2K9SA

Solution structure of dna binding domain of e. coli arac
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
MDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DNA binding domain of AraC protein.
pubmed doi rcsb
molecule keywords Arabinose operon regulatory protein
molecule tags Transcription
source organism Escherichia coli
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2008-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2k9sA00
1CQTA 1WCMJ 2R0QC 2Y9YA 3BQYA 3I4NJ 2JJ7A 1FEXA 1D5YA 1TC3C 3FKIJ 4AYBN 4X1EA 3Q0VA 2OF7A 1DU6A 2PMZN 4MO7A 1P7IA 3GTPJ 1MH3A 2HDDA 1RKTA 3NAUA 1GV2A 2E2IJ 4Y7NJ 3TEDA 4A3LJ 5E3MA 3M4OJ 2KT0A 3LSJA 3BTCA 3GTKJ 1ETOA 1MH4A 1H89C 2DMQA 2WAQN 2M8GX 1OFCX 3HGYA 1QPIA 2P81A 1JJ6C 3S16J 2JA6J 1LFUP 5J1UA 3HM5A 2YUSA 2VPRA 1JJ8C 2COBA 3H0GJ 4M3GA 4MFEA 1Z0XA 2WB1N 4D5CA 4XRMA 2NVTJ 5HODA 4DZPA 1EF4A 3I4MJ 3OSGA 2K40A 1VNDA 2EQRA 1MBKA 3BTLA 1LFBA 3SDGA 3RZOJ 2HYJA 2JA8J 2FD5A 3OSFA 3IH3A 2M9HA 3IH4A 4W97A 3OIOA 5FKKA 4IHWA 2XGEA 5M5WJ 2O8KA 1ETWA 2XGCA 3PM1A 4QSHA 1MSFC 4FCYA 1SANA 1H8AC 3S2HJ 3JRFA 3S17J 4A3IJ 5K7HA 3JRDA 4A3FJ 3B6CA 1A6IA 3BG9A 3RQIA 5IP7J 3S1RJ 4UUTA 5M5YJ 1IC8A 1XG1A 3C2BA 2QCOA 2XB0X 2MG4A 1PUFA 3LSRA 3Q3SA 3LNQA 2DMNA 1HDPA 3JR9A 3GTJJ 4A3GJ 1E3OC 4L5EA 2K9QA 1MBHA 1W0TA 5IYBJ 2DN0A 2VUMJ 2HOSA 1NK3P 4A3DJ 1SFOJ 1GUUA 4XRSG 3GTGJ 1X58A 3VPRA 3JRGA 3JRBA 3JRAA 2JK3A 5FKLA 3CQZJ 1IGNA 3DCFA 2NOGA 1Q1VA 4CYCA 4UUSB 2EZLA 2DA5A 3LSPA 4AUXA 1S7EA 2ID3A 2CQQA 2O7OA 4X6AJ 3HOWJ 4AC0A 3WHCA 1ITYA 2VI6A 1DU0A 1IV6A 2CJJA 3ZQLA 3G1LA 3IV5A 1IG7A 1A5JA 2X48A 1MNMC 3Q0WA 3GTQJ 2HXOA 4XICA 3LOCA 3BR2A 2VKVA 2E2HJ 2GM4A 5FKMA 1AHDP 5FJ8J 3CCYA 4BY1J 4A3JJ 1T56A 2DMTA 2ID6A 5BNGA 2RAEA 2R5ZB 1K61A 1TWGJ 1JGGA 2YU9J 2GLOA 5F04A 4A69C 1WI3A 1GVDA 4IHVA 4IHYA 4G12A 5J3LA 2K9SA 3HB9A 5C4XJ 4JX4A 4QTRA 1MBFA 4JX6A 3FK7A 1POGA 1FIPA 2ME0A 2Y2ZA 1IRZA 3BG3A 3MVPA 3MKLA 1IDYA 4D7MA 3G1OA 3JRHA 2L7FP 3B6AA 2EBIA 2XRLA 1ETKA 3HOUJ 1F36A 4C3IJ 1JKQC 2H1KA 2M0CA 2LP0A 4J19A 3JREA 1Y1WJ 2MGQA 4DW6A 3GTMJ 4BY7J 3Q0UA 3HBLA 1FTZA 3HOVJ 2Y0SN 1TWFJ 2LVSA 4DYRA 5FLVA 2DA3A 2G0EA 4M6VA 2ME6A 2QF7A 5IYCJ 3PO3J 1HOMA 2DMPA 3L1PA 1FIAA 2YS9A 2L0KA 3HOYJ 5C4JJ 5FLMJ 2DA7A 2JMWA 1F43A 1ZKGA 3W6VA 1MBGA 2X6OA 2DMUA 5E3LA 1P7JA 1JTXA 3M3YJ 5C44J 2LR8A 2GBYA 3BTIA 3K7AJ 1B8IB 1BL0A 3GTLJ 4DYCA 1AU7A 2EH3A 2XPWA 1B72B 2DTZA 1Z77A 3S1QJ 1W0UA 4LOCA 3NARA 4RDUA 3BR1A 3A02A 3TW6A 4M3EA 5IP9J 4MIMA 2NVYJ 2XGDA 5GPCA 3A01B 2FX0A 1RR7A 4D7NA 2IAIA 1RKWA 1OJLA 3JRIA 2R93J 1JT6A 2LTPA 3BG5A 2I10A 1TWAJ 1ENHA 1IJWC 4UUSA 3HKZN 1NTCA 1VFCA 1HDDC 3DEWA 5K7ZA 2WV1A 5GP9A 1ZGWA 3ZQFA 2R92J 1IDZA 3S15J 2L7ZA 3RZDJ 3K2AA 3ZQCA 2TCTA 1APLC 3S14J 2DA6A 2M2EA 3TW7A 5EEAA 1OCTC 4NDLA 1T33A 2FQ4A 4FTHA 2LKXA 3ZQIA 2ECCA 9ANTA 4XIDA 4A3KJ 4I6ZA 1QRYA 3BR5A 2LK2A 2R7ZJ 3SFIA 1TWHJ 1U8BA 1RPWA 1WPKA 2JN6A 4V2GA 5F1JA 5M5XJ 2R5ZA 2XPVA 3QPLA 4XK4A 3QQAA 1WH5A 4A3EJ 3S2DJ 5M3FJ 1ETVA 4EEFG 2LY9A 1GT0C 1NK2P 2NVQJ 3S1NJ 1HF0A 3BQZA 1TWCJ 2LFBA 5JLWA 2LD5A 3IH2A 4FE7A 1ZTRA 4B1RA 5J1RA 2E2JJ 1HLVA 4MLOA 5F27A 3ZOBA 2OPTA 4M3FA 5DTDA 1UHSA 1RESA 4A3CJ 1AKHB 4A3BJ 5EGOB 5IP6A 1R9TJ 1JUPA 2EZHA 3ZQGA 5EF6A 1JKRC 3O8HA 1JUMA 1ZK8A 2XPUA 4JYKA 5F0FA 2HOTA 5EYRA 5F0CA 3RKQA 2X9DA 1U78A 2AHQA 4BXXJ 1HCRA 2L9RA 3OOUA 3QPSA 2HI3A 1VI0A 1I6HJ 1X2NA 1LE8B 4RBOA 2R5YB 3GTOJ 2JWTA 3LSGA 2NVXJ 1IUFA 4C2MJ 3SJMA 1YRNB 5EDNA 2DA4A 3PO2J 4A3MJ 2XB5A 3G1MA 2MSYA 3JRCA 1B8IA 2NS8A 5J1YA 1ZQ3P 1B72A 5IYDJ 2IBDA 1GDTA 1JTYA 5E3OA 2CU7A 4M3BA 5K7FA 1JUSA 3CMYA 2JA5J 3A01A 2Y9ZA 3HOXJ 2DA2A 4Y52J 3GBGA 5IOZA 1ZR2A 4JX5A 2IEKA 3CDLA 3D1NI 5EZGA 2B63J 1UG2A 5FKOA 2W48A 4W1UA 4C3HJ 4V2FA 2CUEA 4QIWN 4XRSA 5EG0A 1UMQA 2CRGA 4BBSJ 1FJLA 2VKEA 3TP0A 1XS9A 3BTJA 2KDZA 1JKOC 3TP3A 1ETYA 2H8RA 1BW5A 1BW6A 2JA7J 2M34A 2N8GA 1ETXA 2K9NA 4B4CA 1XC5A 1ORKA 1WGXA 1BA5A 4DYQA 2ZB9A 4HNVA 1BJZA 4A93J 3BR6A 4B3AA 2AO9A 3A03A 5FKNA 5EG0B 1I50J 1GV5A 2EZKA 2ECBA 3HOZJ 4M3DA 1MBEA 2MW8A 4C3JJ 3H3VK 3FISA 5E3NA 3HDDA 1FTTA 4FE4A 1ZR4A 1VF9A 3F0CA 3FIWA 1U9NA 4ABZA 4FISA 2LLKA 3BR3A 3ZQHA 5C3EJ 4BKXA 2CUFA 3S1MJ 5F0HA 2DA1A 2EZIA 4I76A 2E1OA 1MSEC 5IPAA 2Y30A 5M3MJ 4BBRJ 2HXIA 1ETQA 2XSDC 1AKHA 2O9LA 1O4XA 2FJ1A 1QVTA 1U9OA 3WHBA 5EGOA 4IEJA 1X2MA 2Y31A 3O8GA 5F08A 1Y1VJ 2NS7A 1PUFB 1I3QJ 1QVUA 2L7MP 4D5FA 1MBJA 3HGGA 5IOYA 5GPAA 4MFDA 2DJNA 2HOAA 5JLXA 3HEFA 3UKGA 3BT9A 1G2HA 1H88C 3FK6A 4GFBA 4DZJA 1LE8A 2R5YA 5DS9A 2TRTA 1K83J 4IHXA 4JP0A 1YRNA 2ELKA 4S0HB 2E19A 2CQXA 1RETA 4CYCB 1WH7A 3E7LA 1JKPC 1OCPA 5EZHA 1JT0A 2HQ5A 2D5VA 3MN2A 3BR0A
chains in the Genus database with same CATH superfamily
2Y9YA 5D4SA 3AG2H 4IJAA 1BIBA 4CHUA 3ISPA 1FEXA 3GLXA 2R7FA 2OU2A 2V9PA 3SEZA 4E7ZA 4AYBN 3GLLA 5J40A 1OQYA 1PP7U 5CVUA 4WXHA 5TISC 5L3DA 1FC3A 2CQ7A 3ZMZA 1MH3A 1SEUA 4OMZA 3E6CC 2GXAA 4HYEA 3ASNH 1LUJB 4ZYHA 1ON2A 3KLOA 3TEDA 3DLAA 5CQGA 3ZQ7A 2NNYA 2M8GX 2BY3A 1P6RA 1XD7A 2VE8A 2W7NA 1HQCA 1YJ9I 1SVOA 2YX4A 2IPQX 4YFNF 1LFUP 2R7QA 3MFKA 3L9FA 2YUSA 2VPRA 2XAFA 4WXCA 1TL8A 1VQKI 4GYGA 1I39A 4H4KC 2E1NA 2NVTJ 4N4OB 4RLFA 3RTRA 2QENA 3R61A 3E1SA 2K40A 3VYSB 1MBKA 2I5UA 3H35A 3S8PA 1SFXA 3AL0C 4XLCA 2K9MA 4E7IA 4BXFA 2OCCH 1UB9A 4HNUA 3K4NA 2JA8J 4GRIA 2M9HA 4ENNA 1RNLA 1U0JA 1Z3YA 1QZYA 1M1EB 4Q4ZF 3PM1A 2IGMA 5FRNA 1PYVA 4N4NB 3PFYA 1SAUA 4D0PA 1SANA 1A36A 4HQEA 4A3IJ 3EQLF 4RGXA 2FEZA 1AWCA 4A3FJ 3B6CA 1A6IA 4ZDPA 2R7TA 3CMMA 2F4IA 3BCBA 2XAHA 5M5YJ 4NQWB 1FSEA 3RCOA 4UNOA 4XLFA 3Q3SA 1OCZH 4RM2A 2DMNA 1QZZA 2BY0A 2XDVA 3LNQA 2L5QA 2OBPA 3DKYA 2VJIA 3VB2A 2R7VA 2BGCA 2GOXB 1GXPA 3T1BA 2W4SA 1YW9A 3HPHA 1D0YA 3LL7A 2OTLI 4MTDA 2L2OA 4I99C 4ESJA 2EFPA 3J80Z 4WWCA 1SC7A 4NUBA 4RB1A 1Z91A 3T8RA 5FKLA 4OIRF 3JAMK 5CQEA 3CJRB 2NOGA 1Q1VA 4GCVA 1R1UA 3GYHX 4I2OA 3LSPA 2O7OA 2CQQA 5E1WA 5GAGJ 4C9YA 4X6AJ 4H0EA 2DFEA 1DU0A 1IV6A 2BW3B 4ZZLA 3BPXA 3ZQLA 2GA1A 3ZN1A 4HF2A 2JPCA 1UAAA 5CVRA 1VQ5I 3JSPA 4AM3A 1H0MA 3IKVA 3GTQJ 4B43A 2VKVA 4OAYA 4F7ZA 2JQ7A 2ZXHA 1T8IA 5DV5A 4KICA 2OUMA 3OMYA 2D2WA 2KRCA 3N05A 4BQAA 2ZJPF 2XV4S 2BVLA 2L01A 3FXMA 2IS4A 1I1SA 2F4MB 3EUAA 2X1DA 4HSRA 5F04A 2GLOA 1MJBA 1WI3A 4IHYA 1K78A 1BOAA 1E17A 3KETA 2BHYA 2G9WA 1MBFA 2CO5A 4Q48A 3HOTA 2UZKA 2H27A 2VIXA 3FK7A 3HUGA 1FIPA 1IZ1A 2ME0A 2Y2ZA 2WY8Q 3OYMA 4O5VA 3TMOA 1UFMA 1I3AA 3G1OA 3QRFF 3JRHA 3B6AA 4UHTA 1WJDA 4OAZA 4XOTA 2EA2A 3L2RA 1MW7A 3QODA 4B8XA 1F36A 5F64A 5HLTA 4J19A 2DO7A 2LP0A 1FPQA 2VPLA 3F6VA 1G3YA 3DWLE 3JREA 2XASA 1VQMI 4DOZA 2BVMA 4BY7J 2M7AA 1IN8A 2WV0A 3HBLA 2LY1A 3Q0UA 5EEHA 4JBAA 5FLVA 4DYRA 1YOVB 1G3TA 4LK1F 2IT0A 1EJ9A 2KP6A 2QF7A 2DMPA 1REPC 1LNWA 1HA8A 1QU3A 3ZXSA 2RC4A 5J4VA 2WA0A 2YS9A 1FNNA 2E5ZA 3WG9A 3MCZA 1BI0A 3F21A 3GFMA 4HA8A 3DKXA 3HYIA 2QQ8A 2DMUA 3U21A 5DD4A 2ZSHB 1JTXA 4ZYDA 1W5SA 5C44J 3SXYA 3K7AJ 1BL0A 2ZMEC 3GTLJ 2EH3A 1MIJA 1Z77A 1YJNI 4CCOA 4LOCA 5D6FA 3N97A 3DF8A 2EILH 4I0AA 3BR1A 3A02A 3TW6A 5LEJA 3FWEA 4UUVA 5DDGA 2DODA 4B44A 2NVYJ 2XGDA 3A01B 2R7WA 2HTSA 3K1MA 2FX0A 2DK8A 3I64A 4PDKA 3QYFA 3JRIA 2UWMA 4XBFA 2R7UA 1TWAJ 3HRTA 1YTYA 3S3OA 3D5LA 3TO6A 4UUSA 4CSWA 4BDZA 3DEWA 4ZDLA 5K7ZA 4J00A 3OIPA 5GP9A 1ZGWA 5AIPA 1E0EA 5LGUA 2K02A 1WVRA 3K70C 1BI2A 3F6OA 4L5IA 4PGHA 2EIKH 4KDPA 3RJPA 2VOPA 3IC7A 2DA6A 2XAQA 2ZFUA 4BQQA 1OYYA 5GTIC 3VFZA 3D5SC 3QWLA 1U5TA 3WODF 1BOBA 3W3CA 5ICGA 1FT9A 4A3KJ 1UCRA 4I6ZA 3SDBA 2OTJI 1HXDA 2MA3A 2LK2A 3HL2A 1TWHJ 6PAXA 4RB3C 2JN6A 4RAZA 1SD4A 4XK4A 1E2XA 2BE5F 4YFKF 3S2DJ 1ETVA 3K4JA 3HG9A 1O7FA 3LSIA 1T95A 2VT2A 2DOFA 3ZRGA 1BN5A 2NVQJ 2W84A 3HXLA 1TWCJ 2LFBA 1XN7A 2HDCA 4XR6A 2E7WA 3LSTA 4M6XA 2H1LA 3T5XA 4EV0A 4B1RA 5J1RA 2E2JJ 1X1BA 4MGRA 3ZOBA 1ZGJA 1XTAA 1ZYRF 2OPTA 1DGWY 4HBLA 5GADJ 1RESA 1XX5A 2P7CB 4KYWA 3VWBA 3T0YA 2M4KA 4ZYAA 4YG2F 3J80K 4U7DA 2EZHA 5EF6A 3GZNB 3O8HA 1JUMA 4UVBA 4JYKA 2L3DA 4RS8A 4LLLA 2VBWA 4E6KG 2M30A 1Z1DA 3DBLB 3E6MA 2FU4A 3HHHA 3CF5F 4HAMA 3EUKL 1J9IA 5ICFA 2Z99A 5E1ZB 1UHWA 2UXXA 1X2NA 4RBOA 5HLIA 2QSHX 2X6WA 3GTOJ 2JWTA 4LG0A 4C2MJ 1IO2A 2R3SA 4EATA 3SJMA 3KP4A 1YIJI 1SFEA 1YRNB 3KEYA 2VQHA 4A3MJ 2DI3A 3AKZA 2EIJH 1YIOA 4RLQA 2BOLA 3LAJA 1B72A 1TZLA 1GDTA 1B4AA 1WI9A 4M3BA 3HJEA 5K7FA 1JUSA 2H09A 1Z21A 2IP2A 1J7KA 2Y9ZA 4M9ZA 5FROA 1KU3A 4E70A 2NRAC 2HZTA 4CCMA 2B9SA 1BC8C 4IRHA 4JX5A 1N25A 3CDLA 3D1NI 1MMSA 3IWFA 3JW4A 2B63J 5D5WB 3HZJA 2IS6A 5FD6A 2O61A 4XRSA 3QYBA 5EG0A 4G9YA 2QQAA 1MGTA 1UMQA 4U87A 4E4HA 1XS9A 3TP0A 2W1OA 4G7OF 2KDZA 4MHGA 1JKOC 5B1BH 3TP3A 2F4OB 3WU2C 4XL9A 3RDIA 2WWYA 2NXNB 2N8GA 3V7SA 2L9NA 3JSOA 2K9NA 2MH2A 4HLXA 3NQOA 1OCRH 3D5RC 2VBZA 1FMVA 1BA5A 2O03A 2ZB9A 4DYQA 2ISZA 5H20A 4BHCA 3R0AA 2A6HF 4B3AA 1R5GA 2WBMA 3HOZJ 3K1PA 1YYVA 1N78A 2M7BA 3FISA 5E3NA 2V9KA 2HU9A 3HDDA 2QSGX 1VF9A 3F0CA 1G8XA 3CDHA 2K86A 2OA4A 2DYSH 3FIWA 4MEYF 2PJPA 2EV5A 2M3AA 2WY7Q 4LD5A 2PFBA 1ZN2A 3H1CA 4FISA 2LLKA 2RREA 3QU3A 5F0HA 2EZIA 1Y6IA 2X1EA 3CCRI 3H9JA 2Y30A 3KX2A 1G3SA 2HXIA 3FXJA 2FBKA 1J2XA 4GXOA 2NOJB 3IRRA 1QVTA 3WHBA 5LGTA 1XMAA 4FT8A 4IEJA 5KHDA 3O8GA 2NS7A 1I3QJ 4D5FA 1X1CA 1RUOA 2LC2A 4ZZDA 2Y69H 2WAQA 5DCMA 2DJNA 1XPXA 2HOAA 4C2TA 3LQQA 3HEFA 4CCKA 2Y0SA 1LE8A 1RZ4A 3C7JA 3NRVA 5DS9A 5HNFA 2WB1A 2ELKA 4PJLA 2RN7A 2FUG2 4C2UA 4HV6A 1WH7A 2CUJA 2R7XA 3UR3C 2PMHA 4MNUA 2VL8A 4ITVA 2XC7A 3OS2A 1LEBA 2HQ5A 2DW4A 2CW7A 4P9FA 3PQKA 2HTJA 3L2VA 4XOPA 1ERDA 3MZHA 2K27A 1YITI 2QUFA 4OU0A 3I4NJ 1LEAA 2P7VB 2HGCA 2JJ7A 3RI4A 5KK1A 2DU9A 1D5YA 1TC3C 4D9JA 2EFWA 5CLSA 4LIUA 