  2IS1 A;  5EDN A;  3OIP A;  1ODD A;  3M7G A;  4I2O A;  3FBN B;  4LIU A;  1TT0 A;  3F72 A;  3PSI A;  3D5S C;  4M9X A;  2EQR A;  1YS7 A;  4LLN A;  4EEF G;  2KT0 A;  2JTV A;  4CA0 A;  2HTS A;  4BS9 A;  3HOV J;  4IQ4 A;  4N4O B;  3QYE A;  1VQP I;  3J80 K;  2QKL B;  2CMP A;  2RKH A;  2ZXH A;  2KLO A;  3VYU B;  4EV0 A;  2YPR A;  5HLI A;  4G7O F;  4BAC A;  1V4R A;  5DUI A;  1LEB A;  4RS8 A;  3FXK A;  4LLL A;  1RKT A;  3G3Z A;  3OYK A;  5CVR A;  1HCR A;  1QZE A;  3T5X A;  2PMZ A;  3HJE A;  2J5P A;  3Q9S A;  2LFB A;  1ZGA A;  2JA8 J;  2EIL H;  5CJ9 A;  2LNB A;  2DQR A;  4C9Y A;  5J40 A;  5FO5 A;  3JW4 A;  4FQG A;  2BW3 A;  5H6R A;  4UNO A;  3WTW C;  3E6C C;  3I4N J;  2ZME A;  4MTD A;  1SD7 A;  4IOA F;  4E70 A;  1FYM A;  3K0L A;  2V1U A;  1OR7 A;  3IHU A;  5FLX Z;  4F92 B;  4KA4 A;  3VPR A;  4DZP A;  4S04 A;  3JRD A;  2IBD A;  1LEA A;  1RES A;  4DBQ A;  1YOV B;  2DI3 A;  1X58 A;  2K40 A;  3FXL A;  4FTH A;  4BHC A;  3BJA A;  2XAU A;  1GT0 C;  2QCO A;  5D4S A;  4CYC A;  2ZXI A;  2HU9 A;  2XAF A;  1FOY A;  5CYV A;  4J19 A;  1TQP A;  1WH5 A;  2KPM A;  3H3V K;  3KFW X;  3L1P A;  3CJT B;  4Y15 A;  4UV8 A;  1Z6R A;  2DFE A;  3H3U A;  4NBQ A;  3R60 A;  3SEQ A;  3ZOB A;  5JHF A;  3GLL A;  1MNE A;  2WY7 Q;  1T2K A;  1L3L A;  3LWF A;  3MN2 A;  4XIC A;  2WAQ N;  3IL2 A;  5F27 A;  1WJE A;  5L3D A;  3TW7 A;  1QBJ A;  4XLC A;  5J6X A;  1P7I A;  3PJR A;  2CV0 A;  2HTJ A;  4NQW B;  5A2Q Z;  3BG7 A;  1BR1 A;  2DPU A;  1DPR A;  3M3Y J;  3DF8 A;  3ZMV A;  2XSD C;  4MIM A;  4EJT A;  3FK7 A;  1ZG3 A;  3H5N A;  4FHT A;  2GWR A;  1WVR A;  2HOE A;  2V9P A;  2WBM A;  3ABM H;  2W25 A;  4K2E A;  5CVI A;  1XC5 A;  4D7N A;  3M4O J;  1X2M A;  1XGS A;  2OCE A;  1S9H A;  3GTJ J;  5DD8 A;  1J09 A;  3WTU C;  1HXD A;  4UUV A;  4R79 A;  1TLH B;  2P4W A;  3EET A;  1ZTR A;  2QBY B;  2QEN A;  2GXB A;  1WJD A;  2M9H A;  2F5E A;  2XGD A;  1S5L C;  1ENH A;  3KZI C;  2MC4 A;  2KIF A;  4N4N B;  3F8B A;  5DCF A;  4AU7 A;  2ZC2 A;  2ADU A;  2WB1 A;  5FRM A;  4CHU A;  3F23 A;  3BT9 A;  3PQK A;  1EA3 A;  2JJ7 A;  1K78 B;  3BWG A;  4NC8 A;  1IRF A;  2DOF A;  4B1R A;  1GXP A;  2KIM A;  5ICG A;  4XKV A;  1K79 A;  2HS5 A;  1WJF A;  4OIR F;  4A5N A;  2OAZ A;  2ZSH B;  2DT5 A;  3BZK A;  2Y0M A;  1I6H J;  1P7J A;  2VON A;  4P9U A;  4A6D A;  3QOP A;  5L3E A;  3BR5 A;  2E34 A;  3F3X A;  2UXN A;  2R5Y B;  2XDV A;  1XMK A;  1VQK I;  1OCO H;  1VND A;  3OIQ A;  4F52 A;  1O3T A;  1YRN B;  3AG3 H;  3S8P A;  2OQG A;  1NK3 P;  3WU2 C;  4QTR A;  2FUG 2;  1BR4 A;  1N78 A;  1UG0 A;  1VQ6 I;  2LF8 A;  2V6C A;  3CO6 C;  2M7A A;  4L5J A;  3CQZ J;  2C6Y A;  2BY1 A;  3K70 D;  2PEX A;  2JPC A;  2Y75 A;  2VBY A;  2LY9 A;  2F4M B;  3LQR A;  4GYG A;  4JX4 A;  2XF5 A;  2UV1 A;  5F0C A;  3FK6 A;  3MWM A;  1LE8 B;  4UHT A;  1V5E A;  5DDG A;  3HOT A;  3KLN A;  5J1U A;  1POG A;  4WX9 A;  1KQ9 A;  3F6V A;  5E3L A;  3QYF A;  3TKY A;  2R7D A;  1MD0 A;  2VL8 A;  3BCA A;  3LFK A;  2MH9 A;  2R7R A;  3D0S A;  4AM3 A;  3DPL C;  1OKR A;  4HDV A;  1BOA A;  4BDY A;  2E19 A;  2DOE A;  4FT8 A;  1XGM A;  2HQ5 A;  1E0E A;  1C0W A;  4LMY A;  4YFN F;  1R4M B;  3K2A A;  1N25 A;  4HV6 A;  3MEX A;  2F5V A;  2L7M P;  1H8A C;  4ENK A;  2X6Y A;  5HDG A;  1D1C A;  3N4M A;  4PFP A;  2M4K A;  4BKX A;  1I50 J;  1IW7 F;  5J1Y A;  4C3J J;  1A6Q A;  2E1M C;  4L9V A;  4CXF A;  9ANT A;  4LJZ F;  5CQG A;  4A3F J;  2BXY A;  2QA4 I;  3FXM A;  3BG5 A;  4ESB A;  5C44 J;  3OS0 A;  5AON A;  3L2Q A;  5D5W B;  2Z1D A;  4ZYH A;  4AVZ A;  4XKC A;  1GVD A;  1RNL A;  4FX0 A;  1IC8 A;  3T1B A;  4E7I A;  5E1Z B;  1KU3 A;  1S6L A;  4MEX F;  1MBK A;  3BG9 A;  2DTR A;  1B8I A;  3ZR8 X;  2COM A;  1O3Q A;  1AU7 A;  2QKM B;  4G7Z F;  1HKT A;  1YIO A;  2CV1 A;  4AUX A;  4G94 A;  3J7A O;  2IA0 A;  3PO3 J;  3TOB A;  2DA5 A;  2ECC A;  4M3B A;  5GPA A;  3RQI A;  3NAR A;  3W6K B;  3OYB A;  4UY8 I;  3JTH A;  2L5Q A;  1UG2 A;  2MH2 A;  3SYT A;  1ETW A;  4OIP F;  4H4K C;  3IH2 A;  1ETK A;  1ZK8 A;  1TWG J;  2MGQ A;  3SQN A;  3OL4 A;  1RZ4 A;  2IA2 A;  3QRF F;  2R7V A;  4HF0 A;  1MBF A;  1XGN A;  3ML6 A;  3M8J A;  3ZP5 A;  1LVK A;  3BTI A;  4G6D A;  1F36 A;  5HS7 A;  3CJR B;  2IS2 A;  1MIJ A;  2O61 A;  1MMA A;  4L0Y B;  3K1P A;  3BPX A;  2DMT A;  1PDN C;  3F22 A;  5IT3 A;  3F8F A;  3RKW A;  2BHZ A;  2D1V A;  4C3H J;  3HOS A;  2ZXW H;  2E1M B;  4XL9 A;  1PUF B;  4QWQ A;  2YSR A;  3E6B A;  3CDI A;  1A6I A;  1R1U A;  3HSE A;  4AID A;  