4X1EA 4N9HA 3DPUA 3Q0VA 1EH8A 4CCJA 5ILUA 4Q47A 2PMZN 2KMUA 4F52A 3I59A 1P7IA 4II3A 1VTNC 2VODA 3FF5A 5FO5A 3SQNA 4XKBA 1SVLA 4YIRX 2E2IJ 1OR7C 3KYDB 4Y7NJ 4A3LJ 3E3VA 3BTCA 1H89C 2LKPA 4QWQA 2V4JC 1OFCX 1K78B 3HGYA 2I8DA 1QPIA 1PVEA 1JJ6C 2HQAA 3LA3A 5B1AH 4ZC3A 3BLYA 1OCCH 5J1UA 5KAFC 3HM5A 2ZSIB 4P96A 4DQ2A 2IA2A 3Q9SA 3MZYA 4M3GA 4MFEA 1L3LA 1JJ8C 1OMIA 3WGHA 4XRMA 2VE9A 3GCMA 3O6BB 2XF5A 1IRGA 1EF4A 3I4MJ 3OSGA 2ACJA 1HC8A 2JUCA 4ASNA 3PUFA 3BTLA 4Z6YA 2MC4A 3DEUA 4HNTA 5HDKA 3REOA 2FD5A 1D0ZA 1V5GA 3IH4A 1XGMA 3C2GA 1ETWA 4QSHA 1HW2A 3V8KA 2D45A 3BC8A 4F3QA 3S2HJ 4OIQF 3F23A 3DPTA 1W7PB 4RMNA 1XDSA 2K7LA 4RAFA 2KIFA 4KMUX 3PIOF 2EFNA 2R7DA 3C2BA 1YFHA 1LPQA 1JGSA 2QCOA 2XB0X 4HX8A 3I56I 5BMZA 2DT7B 2PBIA 2QZ8A 3D0SA 5LRRA 3BJOA 2BXYA 1HDPA 1VZ0A 4BE1A 3JR9A 2L02A 2L54A 3IP4B 4I02A 3WE2A 5IT9Z 4QPOA 3PSFA 4G8XA 2K9QA 1W0TA 4RGUA 2VUMJ 1ZG5A 1SFOJ 1AA7A 2DPUA 2VXZA 3J7YJ 4YEJA 3QU6A 2JK3A 2DDAA 3L2CA 2V1XA 1O3TA 2OV7A 2MH9A 1P4WA 4UUSB 3J81Z 2DA5A 2M5WA 4AUXA 4DBRA 1S7EA 2ID3A 3MD2A 5CKTA 3BJAA 3NEUA 2LG4A 4PUSA 4NC8A 2KISA 1ITYA 1W5TA 2VI6A 2A69F 2ZJQF 5FFZA 5D5UB 1R4MB 1WHUA 1LKXA 2IGNA 2XF7A 3G6EI 1R5HA 3F8CA 5D5XB 4ZTFA 1U5TB 1S3JA 2JPBA 4KJZA 3MKWB 3K70D 2BV6A 4PSWA 1FWZA 2GM4A 2LYCA 4F55A 3CCYA 1AHDP 3DTEA 3LA7A 1T56A 1R00A 2DMTA 1EA3A 4CUGA 5BNGA 2IRFG 1K61A 2PQ8A 1TWGJ 5J47A 4XKCA 3S2WA 1JGGA 2YU9J 5ICEA 5JR3A 1MJ9A 1G4DA 4IHVA 1K6YA 2DDBA 1D0XA 5ILSA 2ADUA 4ENJA 4BGDA 2QBYA 5FGMA 4I7HA 5HDGA 4IQJA 4JX6A 1K7AA 1I1GA 1E3HA 1POGA 1IF1A 1IRZA 3MVPA 5AIQA 2P6SA 1SD6A 3MKLA 1IDYA 2HKOA 3QOEA 4A5NA 4UV8A 3HKZA 3SZTA 2ZXIA 2STTA 2QM3A 3L00A 4PSXA 1ETKA 4IL6C 3HSFA 2STWA 1YS7A 5HDNA 1OYWA 2M0CA 2GZWA 2F5FA 3R0JA 1PP8F 2DQRA 1WJEA 3MZ8A 4B48A 5HOOA 2Z33A 1FTZA 1TWFJ 1RUNA 2G0EA 3KLNA 4XQFA 5HLHA 3PO3J 1HOMA 2L9VA 4NHJA 4HSTA 2JZYA 5E18F 1XSXA 3WG7H 2FBIA 1FIAA 4BUPA 2L0KA 3CCVI 4UB8C 5C4JJ 4EJUA 3CO6C 4LG0B 2KJCA 1DGRM 4PFOA 5HLGA 2VOOA 3CCLI 2LSOA 3OV8A 2NS0A 3I5UA 1T39A 2GBYA 3WTZA 2QLZA 2VC0A 3FXLA 3O3KA 2EWNA 3TOAA 1T08B 1B72B 2DTZA 2Z5UA 2K85A 3CDIA 4XONA 5IP9J 1JI8A 4M6YA 4MIMA 5GPCA 3LWFA 2OD5A 5H6RA 2VBYA 4RB2C 2PI0A 4AIJA 1TBXA 4NB5A 2R93J 2PEXA 5IT3A 3H0DA 2LTPA 2V1UA 3FMQA 4A0ZA 2XAUA 1S72I 3PFIA 1R7JA 2KKOA 2P6TA 1BIAA 1NTCA 1FMWA 1HDDC 3ZQFA 2YX7A 4LLNA 2HQNA 4MQVA 3SZGA 1O3QA 1RIOH 2JVGA 3EUHA 2ZXWH 2AQEA 2H94A 5AONA 1YO5C 3M8EA 2M2EA 3SEQA 2E5NA 3TW7A 4IXAA 1ZH5A 1V4RA 1T33A 2LKXA 1W1WE 2PMUA 3W6KB 9ANTA 2GWRA 4XIDA 1U6GA 3KZYA 1KQ0A 2R7ZJ 1MMDA 3SFIA 3OYKA 3CCEI 4AYBA 1RPWA 4KIBA 2HOEA 3I3LA 1JHFA 3LSMA 2XUBA 2R5ZA 2M45A 3QPLA 4PZJA 3ABMH 4IZZA 2L4AA 2P5VA 3V7CA 2ZO4A 5M3FJ 2CGPA 2LY9A 5L3BA 2KIUA 2GOMA 4ZTJA 1LVKA 5D8LB 1IUYA 1HF0A 4OMYA 1XMXA 2A61A 3EETA 4MTEA 3PNYA 1R6RA 1I5ZA 1VQPI 2Y75A 3RPUA 4EJTA 4CGZA 1ZTRA 4XLHA 3DV8A 4QPQA 2VASA 1HLVA 2HNHA 4Y13A 4MLOA 4M3FA 1F4KA 1D3YA 3FMSA 5DTDA 1UHSA 2A05A 4ESFA 4A3BJ 3GMEA 3VSLA 4FETA 1GHCA 3M1CA 1D1CA 3ZQGA 1JKRC 1ODDA 5DM7F 3OS0A 2XKOA 4R1HA 2XPUA 5F0FA 4S05A 2Q1ZB 4LIVA 4KFCA 3G3ZA 5EYRA 5F0CA 3J81K 3GZ6A 3RKQA 1U78A 5DCMB 2AHQA 4BXXJ 4DJAA 1KQ8A 1KA8A 3ML6A 2L9RA 3OOUA 2XRNA 1IV8A 4IRIA 1G3WA 1VI0A 1LE8B 4G6DA 2A07F 3KYCB 3W2AA 3LSGA 4OIOF 4HDVA 1MNDA 3CC7I 4YRVA 5EDNA 3BCAA 2HYFA 2KJBA 1R1VA 4OWRB 2BY1A 1VQOI 1OLTA 5J1YA 1ZQ3P 3P7NA 5IYDJ 4L9VA 2ELJA 1IXCA 2GQQA 3FZVA 4CZZA 3N4MA 2F5DA 2NYXA 3T8TA 2CS3A 2H6CA 4CICA 2M4GA 3CMYA 5JVGF 2JA5J 3VOEA 1KQ9A 4KITB 3HOXJ 1B59A 2HPIA 5LBQA 4ENKA 3U1DA 2XSJC 1MKMA 2L4MA 1UJ8A 2MBFA 5EZGA 4MQ9F 2RDPA 2W48A 5K5QA 3I59B 4V2FA 4U0VA 1QNTA 2CRGA 4BBSJ 2YU3A 1FJLA 2VKEA 1IN6A 1TNSA 2XAGA 2VQGA 1KONA 1TQPA 1SMYF 2KIQA 3CTAA 1J5YA 1QPMA 4M9XA 2R7OA 1ETXA 3BP8A 1VQ8I 3CJTB 1KU2A 4BJ5C 1S7OA 5HS9A 1XC5A 1ORKA 3ULQB 4HNVA 1HSTA 1T0FA 2DBBA 3BDDA 2EA4A 4A93J 5FKNA 4L0YB 2IW5A 1XGOA 2VKDA 2BXZA 2MW8A 2BHZA 5B5EC 2CFXA 5D4RA 1SVMA 4FE4A 4DIQA 1ZR4A 2H6BA 2F5CA 3K2ZA 3KP2A 1UHMA 2DOAA 2OQRA 3CUQA 1U9NA 4ABZA 4CH7A 4XLAA 1QZEA 2P4WA 1QO0D 3R6SA 2QA4I 5J4YA 4AIHA 4Y15A 3HRUA 3KP7A 3IAM2 1HKTA 1QBJA 4I76A 3OR1C 4E7HA 4HV5A 2E1OA 2A5WA 3M8JA 4HLYA 5D5VB 3JCUC 1XCVA 5M3MJ 3CJNA 1ETQA 1AKHA 2FJ1A 1U9OA 2MD0A 3DBHB 1Z3XA 2XHKA 4XSZF 4RAGA 3OYJA 2Y31A 5LLQA 1Y1VJ 4RM3A 3GFLA 3HPGA 1MBJA 3KP6A 4UXNA 3LFUA 2CQKA 4A0XA 5CPRB 2VONA 2PX9A 5GPAA 3S93A 1KU7A 4BXUA 3CCSI 3KP3A 1RR8C 1RI7A 2CFOA 2UUZA 2LBFA 5E20A 1N77A 4GFBA 3FK6A 1WFXA 1W7PD 2R5YA 2FNPA 1STZA 3L09A 3CESA 3MWMA 3IL2A 2FF4A 4CCNA 4IHXA 1USTA 1S9HA 3IRQA 2OAZA 3CCJI 5E17F 1PDNC 4AWXB 2YPRA 4Y4RA 4RAYA 1JT0A 4EQQA 1QGPA 2MD5A 2FNAA 2JRMA 2VJ4A 3MKYB 4E7JA 3DXJF 3BR0A 3KFWX 3LFKA 3IUOA 3G4SI 1WCMJ 1CQTA 4EVIA 2QVOA 2ZBKA 4GO1A 2QQ9A 2W00A 5K5OA 1J09A 4M71A 1TT0A 3U9GA 3GXOA 2E71A 4CZCA 1V55H 1NG7A 2OF7A 3M7GA 5LFAA 2E36A 4MO7A 3W2VA 1VQ4I 3GTPJ 2HDDA 2BZTA 1RKTA 1Z6RA 3IAS2 1A6QA 2E7XA 4HPQA 4XMYA 2DPDA 4AD9A 2KT0A 4EM2A 4XLPF 3GTKJ 1ETOA 1MH4A 2DMQA 5L3EA 2WAQN 3C1DA 1NG6A 1PUEE 2CUZA 3BZ6A 2P81A 4KUMA 1ACIA 2QBYB 1LB2A 2RV8A 2JA6J 2WAFA 1BR4A 1ZRCA 3G2BA 3U2RA 2V26A 1SFKA 4FX4A 1TNTA 2O3FA 2V79A 3H0GJ 2LREA 1Z0XA 1IRXA 4O3MA 2IA0A 2WB1N 3FM5A 2HDWA 4D5CA 3A2KA 5L3FA 5HODA 4DZPA 3LAPA 2HYGD 1SFUA 5DYMA 4IOCF 1VNDA 2ZKZA 2CW8A 2EQRA 2ETHA 3U1KA 3CCMI 1ZG3A 1ZLKA 1T38A 2H8WA 4PGGA 1FYMA 1LDKB 2F5EA 3SDGA 5L3CA 3VDXA 2O5RA 3RZOJ 2R7SA 1H9GA 4W97A 2Z1DA 4G6QA 2XGEA 4NBQA 3QYEA 1P4AA 3ZCOA 4D1QA 3OYFA 3F22A 1MSFC 2F6CA 4OINF 5FFXA 3BG9A 5IP7J 3HRMA 1ON1A 1XB4A 4RGRA 2ZCWA 1PUFA 1K79A 2D1VA 2K5CA 3UNGC 3LSRA 1E3OC 2JSCA 3I53A 2LH9A 1OKRA 3I71A 4PCQA 3OYCA 3DU5A 3F72A 2KRFA 3OYAA 1NK3P 2HOSA 1BC7C 4A3DJ 1GUUA 2MLKA 1W36C 1X58A 2LY2A 3RQ4A 3VYTB 1Y0UA 3HTSB 2M8EA 3JRBA 1MMGA 2OZ6A 4ZH4F 5J8FA 2DAOA 3PSIA 1IGNA 1VQ9I 1Y0NA 3P9IA 1YS6A 1LDJA 1CF7A 2EZLA 3IHUA 3HOWJ 2CMPA 4A6DA 3RYPA 4C30A 1IN4A 5E8GA 2CV1A 1L0OC 1IXRC 5JHUA 3EDPA 5FD5A 2OCEA 1Z6TA 4NC7A 3IV5A 2O0YA 2VBXA 1A5JA 1V3FA 2X48A 3Q0WA 3H5RA 3C3WA 3QP6A 5B3SH 3EUHC 4N9IA 4ZYGA 1GXQA 2GAUA 3BR2A 3LOCA 2FBHA 2CYYA 4BAYA 2E2HJ 1W4MA 1ZELA 3CMEI 2QWWA 4F92B 2R7RA 1F1ZA 4BU2A 2ID6A 4M73A 2R5ZB 2RAEA 4N0BA 2GA2A 2WC2A 2IXSA 1WQ2A 3SYTA 1EH7A 3ROUA 1HW1A 3FM3A 1QQIA 1YW7A 1ZRFA 2B0LA 5IY5H 1DPRA 3WTYC 5J3LA 2K9SA 3HB9A 4GGGA 2NVUB 3E5QA 1MDMA 1BR2A 4QTRA 4FHTA 2LOOA 1JHHA 3IWZA 4BNCA 3K9TA 4IVNA 3BG3A 3CP2A 4D7MA 3M07A 2HQRA 1O3RA 2DFHA 2L7FP 3LMMA 4DBQA 1MMNA 4AVPA 5DCFA 3HOUJ 2ZMEA 5HS7A 4HW0A 2GIZA 3ZMTA 2EB7A 2CW0F 3VSKA 2X85A 1Y8RB 3FXKA 3WE3A 4JK1X 3FDYA 2KHMA 3E6BA 4DW6A 3GTMJ 2DT6A 3C18A 4LFUA 3ONQA 1WZ2A 3HOVJ 2ZNYA 2DA3A 3HUGB 5KCMA 4M6VA 4WXDA 1SAXA 4I09A 1MJAA 2XAJA 3KZZA 3VYUB 5J6XA 3WTTC 3ELKA 4ETSA 4DNCA 3L2WA 2A5YB 3GO5A 3M1EA 2ESNA 3HOYJ 1HW5A 3DFGA 4B09A 3V7RA 2JMWA 3DQVC 1F43A 2BY2A 2PJRA 3W6VA 1MBGA 4AIDA 2KRHA 2X6OA 3GW2A 3KE2A 1P7JA 3ZMUA 2LR8A 3BTIA 4PK4A 3ERMA 4DYCA 1AU7A 1V5FA 4AVZA 5TRDA 3HRSA 3S1QJ 1MZBA 4PFPA 4LITA 3NARA 2M1BA 3F8NA 5LD2C 1UELB 4KN4X 2PG4A 1Y56A 2A6TA 2RNGA 1RR7A 4AIKA 4Y17A 2ICWG 2LMDA 1RKWA 4KT6A 1JT6A 2I10A 5ERIA 1T2KA 1IJWC 3HKZN 1VFCA 4E7KA 4LLGF 2WV1A 1XDUA 2BEOA 4OIPF 2DT5A 5H6QA 4A5MA 1J59A 1WJBA 2R92J 3M9AA 1HBXG 3W6JB 3S15J 3E5XA 3RSNA 3CO7C 3GFJA 2IA1A 3DBRB 4J01A 5CVJA 4BJTA 5CVIA 2G7UA 1O7LA 3BR5A 3PUBA 4EJWA 4L18B 3OOPA 3H36A 4LB5A 2FQ3A 3MEXA 1NH3A 2YSRA 3A4CA 2V7FA 4V2GA 3ZPLA 5M5XJ 2LRDA 5H2FC 2XPVA 3BZKA 2C6YA 1P92A 3QQAA 1WH5A 1FOXA 3AG3H 2PMZA 2Q2EA 4CO8A 4A3EJ 4EEFG 1T0FC 4KIFA 2G7HA 1GT0C 1NK2P 3TBIA 2EINH 4HG2A 3S1NJ 3J7ZI 3OYBA 4KT5C 4F93B 3CUQB 3R60A 1RRJA 2RVCA 2LD5A 4FE7A 4R8HA 3ZP5A 4NNJA 1FX7A 3BY6A 3CUQC 3FBNB 4B47A 1U5TC 4HDUA 4K2EA 1XGNA 1F9NA 5LGNA 1WJFA 1V54H 4A3CJ 1IXSB 1AKHB 4P9UA 1HKSA 3WGGA 2FMLA 1BJAA 1R9TJ 1JUPA 2FRHA 1GVJA 3PIPF 3KZIC 3K10A 4M72A 2M0MA 2XF6A 3E0JB 1DP7P 3HC7A 2IGKA 1JXSA 3CCQI 4WF2A 3B02A 3CJQB 1MNEA 3DU6A 1HCRA 2W85A 2X6XA 4BEHA 3FHZA 2LBFB 1YLFA 5HS8A 1ZG1A 1G6NA 3ZMSA 2PLYA 2R5YB 3ERED 2QGUA 3I54A 1IUFA 5A2QZ 3GF2A 3FKJA 2KQRA 1DUXC 2QQBA 2PN6A 2LF8A 4BHPA 4L9TA 3VODA 2HPMA 3PO2J 3ABLH 2DK5A 2MSYA 3JRCA 2V9VA 1B8IA 4IHSA 3FX3A 2GXGA 1XMKA 3W2WA 1YW8A 2E35A 1TP4A 5E3OA 4EGZA 2FE3A 5DD8A 3SFZA 4RGSA 1BI3A 3I55I 2P5KA 1G59A 3JTHA 4U0YA 4XSXF 2QKMB 4BQNA 2RKHA 4JOMA 2Z2SB 3DTIA 2MC3A 2DA2A 2A68F 4Y52J 2UXNA 3GBGA 5IOZA 1ZR2A 1PJRA 4PJJA 2BBYA 1Q1HA 3BG7A 2KIMA 3ZQQA 3RKXA 3TQNA 5FKOA 3G73A 1R4NB 1TQIA 3GZ5A 1KYWA 2BYVE 1IN5A 1P4XA 2DFFA 4W1UA 4C3HJ 4QIWN 4KA4A 4E7LA 3PNVA 1ZHFA 3AL0B 3GEZA 3AAFA 2ISYA 3BTJA 3RKYA 5BOXA 2EK5A 1BW5A 3OL3A 2JA7J 2M34A 1FLIA 1ZLJA 5CJ9A 2B7EA 2GXBA 3WGIA 2K4JA 3PQJA 2EIMH 2LF7A 2CG4A 4L5JA 3M8FA 1ZARA 2CSOA 1WGXA 1D1AA 2JA2A 1WRJA 2AO9A 5EG0B 3PL8A 4G7ZF 2EZKA 2ECBA 1WJCA 4LMYA 1VQ7I 4M3DA 1MBEA 2VQCA 1FSHA 3DTKA 2DYRH 1QHHD 2F5VA 2KDOA 3QP5A 1FTTA 5D6EA 3OYNA 5JVTA 3CD6I 4BL0B 3OYHA 2VN2A 1S7AA 3I9V2 2EJRA 4PJNA 2VC1A 3BR3A 3KEOA 1I27A 1YX5A 3ASOH 3ZQHA 3B73A 5C3EJ 4F91B 3S1MJ 4FX0A 1KZHA 3J7AY 2V6CA 4UVCA 5EJCA 2MYSA 5GTHC 3AFHA 3KCCA 3MMYB 2EV6A 1MSEC 5IPAA 4BBRJ 3J7AO 2XVCA 1S5LC 4P5OA 5GAEJ 2DLLA 2FOKA 5EGOA 1X2MA 2VB6A 3C2HA 1ZGAA 3SHFA 3WU0A 3H3ZA 2AXTC 3I58A 4IOAF 2D1HA 1PUFB 1QVUA 2DQLA 2L7MP 4HX4A 4LG3A 3V4GA 1ZRDA 3HGGA 1X1DA 2CQNA 1A35A 1Z05A 4MFDA 4YELA 5IT9K 1R49A 2JTVA 5JLXA 3UKGA 3KPHA 4ZJZA 1MD0A 2EV0A 3BT9A 3I0TA 1G2HA 5FB2A 4HQMA 4Z2YA 1F5TA 5FRMA 4BYYA 4DZJA 3K4BA 3KYLA 3K69A 4BHBA 4HX7A 4JP0A 1LJ9A 4U0WA 1XSDA 1X19A 2E34A 2R4GA 4XN0A 5TJJA 3VYRB 3DKWA 4Q5SF 2DTRA 