4KFC A;  3IRR A;  3NAU A;  2RRE A;  3F8M A;  2XPV A;  3HHG A;  3ZQQ A;  3OYM A;  4EJW A;  2OU2 A;  1BI0 A;  2K7L A;  2V9K A;  3F8N A;  5E3M A;  1Q1V A;  3FBI B;  3SJM A;  2CO5 A;  1P92 A;  1LB2 A;  4MNU A;  4X0G A;  3OYI A;  3X2Q H;  2K3F A;  3DEE A;  3PM1 A;  4JOM A;  3A01 A;  2CW7 A;  1B1B A;  3JAM K;  4UB6 C;  3LSP A;  1BIA A;  1IXR C;  2F5F A;  3EUH A;  5F6F A;  4IHW A;  2IS6 A;  1QHH D;  1IDZ A;  5TRD A;  1LKX A;  4G6T B;  3CUO A;  1O3S A;  2O3F A;  2H6C A;  2DBB A;  3W3C A;  1V5F A;  4CYD A;  3I5U A;  2XC7 A;  1ZR2 A;  2MSY A;  1TNT A;  3J81 Z;  4DYQ A;  3CCR I;  1BIB A;  2E5N A;  1P2F A;  3E5U A;  2EFN A;  2LOO A;  4J01 A;  2DA7 A;  4A0Z A;  4HQE A;  4L5I A;  4JK1 X;  4GDF A;  1ZAO A;  3DLL F;  1RIO H;  2HDC A;  5LHH A;  4UXN A;  1HQC A;  3H0G J;  1IV8 A;  4Y17 A;  2K9M A;  3EUA A;  1PP8 F;  3JRH A;  4WXH A;  1SD5 A;  1ULY A;  2YU9 J;  4CUG A;  4IO9 F;  1U3E M;  2O9L A;  2W1O A;  2M8E A;  4II2 A;  2P6T A;  1U5T A;  1IN6 A;  4UUS A;  1FIP A;  4M6X A;  1X4O A;  2ICW G;  4EGZ A;  3F0C A;  3D5R C;  1W7P A;  1WH7 A;  4JQF A;  1W4M A;  3O8H A;  1TTY A;  2XKP A;  1MMS A;  3WOD F;  2W84 A;  4EJU A;  4ZC3 A;  3WE3 A;  2F5C A;  2FX0 A;  4IXA A;  1FOX A;  1F4K A;  1FYK A;  4P96 A;  5F08 A;  3WHC A;  3HSR A;  3TBI A;  1T39 A;  3HYI A;  4RLF A;  3OYN A;  1XPX A;  3I54 A;  2DMN A;  2PMU A;  1FIA A;  1S7O A;  1M1E B;  3JRA A;  2VC0 A;  1DGR M;  2QSF X;  2LBF B;  1WHU A;  3J7Y J;  3A02 A;  2HKO A;  4A3M J;  2Q1Z B;  1YW9 A;  3TL4 X;  2WAF A;  2R5Z B;  1OCT C;  3C18 A;  2KIS A;  4F3Q A;  3V7S A;  1BJZ A;  5B1B H;  5DYM A;  1HLV A;  3IAM 2;  5BOX A;  2XF6 A;  4HNU A;  3TGN A;  2YU3 A;  2YX4 A;  1JTY A;  3MKW B;  1TBX A;  4HLX A;  5LD2 C;  3BPV A;  1XD7 A;  3JRI A;  2NYX A;  3GX4 X;  2QWW A;  3B02 A;  2UZK A;  2AXT C;  4EJV A;  4CZZ A;  5BPD A;  1KQ8 A;  2O8X A;  3S3O A;  3OYG A;  2VJI A;  5ICF A;  3RCO A;  2HOS A;  2DT6 A;  3BZC A;  3CCY A;  3DCF A;  2G0E A;  4S0H B;  1WJA A;  4CIC A;  1FT9 A;  1TWH J;  5GAH J;  3CUQ C;  3CC2 I;  2HEO A;  1WSU A;  4HX7 A;  1J75 A;  2V79 A;  2KZG A;  1E2X A;  3IP4 B;  3VYT B;  4RBO A;  2EIN H;  2ZXJ A;  2GA2 A;  1VFC A;  2X1E A;  2KJB A;  3KPH A;  3DTK A;  3ULQ B;  4YIR