4II2A 2K3PA 3K4MA 1O3SA 2CQXA 1RETA 1CF7B 3E7LA 1OR7A 1OCPA 2Y0MA 3CLOA 1W36D 2XIGA 2A3SA 2JRTA 5ICCA 3Q5FA 1X1AA 2D5VA 3MN2A 3TO9A 3JTGA 2FMYA 2R0QC 3BQYA 2FA5A 3TDUC 3E6DA 5L3GA 4V19K 2IJLA 3WTSC 3FKIJ 3FXQA 2HKXA 4HZFA 1UG0A 2ZNZA 1BBYA 1H9TA 4ZDOA 3WTUC 1DU6A 2QKLB 1R23A 4UV9A 4CXFA 3EYIA 1ONVA 2HVSA 5LRSA 4KN7X 2F48A 3A0HC 3AG1H 4IF4A 1TQMA 3NAUA 5F6FA 4S04A 3CUOA 1GV2A 5E3MA 1X4PA 3M4OJ 3LSJA 2WTEA 1E3PA 4A2UA 2M87A 2HVQA 4IRGA 1MDMB 2ZFWA 2F2EA 3K6GA 3S16J 3GWZA 3FXUA 3FBIB 4L9NA 3F8FA 4PJ0C 2COBA 4XN3A 3PJRA 1CGPA 2XKPA 2VT3A 2ZJ2A 1W7PA 4A12A 3CC4I 3LQRA 4P1WA 1TW3A 2ZMEB 1FBUA 1TLHB 1VQLI 4KMFA 5A2QK 2FSWA 4I98B 3WTVC 1LFBA 2K3FA 2MLGA 3A0BC 2HYJA 3OSFA 3IH3A 2E1MB 5FKKA 3OIOA 3RPUD 3P5JA 3S3NA 1YE9A 1IN7A 2JT1A 4IHWA 5M5WJ 3CLQA 1B6AA 2XGCA 3Q9VA 2O8KA 2OC6A 1XSVA 1YI2I 1R71A 1K6OA 4FCYA 2RQPA 1H8AC 4XKWA 3JRFA 2E1MC 3S17J 5K7HA 2KL4A 3JRDA 2W57A 2ESHA 3CZ6A 3RQIA 3S1RJ 4UUTA 4BACA 5EEGA 1U3EM 1S29A 1IC8A 1XG1A 2PJRB 3DEEA 4EM1A 2MG4A 2VKHA 1X1PA 5GAHJ 3BROA 3H5AA 1D5VA 3DLLF 3QAHA 3GTJJ 4A3GJ 1WJ5A 5ED4A 4L5EA 2X51A 1MBHA 2X4HA 2ZXJA 2HR3A 2DFIA 1Z67A 5IYBJ 1HKQA 2DN0A 1Z9CA 4XRSG 1B9NA 5E79C 1IRFA 4GYIA 3GTGJ 3K4CA 3VPRA 3JRGA 2DXIA 3F9KA 3JRAA 2YR2A 4YFXF 3H3UA 4IPAA 1LFPA 3CQZJ 1LDDA 3DCFA 2X0LA 3HSRA 4CYCA 1S6LA 2W25A 2CV2A 2ELHA 3BWGA 3HSEA 1R1TA 4AC0A 1FZPB 4XLEA 3WHCA 5DUKA 2VLAA 5LHHA 1QA6A 1Z7UA 3E5UA 1KYZA 2CJJA 3F8BA 3ABUA 1C0WA 4ESBA 2Q8KA 3G1LA 4BE2A 1BM9A 3RPQA 1IG7A 2P8TA 2P5LC 1MNMC 2IS2A 4UY8I 3PNTA 1SD5A 2EFOA 2E1CA 2HXOA 4XICA 5LEKA 3A1YA 3OR2C 5DM6F 3FMRA 3LSHA 5FKMA 5FJ8J 4BY1J 4HRIA 4NC6A 2V1NA 5DUIA 4O6JA 4XRFA 4A3JJ 1FBSA 1T6SA 4L0ZB 3KP5A 4EMSA 3QPTA 1WKMA 3MQ0A 3F3XA 1HSJA 2Q2EB 1DPUA 4A69C 1GVDA 3OYGA 1O57A 1ZREA 1I6XA 4G12A 1D8KA 1VQ6I 5C4XJ 2VJ5A 4JX4A 1DQUA 1YQAA 2E60A 3BPVA 3KIOA 3HOSA 2L9SA 1MMAA 2O6GE 2IVMA 2IS1A 4EJVA 1J75A 4A0YA 1IAWA 1S8NA 2VJJA 2EFQA 3BJ6A 3L7WA 1N75A 1R36A 2EBIA 1EV7A 2XRLA 5KNLA 1BR1A 2KPMA 4C3IJ 4HEA2 1JKQC 4BH9A 2H1KA 2ZC2A 2RQQA 4G6TB 2JVHA 5FLXZ 2MGQA 1Y1WJ 3FHNA 4I01A 2Y0SN 3NWSA 2LVSA 1YG2A 2WADA 1BI1A 1FBQA 2KFDA 2ME6A 3O2PE 4BS9A 5IYCJ 1B9MA 1VQNI 1Y8QB 4LK0F 3L1PA 2DCEA 2QEXI 4BEHB 3IKTA 2W24A 2MFZA 2WAEA 2JUGA 3HTUA 3OL4A 4XNFA 2KZVA 4BJ6C 2J5PA 2XROA 2Z3YA 4CYDA 5FLMJ 2DA7A 1R58A 1ZKGA 2AQFA 4NQWA 4U88A 5E1XA 5E3LA 2IGOA 1LVAA 4RB0A 3M3YJ 3MAJA 1B8IB 3TL4X 3GX4X 3HHGA 2XPWA 1OCOH 4PJMA 1W0UA 5BPIA 4GDFA 4RDUA 1U8RA 4M3EA 5LHGA 5ILVA 1YJWI 1IW7F 4BDYA 4KIGA 3CMAI 1X4OA 4D7NA 2IAIA 1OJLA 3ECOA 3H9GA 5E8IA 4XORA 3BG5A 3VEPA 3G71I 5CVVA 1KGSA 3OYDA 1ENHA 1AOYA 1WSUA 1TTYA 3ABKH 2RNJA 3H5NA 3QOPA 4EJOA 2Y48A 3KEQA 3NWTA 2JSPA 2HZDA 3K4LA 1EH6A 4FASD 5BQTA 1OYIA 5HNHA 3L2UA 1IDZA 2L7ZA 4RA2A 4QLCU 2Z9OA 2BW3A 2QSFX 3RZDJ 3K2AA 3ZQCA 2TCTA 3AG4H 2EPFA 1APLC 2FOWA 4G94A 3S14J 2XGXA 5EEAA 1OCTC 4NDLA 3TKYA 2CWEA 1UZCA 4M9SA 2J5OA 3WTWC 3ZMVA 2X1CA 2FQ4A 4FTHA 2HEOA 4IKFA 3QPHA 3ZQIA 2ECCA 2LKSA 1QRYA 3GFIA 2LDUA 3BOQA 1U8BA 2HVRA 1WPKA 1DDNA 5F1JA 1FOWA 4ENMA 3WTXC 4XLNF 1V5EA 2X6YA 2VXDA 4UB6C 4HOBA 4TV7A 5BPDA 3BQZA 1KU9A 1FYLA 2GIVA 5JLWA 2KZGA 3IH2A 1USSA 5HVQC 2KLOA 3F8MA 3MKZA 3DPLC 5F27A 4HF1A 4UVAA 3RKWA 2OZUA 1XCBA 2Q0OA 5D8KB 4IO9F 4LB6B 1JE8A 2NNNA 4Y33A 5EGOB 4AU7A 5IP6A 3GVAA 3OYEA 1EKEA 2ZJRF 4CCLA 1FP2A 2P0WA 1ZK8A 3FXRA 4E7SA 3OY9A 1LQ1A 2COMA 2LNBA 3TGNA 2HOTA 3V42A 5TGTA 2X9DA 1D1BA 4G7HF 2DOEA 2HFHA 3ABTA 4EM0B 1FYKA 3GUDA 3QPSA 2HI3A 4BQOA 1I6HJ 2DJIA 1FP1D 1FY7A 4YIIA 4IX7A 1QHGA 2AS5F 2NVXJ 1WWXA 5K5RA 3OYLA 1W5CC 4WX9A 3OYIA 2QYOA 3TOBA 2DA4A 3BG6A 1ULYA 1Y39A 2XB5A 3G1MA 3LA2A 2NS8A 4LGWA 1NHAA 4M74A 2IBDA 4IQ4A 4I0BA 3S3MA 1JTYA 1A04A 2Z16A 3FXOA 2CU7A 1U2WA 3R4KA 1R5ID 4KNYA 1X3UA 3A01A 4B3XA 3RIRA 4OOIA 1B1BA 3I4PA 3HIFA 3EPZA 3SZPA 3L2QA 4CDGA 5B66C 2V6EA 3CP8A 4EGYA 2IEKA 2CH0A 4ANJA 4ON0A 1UG2A 1OPCA 1SD7A 2HS5A 3ZR8X 1DP3A 5LHIA 2CUEA 1TW2A 1P2FA 2O8XA 3ESWB 1GLNA 3CF2A 1D8JA 5KAIC 1ETYA 2H8RA 1BW6A 1SMTA 5F1RA 4HF0A 3JAMZ 5FLXK 1FOYA 1K4TA 4P55A 4B4CA 3S32A 5JFRA 3K4KA 3ZGKA 3DP7A 3RYRA 4KISA 1BJZA 2MABA 3BR6A 3A03A 4A6EA 4CA0A 1I50J 1WJAA 1GV5A 3OWTA 3WU1B 4IHTA 1J0RA 4C3JJ 3H3VK 1YHQI 3E97A 4L9JA 4LJZF 1XGSA 4JQFA 4WK8F 1YX3A 1T98A 3P9KA 5JI6A 4DGWB 2HWVA 2UV1A 3EYYA 3V8LA 3ECHA 1OISA 2OQGA 1TT5B 5CYVA 5K1YA 3CCUI 4BKXA 5DEQA 2CUFA 2AXLA 4MEXF 2DA1A 1P9QC 2L7KA 3K1NA 4XKVA 5BS6A 2XSDC 2O9LA 3H9QA 1O4XA 1RC9A 2CV0A 2RGVA 2W82A 2A6EF 4Y3OA 5F08A 3H92A 1Z7LA 2NAZA 2OJED 5IOYA 4YIFA 2K4BA 1ZAOA 4X0GA 3TDZC 2K9LA 3K0LA 2V1DA 2TDXA 5JHFA 4ZYEA 1H88C 3ZN0A 2TRTA 3P9CA 1K83J 4BE0A 3BZCA 3V8JA 1YRNA 5KVRA 4S0HB 2E19A 4FQGA 3COAC 3LSKA 3OS1A 4R79A 3CC2I 4CYCB 2FXAA 4XM3A 1JKPC 1X3WB 2VQLA 5J8CA 3X2QH 4U7BA 5EZHA 1A31A 4WCGA 1X3ZB 1R22A 3ZMDA 3TO7A 1FOKA 1K4SA 3OIQA
chains in the Genus database with same CATH topology
1CQTA 1WCMJ 2R0QC 2Y9YA 3BQYA 3I4NJ 2JJ7A 1FEXA 1D5YA 1TC3C 3FKIJ 4AYBN 4X1EA 3Q0VA 2OF7A 1DU6A 2PMZN 4MO7A 1P7IA 3GTPJ 1MH3A 2HDDA 1RKTA 3NAUA 1GV2A 2E2IJ 4Y7NJ 3TEDA 4A3LJ 5E3MA 3M4OJ 2KT0A 3LSJA 3BTCA 3GTKJ 1ETOA 1MH4A 1H89C 2DMQA 2WAQN 2M8GX 1OFCX 3HGYA 1QPIA 2P81A 1JJ6C 3S16J 2JA6J 1LFUP 5J1UA 3HM5A 2YUSA 2VPRA 1JJ8C 2COBA 3H0GJ 4M3GA 4MFEA 1Z0XA 2WB1N 4D5CA 4XRMA 2NVTJ 5HODA 4DZPA 1EF4A 3I4MJ 3OSGA 2K40A 1VNDA 2EQRA 1MBKA 3BTLA 1LFBA 3SDGA 3RZOJ 2HYJA 2JA8J 2FD5A 3OSFA 3IH3A 2M9HA 3IH4A 4W97A 3OIOA 5FKKA 4IHWA 2XGEA 5M5WJ 2O8KA 1ETWA 2XGCA 3PM1A 4QSHA 1MSFC 4FCYA 1SANA 1H8AC 3S2HJ 3JRFA 3S17J 4A3IJ 5K7HA 3JRDA 4A3FJ 3B6CA 1A6IA 3BG9A 3RQIA 5IP7J 3S1RJ 4UUTA 5M5YJ 1IC8A 1XG1A 3C2BA 2QCOA 2XB0X 2MG4A 1PUFA 3LSRA 3Q3SA 3LNQA 2DMNA 1HDPA 3JR9A 3GTJJ 4A3GJ 1E3OC 4L5EA 2K9QA 1MBHA 1W0TA 5IYBJ 2DN0A 2VUMJ 2HOSA 1NK3P 4A3DJ 1SFOJ 1GUUA 4XRSG 3GTGJ 1X58A 3VPRA 3JRGA 3JRBA 3JRAA 2JK3A 5FKLA 3CQZJ 1IGNA 3DCFA 2NOGA 1Q1VA 4CYCA 4UUSB 2EZLA 2DA5A 3LSPA 4AUXA 1S7EA 2ID3A 2CQQA 2O7OA 4X6AJ 3HOWJ 4AC0A 3WHCA 1ITYA 2VI6A 1DU0A 1IV6A 2CJJA 3ZQLA 3G1LA 3IV5A 1IG7A 1A5JA 2X48A 1MNMC 3Q0WA 3GTQJ 2HXOA 4XICA 3LOCA 3BR2A 2VKVA 2E2HJ 2GM4A 5FKMA 1AHDP 5FJ8J 3CCYA 4BY1J 4A3JJ 1T56A 2DMTA 2ID6A 5BNGA 2RAEA 2R5ZB 1K61A 1TWGJ 1JGGA 2YU9J 2GLOA 5F04A 4A69C 1WI3A 1GVDA 4IHVA 4IHYA 4G12A 5J3LA 2K9SA 3HB9A 5C4XJ 4JX4A 4QTRA 1MBFA 4JX6A 3FK7A 1POGA 1FIPA 2ME0A 2Y2ZA 1IRZA 3BG3A 3MVPA 3MKLA 1IDYA 4D7MA 3G1OA 3JRHA 2L7FP 3B6AA 2EBIA 2XRLA 1ETKA 3HOUJ 1F36A 4C3IJ 1JKQC 2H1KA 2M0CA 2LP0A 4J19A 3JREA 1Y1WJ 2MGQA 4DW6A 3GTMJ 4BY7J 3Q0UA 3HBLA 1FTZA 3HOVJ 2Y0SN 1TWFJ 2LVSA 4DYRA 5FLVA 2DA3A 2G0EA 4M6VA 2ME6A 2QF7A 5IYCJ 3PO3J 1HOMA 2DMPA 3L1PA 1FIAA 2YS9A 2L0KA 3HOYJ 5C4JJ 5FLMJ 2DA7A 2JMWA 1F43A 1ZKGA 3W6VA 1MBGA 2X6OA 2DMUA 5E3LA 1P7JA 1JTXA 3M3YJ 5C44J 2LR8A 2GBYA 3BTIA 3K7AJ 1B8IB 1BL0A 3GTLJ 4DYCA 1AU7A 2EH3A 2XPWA 1B72B 2DTZA 1Z77A 3S1QJ 1W0UA 4LOCA 3NARA 4RDUA 3BR1A 3A02A 3TW6A 4M3EA 5IP9J 4MIMA 2NVYJ 2XGDA 5GPCA 3A01B 2FX0A 1RR7A 4D7NA 2IAIA 1RKWA 1OJLA 3JRIA 2R93J 1JT6A 2LTPA 3BG5A 2I10A 1TWAJ 1ENHA 1IJWC 4UUSA 3HKZN 1NTCA 1VFCA 1HDDC 3DEWA 5K7ZA 2WV1A 5GP9A 1ZGWA 3ZQFA 2R92J 1IDZA 3S15J 2L7ZA 3RZDJ 3K2AA 3ZQCA 2TCTA 1APLC 3S14J 2DA6A 2M2EA 3TW7A 5EEAA 1OCTC 4NDLA 1T33A 2FQ4A 4FTHA 2LKXA 3ZQIA 2ECCA 9ANTA 4XIDA 4A3KJ 4I6ZA 1QRYA 3BR5A 2LK2A 2R7ZJ 3SFIA 1TWHJ 1U8BA 1RPWA 1WPKA 2JN6A 4V2GA 5F1JA 5M5XJ 2R5ZA 2XPVA 3QPLA 4XK4A 3QQAA 1WH5A 4A3EJ 3S2DJ 5M3FJ 1ETVA 4EEFG 2LY9A 1GT0C 1NK2P 2NVQJ 3S1NJ 1HF0A 3BQZA 1TWCJ 2LFBA 5JLWA 2LD5A 3IH2A 4FE7A 1ZTRA 4B1RA 5J1RA 2E2JJ 1HLVA 4MLOA 5F27A 3ZOBA 2OPTA 4M3FA 5DTDA 1UHSA 1RESA 4A3CJ 1AKHB 4A3BJ 5EGOB 5IP6A 1R9TJ 1JUPA 2EZHA 3ZQGA 5EF6A 1JKRC 3O8HA 1JUMA 1ZK8A 2XPUA 4JYKA 5F0FA 2HOTA 5EYRA 5F0CA 3RKQA 2X9DA 1U78A 2AHQA 4BXXJ 1HCRA 2L9RA 3OOUA 3QPSA 2HI3A 1VI0A 1I6HJ 1X2NA 1LE8B 4RBOA 2R5YB 3GTOJ 2JWTA 3LSGA 2NVXJ 1IUFA 4C2MJ 3SJMA 1YRNB 5EDNA 2DA4A 3PO2J 4A3MJ 2XB5A 3G1MA 2MSYA 3JRCA 1B8IA 2NS8A 5J1YA 1ZQ3P 1B72A 5IYDJ 2IBDA 1GDTA 1JTYA 5E3OA 2CU7A 4M3BA 5K7FA 1JUSA 3CMYA 2JA5J 3A01A 2Y9ZA 3HOXJ 2DA2A 4Y52J 3GBGA 5IOZA 1ZR2A 4JX5A 2IEKA 3CDLA 3D1NI 5EZGA 2B63J 1UG2A 5FKOA 2W48A 4W1UA 4C3HJ 4V2FA 2CUEA 4QIWN 4XRSA 5EG0A 1UMQA 2CRGA 4BBSJ 1FJLA 2VKEA 3TP0A 1XS9A 3BTJA 2KDZA 1JKOC 3TP3A 1ETYA 2H8RA 1BW5A 1BW6A 2JA7J 2M34A 2N8GA 1ETXA 2K9NA 4B4CA 1XC5A 1ORKA 1WGXA 1BA5A 4DYQA 2ZB9A 4HNVA 1BJZA 4A93J 3BR6A 4B3AA 2AO9A 3A03A 5FKNA 5EG0B 1I50J 1GV5A 2EZKA 2ECBA 3HOZJ 4M3DA 1MBEA 2MW8A 4C3JJ 3H3VK 3FISA 5E3NA 3HDDA 1FTTA 4FE4A 1ZR4A 1VF9A 3F0CA 3FIWA 1U9NA 4ABZA 4FISA 2LLKA 3BR3A 3ZQHA 5C3EJ 4BKXA 2CUFA 3S1MJ 5F0HA 2DA1A 2EZIA 4I76A 2E1OA 1MSEC 5IPAA 2Y30A 5M3MJ 4BBRJ 2HXIA 1ETQA 2XSDC 1AKHA 2O9LA 1O4XA 2FJ1A 1QVTA 1U9OA 3WHBA 5EGOA 4IEJA 1X2MA 2Y31A 3O8GA 5F08A 1Y1VJ 2NS7A 1PUFB 1I3QJ 1QVUA 2L7MP 4D5FA 1MBJA 3HGGA 5IOYA 5GPAA 4MFDA 2DJNA 2HOAA 5JLXA 3HEFA 3UKGA 3BT9A 1G2HA 1H88C 3FK6A 4GFBA 4DZJA 1LE8A 2R5YA 5DS9A 2TRTA 1K83J 4IHXA 4JP0A 1YRNA 2ELKA 4S0HB 2E19A 2CQXA 1RETA 4CYCB 1WH7A 3E7LA 1JKPC 1OCPA 5EZHA 1JT0A 2HQ5A 2D5VA 3MN2A 3BR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQT A;  1WCM J;  2R0Q C;  2Y9Y A;  3BQY A;  3I4N J;  2JJ7 A;  1FEX A;  1D5Y A;  1TC3 C;  3FKI J;  4AYB N;  4X1E A;  3Q0V A;  2OF7 A;  1DU6 A;  2PMZ N;  4MO7 A;  1P7I A;  3GTP J;  1MH3 A;  2HDD A;  1RKT A;  3NAU A;  1GV2 A;  2E2I J;  4Y7N J;  3TED A;  4A3L J;  5E3M A;  3M4O J;  2KT0 A;  3LSJ A;  3BTC A;  3GTK J;  1ETO A;  1MH4 A;  1H89 C;  2DMQ A;  2WAQ N;  2M8G X;  1OFC X;  3HGY A;  1QPI A;  2P81 A;  1JJ6 C;  