X;  3BTC A;  1D5Y A;  4LB5 A;  2VOP A;  4AIJ A;  4DYR A;  3KZZ A;  3K4C A;  1RPW A;  3GFM A;  1FOK A;  1YE9 A;  1XTA A;  1XSX A;  3I59 A;  3VSK A;  3DBH B;  5K5R A;  4Y7N J;  2LSO A;  2IGN A;  3AFH A;  4RGS A;  4XLF A;  5DEQ A;  4WK8 F;  3OYL A;  2V1X A;  4WXD A;  2PJR B;  1ZRE A;  2CQX A;  4IJA A;  1X3Z B;  2RNJ A;  2XIG A;  2L54 A;  3I64 A;  4BJ5 C;  3CCM I;  3O6B B;  4OIN F;  2DXI A;  2JA5 J;  1OYI A;  4I0B A;  2H8R A;  2QBY A;  2XGX A;  3OYD A;  4MFD A;  2BZT A;  1Y0U A;  3CDL A;  4ZTJ A;  2ECB A;  1R6R A;  4MQV A;  1WJ5 A;  3FXO A;  3HRM A;  3L2W A;  1MSF C;  5EG0 B;  1HW5 A;  1O4X A;  2H27 A;  1BBY A;  2VKD A;  2RN7 A;  4G12 A;  1LFB A;  3CUQ B;  3HXL A;  2HYJ A;  1HKQ A;  3BR3 A;  4U87 A;  4ETS A;  2HNH A;  2BEO A;  4BNC A;  3QP5 A;  2JUG A;  3U21 A;  1AOY A;  2CQQ A;  3A0H C;  2RQP A;  5HS8 A;  2R3S A;  2X6W A;  5F04 A;  3ZQ7 A;  4R1H A;  3JRB A;  3R0J A;  5LHI A;  3MCZ A;  5JVG F;  1WQ2 A;  4CGZ A;  5IP9 J;  1YRN A;  2O0Y A;  2DO7 A;  2KRH A;  4LFU A;  2Y0S N;  3ECO A;  3HRS A;  2CUE A;  3F6O A;  4NNJ A;  2W57 A;  1TWC J;  5KHD A;  1I1G A;  3S1Q J;  2K3P A;  1IXC A;  2WAD A;  1R00 A;  4ZZD A;  1IJW C;  1UHM A;  3HOW J;  2OPT A;  2P5V A;  1XSD A;  2RGV A;  2M8G X;  2EFW A;  3G1M A;  3SZG A;  1S7E A;  5FJ8 J;  3GFI A;  3WTT C;  4ENN A;  3JCU C;  5K7F A;  3LL7 A;  3T0Y A;  2OD5 A;  1X1C A;  3MMY B;  1W5S A;  3FWE A;  4A3L J;  1SFO J;  1RI7 A;  3GBG A;  2FOK A;  2M0M A;  1YW8 A;  5AIP A;  1OYY A;  2KZV A;  2HZT A;  3PSF A;  1JKQ C;  2DN0 A;  1AKH B;  4KIB A;  1YFH A;  1DGW Y;  3I0T A;  3V42 A;  3DTI A;  1T33 A;  5GAE J;  4XQF A;  2DU9 A;  2K5C A;  4A5M A;  3FM5 A;  1QRY A;  3W6V A;  5B66 C;  2EBI A;  4BQO A;  4HZF A;  5L3G A;  4BJT A;  1VQ8 I;  3R0A A;  5GAD J;  1IF1 A;  2OTL I;  2Q8K A;  2LG4 A;  3PIO F;  1R36 A;  5ED4 A;  5J4Y A;  2YR2 A;  4XN3 A;  5CQE A;  3KET A;  1IV6 A;  2Z5U A;  5DTD A;  2GQQ A;  2PMZ N;  2JMW A;  5J4V A;  1T38 A;  3IRQ A;  1JI8 A;  1MMN A;  4PZJ A;  4LLG F;  1SMY F;  3CJN A;  4PCQ A;  5LRR A;  1USS A;  2GA1 A;  3K7A J;  3GTP J;  3M1C A;  3MVP A;  1CQT A;  3LSR A;  3WE2 A;  1K4T A;  4UB8 C;  1DDN A;  2L0K A;  3PNY A;  3S17 J;  1FP2 A;  4MGR A;  2ME0 A;  4CCM A;  