3S16 J;  2JA6 J;  1LFU P;  5J1U A;  3HM5 A;  2YUS A;  2VPR A;  1JJ8 C;  2COB A;  3H0G J;  4M3G A;  4MFE A;  1Z0X A;  2WB1 N;  4D5C A;  4XRM A;  2NVT J;  5HOD A;  4DZP A;  1EF4 A;  3I4M J;  3OSG A;  2K40 A;  1VND A;  2EQR A;  1MBK A;  3BTL A;  1LFB A;  3SDG A;  3RZO J;  2HYJ A;  2JA8 J;  2FD5 A;  3OSF A;  3IH3 A;  2M9H A;  3IH4 A;  4W97 A;  3OIO A;  5FKK A;  4IHW A;  2XGE A;  5M5W J;  2O8K A;  1ETW A;  2XGC A;  3PM1 A;  4QSH A;  1MSF C;  4FCY A;  1SAN A;  1H8A C;  3S2H J;  3JRF A;  3S17 J;  4A3I J;  5K7H A;  3JRD A;  4A3F J;  3B6C A;  1A6I A;  3BG9 A;  3RQI A;  5IP7 J;  3S1R J;  4UUT A;  5M5Y J;  1IC8 A;  1XG1 A;  3C2B A;  2QCO A;  2XB0 X;  2MG4 A;  1PUF A;  3LSR A;  3Q3S A;  3LNQ A;  2DMN A;  1HDP A;  3JR9 A;  3GTJ J;  4A3G J;  1E3O C;  4L5E A;  2K9Q A;  1MBH A;  1W0T A;  5IYB J;  2DN0 A;  2VUM J;  2HOS A;  1NK3 P;  4A3D J;  1SFO J;  1GUU A;  4XRS G;  3GTG J;  1X58 A;  3VPR A;  3JRG A;  3JRB A;  3JRA A;  2JK3 A;  5FKL A;  3CQZ J;  1IGN A;  3DCF A;  2NOG A;  1Q1V A;  4CYC A;  4UUS B;  2EZL A;  2DA5 A;  3LSP A;  4AUX A;  1S7E A;  2ID3 A;  2CQQ A;  2O7O A;  4X6A J;  3HOW J;  4AC0 A;  3WHC A;  1ITY A;  2VI6 A;  1DU0 A;  1IV6 A;  2CJJ A;  3ZQL A;  3G1L A;  3IV5 A;  1IG7 A;  1A5J A;  2X48 A;  1MNM C;  3Q0W A;  3GTQ J;  2HXO A;  4XIC A;  3LOC A;  3BR2 A;  2VKV A;  2E2H J;  2GM4 A;  5FKM A;  1AHD P;  5FJ8 J;  3CCY A;  4BY1 J;  4A3J J;  1T56 A;  2DMT A;  2ID6 A;  5BNG A;  2RAE A;  2R5Z B;  1K61 A;  1TWG J;  1JGG A;  2YU9 J;  2GLO A;  5F04 A;  4A69 C;  1WI3 A;  1GVD A;  4IHV A;  4IHY A;  4G12 A;  5J3L A;  2K9S A;  3HB9 A;  5C4X J;  4JX4 A;  4QTR A;  1MBF A;  4JX6 A;  3FK7 A;  1POG A;  1FIP A;  2ME0 A;  2Y2Z A;  1IRZ A;  3BG3 A;  3MVP A;  3MKL A;  1IDY A;  4D7M A;  3G1O A;  3JRH A;  2L7F P;  3B6A A;  2EBI A;  2XRL A;  1ETK A;  3HOU J;  1F36 A;  4C3I J;  1JKQ C;  2H1K A;  2M0C A;  2LP0 A;  4J19 A;  3JRE A;  1Y1W J;  2MGQ A;  4DW6 A;  3GTM J;  4BY7 J;  3Q0U A;  3HBL A;  1FTZ A;  3HOV J;  2Y0S N;  1TWF J;  2LVS A;  4DYR A;  5FLV A;  2DA3 A;  2G0E A;  4M6V A;  2ME6 A;  2QF7 A;  5IYC J;  3PO3 J;  1HOM A;  2DMP A;  3L1P A;  1FIA A;  2YS9 A;  2L0K A;  3HOY J;  5C4J J;  5FLM J;  2DA7 A;  2JMW A;  1F43 A;  1ZKG A;  3W6V A;  1MBG A;  2X6O A;  2DMU A;  5E3L A;  1P7J A;  1JTX A;  3M3Y J;  5C44 J;  2LR8 A;  2GBY A;  3BTI A;  3K7A J;  1B8I B;  1BL0 A;  3GTL J;  4DYC A;  1AU7 A;  2EH3 A;  2XPW A;  1B72 B;  2DTZ A;  1Z77 A;  3S1Q J;  1W0U A;  4LOC A;  3NAR A;  4RDU A;  3BR1 A;  3A02 A;  3TW6 A;  4M3E A;  5IP9 J;  4MIM A;  2NVY J;  2XGD A;  5GPC A;  3A01 B;  2FX0 A;  1RR7 A;  4D7N A;  2IAI A;  1RKW A;  1OJL A;  3JRI A;  2R93 J;  1JT6 A;  2LTP A;  3BG5 A;  2I10 A;  1TWA J;  1ENH A;  1IJW C;  4UUS A;  3HKZ N;  1NTC A;  1VFC A;  1HDD C;  3DEW A;  5K7Z A;  2WV1 A;  5GP9 A;  1ZGW A;  3ZQF A;  2R92 J;  1IDZ A;  3S15 J;  2L7Z A;  3RZD J;  3K2A A;  3ZQC A;  2TCT A;  1APL C;  3S14 J;  2DA6 A;  2M2E A;  3TW7 A;  5EEA A;  1OCT C;  4NDL A;  1T33 A;  2FQ4 A;  4FTH A;  2LKX A;  3ZQI A;  2ECC A;  9ANT A;  4XID A;  4A3K J;  4I6Z A;  1QRY A;  3BR5 A;  2LK2 A;  2R7Z J;  3SFI A;  1TWH J;  1U8B A;  1RPW A;  1WPK A;  2JN6 A;  4V2G A;  5F1J A;  5M5X J;  2R5Z A;  2XPV A;  3QPL A;  4XK4 A;  3QQA A;  1WH5 A;  4A3E J;  3S2D J;  5M3F J;  1ETV A;  4EEF G;  2LY9 A;  1GT0 C;  1NK2 P;  2NVQ J;  3S1N J;  1HF0 A;  3BQZ A;  1TWC J;  2LFB A;  5JLW A;  2LD5 A;  3IH2 A;  4FE7 A;  1ZTR A;  4B1R A;  5J1R A;  2E2J J;  1HLV A;  4MLO A;  5F27 A;  3ZOB A;  2OPT A;  4M3F A;  5DTD A;  1UHS A;  1RES A;  4A3C J;  1AKH B;  4A3B J;  5EGO B;  5IP6 A;  1R9T J;  1JUP A;  2EZH A;  3ZQG A;  5EF6 A;  1JKR C;  3O8H A;  1JUM A;  1ZK8 A;  2XPU A;  4JYK A;  5F0F A;  2HOT A;  5EYR A;  5F0C A;  3RKQ A;  2X9D A;  1U78 A;  2AHQ A;  4BXX J;  1HCR A;  2L9R A;  3OOU A;  3QPS A;  2HI3 A;  1VI0 A;  1I6H J;  1X2N A;  1LE8 B;  4RBO A;  2R5Y B;  3GTO J;  2JWT A;  3LSG A;  2NVX J;  1IUF A;  4C2M J;  3SJM A;  1YRN B;  5EDN A;  2DA4 A;  3PO2 J;  4A3M J;  2XB5 A;  3G1M A;  2MSY A;  3JRC A;  1B8I A;  2NS8 A;  5J1Y A;  1ZQ3 P;  1B72 A;  5IYD J;  2IBD A;  1GDT A;  1JTY A;  5E3O A;  2CU7 A;  4M3B A;  5K7F A;  1JUS A;  3CMY A;  2JA5 J;  3A01 A;  2Y9Z A;  3HOX J;  2DA2 A;  4Y52 J;  3GBG A;  5IOZ A;  1ZR2 A;  4JX5 A;  2IEK A;  3CDL A;  3D1N I;  5EZG A;  2B63 J;  1UG2 A;  5FKO A;  2W48 A;  4W1U A;  4C3H J;  4V2F A;  2CUE A;  4QIW N;  4XRS A;  5EG0 A;  1UMQ A;  2CRG A;  4BBS J;  1FJL A;  2VKE A;  3TP0 A;  1XS9 A;  3BTJ A;  2KDZ A;  1JKO C;  3TP3 A;  1ETY A;  2H8R A;  1BW5 A;  1BW6 A;  2JA7 J;  2M34 A;  2N8G A;  1ETX A;  2K9N A;  4B4C A;  1XC5 A;  1ORK A;  1WGX A;  1BA5 A;  4DYQ A;  2ZB9 A;  4HNV A;  1BJZ A;  4A93 