2Y9Y A;  3OYJ A;  1FBS A;  1IUF A;  2CRG A;  5D8K B;  3FM3 A;  2W85 A;  4Z2Y A;  3HOZ J;  2CW8 A;  3PL8 A;  4OIO F;  1WGX A;  2Q0O A;  3ECH A;  1Y56 A;  2M5W A;  1Z9C A;  1BC8 C;  1TQI A;  2P6S A;  3PNT A;  5F1J A;  2WTE A;  2LVS A;  2AO9 A;  4AYB A;  4KIT B;  3FMQ A;  4QSH A;  2L3D A;  1QVU A;  1BN5 A;  3QPH A;  2OV7 A;  2IW5 A;  5J8F A;  2EA4 A;  4X1E A;  5DD4 A;  2GZW A;  1X1B A;  2KRF A;  2P5L C; 
#chains in the Genus database with same CATH homology
 4XK4 A;  4DYC A;  2K9Q A;  5J1U A;  1POG A;  4IHV A;  2VI6 A;  5E3L A;  4A3K J;  3OOU A;  3ZQH A;  2ZB9 A;  2K9S A;  2LR8 A;  1PUF A;  3OIO A;  4M3G A;  3ZQL A;  1ETX A;  4MFE A;  1Y1V J;  2EH3 A;  1MBJ A;  4A3J J;  2ID6 A;  4A3D J;  3D1N I;  2R5Y A;  2E19 A;  2FJ1 A;  2L7F P;  3S1R J;  2HQ5 A;  4W1U A;  2DA2 A;  1U8B A;  1Y1W J;  2DMP A;  3K2A A;  5FLM J;  5EZH A;  2AHQ A;  2L7M P;  1H8A C;  3Q3S A;  3GTK J;  3HDD A;  3BTL A;  2O7O A;  2O8K A;  2WB1 N;  4A3B J;  3BQY A;  4BKX A;  1I50 J;  1ETY A;  3HKZ N;  5EZG A;  4C3J J;  2OF7 A;  5J1Y A;  1UMQ A;  3LOC A;  9ANT A;  1LE8 A;  1WI3 A;  2LK2 A;  3G1L A;  4A3F J;  1R9T J;  1IDY A;  5IP7 J;  3BG5 A;  2KDZ A;  5C44 J;  2NVX J;  3BR0 A;  3IH4 A;  1GVD A;  4JP0 A;  1IC8 A;  3LSG A;  1H89 C;  3Q0V A;  1ZKG A;  4W97 A;  4I76 A;  1MBK A;  3BG9 A;  1B8I A;  5K7Z A;  3OSF A;  1AU7 A;  4DZJ A;  5FKO A;  4AUX A;  1SAN A;  3PO3 J;  1I3Q J;  2DA5 A;  2ECC A;  4M3B A;  5F0F A;  3NAR A;  5FKL A;  5GPA A;  3RQI A;  4D5C A;  3FKI J;  2Y31 A;  5J1R A;  1OCP A;  1UG2 A;  4AYB N;  3BQZ A;  3LSJ A;  1ETW A;  3ZQG A;  3IH2 A;  1ETK A;  1ZK8 A;  5IP6 A;  1TWG J;  4BBR J;  2MGQ A;  3BG3 A;  1TWF J;  3LNQ A;  2LLK A;  1ZQ3 P;  1MBF A;  3MKL A;  3BTI A;  1F36 A;  2CJJ A;  4JX6 A;  3QPS A;  1MH4 A;  1JKR C;  1ETQ A;  1JKO C;  1GV2 A;  2DMT A;  1GUU A;  5HOD A;  5M5X J;  1DU0 A;  1MSE C;  4C3H J;  2D5V A;  2E2I J;  2DTZ A;  1PUF B;  2R93 J;  5IOZ A;  2B63 J;  1ETO A;  2L9R A;  2W48 A;  1A6I A;  3HM5 A;  4M6V A;  4IHX A;  1JT0 A;  1MNM C;  1F43 A;  3NAU A;  4HNV A;  2XPV A;  4I6Z A;  2L7Z A;  2XB5 A;  2R5Z A;  2HXI A;  2GBY A;  5E3M A;  1GDT A;  1Q1V A;  2DA6 A;  5EGO B;  4RDU A;  3SJM A;  4A3C J;  1JJ6 C;  5C3E J;  3PM1 A;  2DA1 A;  1B72 A;  3A01 A;  4NDL A;  3TP3 A;  3LSP A;  2HXO A;  1FJL A;  4FIS A;  2DA4 A;  1RET A;  1UHS A;  2NS8 A;  4IHW A;  3RZO J;  4BXX J;  1IDZ A;  4Y52 J;  2JWT A;  2TCT A;  3S2H J;  4D7M A;  1TWA J;  4XRM A;  3JRE A;  2DA3 A;  1U78 A;  1ZR2 A;  2MSY A;  4DYQ A;  2VUM J;  1ITY A;  1BA5 A;  2DA7 A;  4BY1 J;  2M34 A;  2K9N A;  3GTG J;  2YS9 A;  4IHY A;  1ETV A;  3QPL A;  1K61 A;  2VKE A;  1K83 J;  1HDP A;  4AC0 A;  1B8I B;  2XPW A;  3TW6 A;  5EGO A;  3H0G J;  3I4M J;  3JRH A;  1LFU P;  5FKN A;  2NVT J;  2LTP A;  4IEJ A;  2HI3 A;  2XPU A;  5F0H A;  2YU9 J;  1FTZ A;  2DJN A;  2ME6 A;  2X48 A;  5IPA A;  2M2E A;  1HF0 A;  2O9L A;  3SFI A;  5EEA A;  3TED A;  3JR9 A;  2HOT A;  4UUS A;  3B6C A;  1FIP A;  5EYR A;  1APL C;  3IH3 A;  1JTX A;  1JUS A;  3UKG A;  1IGN A;  3JRC A;  3F0C A;  3ZQI A;  1DU6 A;  2E1O A;  1WH7 A;  4BBS J;  2DMU A;  1MBH A;  3O8H A;  4M3E A;  4B4C A;  2ID3 A;  1Z0X A;  4FCY A;  2FX0 A;  4XRS A;  2R7Z J;  5M3M J;  1GV5 A;  4C3I J;  1MBG A;  1OFC X;  1RR7 A;  5F08 A;  3WHC A;  2XB0 X;  2DMN A;  1FIA A;  4A3G J;  2VPR A;  3JRA A;  5IYC J;  2M0C A;  3A02 A;  1BW6 A;  4A3M J;  5EG0 A;  2R5Z B;  5IOY A;  4FE4 A;  1OCT C;  5M5W J;  1BJZ A;  1U9N A;  1HLV A;  2EZI A;  1B72 B;  3A01 B;  2YUS A;  1JUM A;  1JTY A;  2NVY J;  5JLX A;  2NOG A;  2HOA A;  2CUF A;  5E3O A;  2E2H J;  3O8G A;  1A5J A;  3JRI A;  5BNG A;  2FQ4 A;  2VKV A;  1JKP C;  3HBL A;  4MO7 A;  1ZR4 A;  4X6A J;  1FTT A;  1RKW A;  3CMY A;  2IEK A;  1G2H A;  2HOS A;  3CCY A;  3DCF A;  5GP9 A;  3GTL J;  2G0E A;  4S0H B;  3S15 J;  4L5E A;  4GFB A;  1IRZ A;  2N8G A;  3BTJ A;  1TWH J;  4DW6 A;  1ORK A;  3HOX J;  1E3O C;  1H88 C;  5J3L A;  4C2M J;  4LOC A;  3ZQC A;  2Y9Z A;  1VF9 A;  4RBO A;  5K7H A;  3S1M J;  3GTM J;  1VFC A;  2X9D A;  2JA6 J;  3G1O A;  2H1K A;  2Y30 A;  3B6A A;  3S2D J;  1NTC A;  3BTC A;  1D5Y A;  4DYR A;  3HGG A;  5IYB J;  2DMQ A;  1RPW A;  4UUS B;  5C4X J;  1W0T A;  2GM4 A;  5E3N A;  3HEF A;  3JRF A;  2QF7 A;  1QVT A;  4Y7N J;  4XRS G;  3RKQ A;  2GLO A;  2EZL A;  5FLV A;  4A93 J;  3FIW A;  5EDN A;  1U9O A;  3QQA A;  1HOM A;  3JRG A;  2EQR A;  2CQX A;  2I10 A;  4EEF G;  2WV1 A;  2KT0 A;  3HOV J;  2XGC A;  2JA5 J;  2H8R A;  3RZD J;  4MFD A;  3Q0U A;  4ABZ A;  4CYC B;  1XS9 A;  3CDL A;  1AHD P;  1TC3 C;  2ECB A;  3SDG A;  5GPC A;  4BY7 J;  3HOU J;  4A69 C;  2LD5 A;  5EG0 B;  1O4X A;  1MSF C;  1VI0 A;  5FKM A;  1X2N A;  4G12 A;  1RKT A;  1LFB A;  1HCR A;  2CU7 A;  3A03 A;  1MBE A;  2HYJ A;  5C4J J;  1JGG A;  3BR3 A;  2LFB A;  2JA8 J;  1QPI A;  3DEW A;  3E7L A;  4QIW N;  3PO2 J;  4M3D A;  3WHB A;  2CQQ A;  4FE7 A;  4JX5 A;  5M5Y J;  2ELK A;  4JYK A;  5F04 A;  1JT6 A;  3JRB A;  5IP9 J;  3I4N J;  1YRN A;  2TRT A;  2COB A;  2Y0S N;  2CUE A;  4A3I J;  1TWC J;  2NS7 A;  3VPR A;  1T56 A;  4DZP A;  3JRD A;  3S1Q J;  2IBD A;  1RES A;  3BR6 A;  1IJW C;  2K40 A;  1X58 A;  2R92 J;  3HOW J;  2OPT A;  4FTH A;  3GTQ J;  1GT0 C;  2QCO A;  3IV5 A;  4D5F A;  4CYC A;  2M8G X;  2XRL A;  3G1M A;  1S7E A;  5FJ8 J;  4J19 A;  1WH5 A;  5DS9 A;  3H3V K;  3L1P A;  5K7F A;  4A3L J;  1SFO J;  3ZOB A;  3HOY J;  1EF4 A;  3GBG A;  1WCM J;  2MG4 A;  3MN2 A;  4XIC A;  2WAQ N;  5F27 A;  3TW7 A;  1JKQ C;  2DN0 A;  1AKH B;  1JJ8 C;  1P7I A;  2EZH A;  3HB9 A;  1T33 A;  4V2G A;  1BW5 A;  3M3Y J;  1QRY A;  4MIM A;  2XSD C;  2HDD A;  3W6V A;  2EBI A;  3FK7 A;  3OSG A;  1XG1 A;  1FEX A;  2X6O A;  4B3A A;  2E2J J;  3M4O J;  1XC5 A;  4D7N A;  5JLW A;  1X2M A;  3GTJ J;  1NK2 P;  3S16 J;  4V2F A;  1ZTR A;  2LP0 A;  4MLO A;  2RAE A;  5IYD J;  2M9H A;  2Y2Z A;  2XGD A;  3HGY A;  1ENH A;  1IV6 A;  3C2B A;  3FIS A;  5DTD A;  2PMZ N;  2MW8 A;  2JMW A;  3BT9 A;  3BR1 A;  2LKX A;  2IAI A;  2JJ7 A;  4A3E J;  2EZK A;  4B1R A;  1WPK A;  1OJL A;  5FKK A;  3K7A J;  3GTP J;  2FD5 A;  4XID A;  2JK3 A;  1IG7 A;  3MVP A;  5M3F J;  4UUT A;  2R0Q C;  1AKH A;  1CQT A;  3Q0W A;  5EF6 A;  3LSR A;  1Z77 A;  2L0K A;  3S17 J;  1I6H J;  1JUP A;  1P7J A;  2ME0 A;  3ZQF A;  2JA7 J;  2Y9Y A;  3S14 J;  3BR5 A;  3GTO J;  2R5Y B;  1MH3 A;  1HDD C;  3S1N J;  1VND A;  1W0U A;  1IUF A;  2CRG A;  1YRN B;  1NK3 P;  2P81 A;  3HOZ J;  4QTR A;  2JN6 A;  1WGX A;  1BL0 A;  3CQZ J;  4M3F A;  3BR2 A;  5F1J A;  2LVS A;  2AO9 A;  2XGE A;  4QSH A;  1QVU A;  2LY9 A;  4X1E A;  4JX4 A;  3TP0 A;  1ZGW A;  5F0C A;  3FK6 A;  1LE8 B;  2NVQ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...