J;  3BR6 A;  4B3A A;  2AO9 A;  3A03 A;  5FKN A;  5EG0 B;  1I50 J;  1GV5 A;  2EZK A;  2ECB A;  3HOZ J;  4M3D A;  1MBE A;  2MW8 A;  4C3J J;  3H3V K;  3FIS A;  5E3N A;  3HDD A;  1FTT A;  4FE4 A;  1ZR4 A;  1VF9 A;  3F0C A;  3FIW A;  1U9N A;  4ABZ A;  4FIS A;  2LLK A;  3BR3 A;  3ZQH A;  5C3E J;  4BKX A;  2CUF A;  3S1M J;  5F0H A;  2DA1 A;  2EZI A;  4I76 A;  2E1O A;  1MSE C;  5IPA A;  2Y30 A;  5M3M J;  4BBR J;  2HXI A;  1ETQ A;  2XSD C;  1AKH A;  2O9L A;  1O4X A;  2FJ1 A;  1QVT A;  1U9O A;  3WHB A;  5EGO A;  4IEJ A;  1X2M A;  2Y31 A;  3O8G A;  5F08 A;  1Y1V J;  2NS7 A;  1PUF B;  1I3Q J;  1QVU A;  2L7M P;  4D5F A;  1MBJ A;  3HGG A;  5IOY A;  5GPA A;  4MFD A;  2DJN A;  2HOA A;  5JLX A;  3HEF A;  3UKG A;  3BT9 A;  1G2H A;  1H88 C;  3FK6 A;  4GFB A;  4DZJ A;  1LE8 A;  2R5Y A;  5DS9 A;  2TRT A;  1K83 J;  4IHX A;  4JP0 A;  1YRN A;  2ELK A;  4S0H B;  2E19 A;  2CQX A;  1RET A;  4CYC B;  1WH7 A;  3E7L A;  1JKP C;  1OCP A;  5EZH A;  1JT0 A;  2HQ5 A;  2D5V A;  3MN2 A;  3BR0 A; 
#chains in the Genus database with same CATH topology
 2Y9Y A;  5D4S A;  3AG2 H;  4IJA A;  1BIB A;  4CHU A;  3ISP A;  1FEX A;  3GLX A;  2R7F A;  2OU2 A;  2V9P A;  3SEZ A;  4E7Z A;  4AYB N;  3GLL A;  5J40 A;  1OQY A;  1PP7 U;  5CVU A;  4WXH A;  5TIS C;  5L3D A;  1FC3 A;  2CQ7 A;  3ZMZ A;  1MH3 A;  1SEU A;  4OMZ A;  3E6C C;  2GXA A;  4HYE A;  3ASN H;  1LUJ B;  4ZYH A;  1ON2 A;  3KLO A;  3TED A;  3DLA A;  5CQG A;  3ZQ7 A;  2NNY A;  2M8G X;  2BY3 A;  1P6R A;  1XD7 A;  2VE8 A;  2W7N A;  1HQC A;  1YJ9 I;  1SVO A;  2YX4 A;  2IPQ X;  4YFN F;  1LFU P;  2R7Q A;  3MFK A;  3L9F A;  2YUS A;  2VPR A;  2XAF A;  4WXC A;  1TL8 A;  1VQK I;  4GYG A;  1I39 A;  4H4K C;  2E1N A;  2NVT J;  4N4O B;  4RLF A;  3RTR A;  2QEN A;  3R61 A;  3E1S A;  2K40 A;  3VYS B;  1MBK A;  2I5U A;  3H35 A;  3S8P A;  1SFX A;  3AL0 C;  4XLC A;  2K9M A;  4E7I A;  4BXF A;  2OCC H;  1UB9 A;  4HNU A;  3K4N A;  2JA8 J;  4GRI A;  2M9H A;  4ENN A;  1RNL A;  1U0J A;  1Z3Y A;  1QZY A;  1M1E B;  4Q4Z F;  3PM1 A;  2IGM A;  5FRN A;  1PYV A;  4N4N B;  3PFY A;  1SAU A;  4D0P A;  1SAN A;  1A36 A;  4HQE A;  4A3I J;  3EQL F;  4RGX A;  2FEZ A;  1AWC A;  4A3F J;  3B6C A;  1A6I A;  4ZDP A;  2R7T A;  3CMM A;  2F4I A;  3BCB A;  2XAH A;  5M5Y J;  4NQW B;  1FSE A;  3RCO A;  4UNO A;  4XLF A;  3Q3S A;  1OCZ H;  4RM2 A;  2DMN A;  1QZZ A;  2BY0 A;  2XDV A;  3LNQ A;  2L5Q A;  2OBP A;  3DKY A;  2VJI A;  3VB2 A;  2R7V A;  2BGC A;  2GOX B;  1GXP A;  3T1B A;  2W4S A;  1YW9 A;  3HPH A;  1D0Y A;  3LL7 A;  2OTL I;  4MTD A;  2L2O A;  4I99 C;  4ESJ A;  2EFP A;  3J80 Z;  4WWC A;  1SC7 A;  4NUB A;  4RB1 A;  1Z91 A;  3T8R A;  5FKL A;  4OIR F;  3JAM K;  5CQE A;  3CJR B;  2NOG A;  1Q1V A;  4GCV A;  1R1U A;  3GYH X;  4I2O A;  3LSP A;  2O7O A;  2CQQ A;  5E1W A;  5GAG J;  4C9Y A;  4X6A J;  4H0E A;  2DFE A;  1DU0 A;  1IV6 A;  2BW3 B;  4ZZL A;  3BPX A;  3ZQL A;  2GA1 A;  3ZN1 A;  4HF2 A;  2JPC A;  1UAA A;  5CVR A;  1VQ5 I;  3JSP A;  4AM3 A;  1H0M A;  3IKV A;  3GTQ J;  4B43 A;  2VKV A;  4OAY A;  4F7Z A;  2JQ7 A;  2ZXH A;  1T8I A;  5DV5 A;  4KIC A;  2OUM A;  3OMY A;  2D2W A;  2KRC A;  3N05 A;  4BQA A;  2ZJP F;  2XV4 S;  2BVL A;  2L01 A;  3FXM A;  2IS4 A;  1I1S A;  2F4M B;  3EUA A;  2X1D A;  4HSR A;  5F04 A;  2GLO A;  1MJB A;  1WI3 A;  4IHY A;  1K78 A;  1BOA A;  1E17 A;  3KET A;  2BHY A;  2G9W A;  1MBF A;  2CO5 A;  4Q48 A;  3HOT A;  2UZK A;  2H27 A;  2VIX A;  3FK7 A;  3HUG A;  1FIP A;  1IZ1 A;  2ME0 A;  2Y2Z A;  2WY8 Q;  3OYM A;  4O5V A;  3TMO A;  1UFM A;  1I3A A;  3G1O A;  3QRF F;  3JRH A;  3B6A A;  4UHT A;  1WJD A;  4OAZ A;  4XOT A;  2EA2 A;  3L2R A;  1MW7 A;  3QOD A;  4B8X A;  1F36 A;  5F64 A;  5HLT A;  4J19 A;  2DO7 A;  2LP0 A;  1FPQ A;  2VPL A;  3F6V A;  1G3Y A;  3DWL E;  3JRE A;  2XAS A;  1VQM I;  4DOZ A;  2BVM A;  4BY7 J;  2M7A A;  1IN8 A;  2WV0 A;  3HBL A;  2LY1 A;  3Q0U A;  5EEH A;  4JBA A;  5FLV A;  4DYR A;  1YOV B;  1G3T A;  4LK1 F;  2IT0 A;  1EJ9 A;  2KP6 A;  2QF7 A;  2DMP A;  1REP C;  1LNW A;  1HA8 A;  1QU3 A;  3ZXS A;  2RC4 A;  5J4V A;  2WA0 A;  2YS9 A;  1FNN A;  2E5Z A;  3WG9 A;  3MCZ A;  1BI0 A;  3F21 A;  3GFM A;  4HA8 A;  3DKX A;  3HYI A;  2QQ8 A;  2DMU A;  3U21 A;  5DD4 A;  2ZSH B;  1JTX A;  4ZYD A;  1W5S A;  5C44 J;  3SXY A;  3K7A J;  1BL0 A;  2ZME C;  3GTL J;  2EH3 A;  1MIJ A;  1Z77 A;  1YJN I;  4CCO A;  4LOC A;  5D6F A;  3N97 A;  3DF8 A;  2EIL H;  4I0A A;  3BR1 A;  3A02 A;  3TW6 A;  5LEJ A;  3FWE A;  4UUV A;  5DDG A;  2DOD A;  4B44 A;  2NVY J;  2XGD A;  3A01 B;  2R7W A;  2HTS A;  3K1M A;  2FX0 A;  2DK8 A;  3I64 A;  4PDK A;  3QYF A;  3JRI A;  2UWM A;  4XBF A;  2R7U A;  1TWA J;  3HRT A;  1YTY A;  3S3O A;  3D5L A;  3TO6 A;  4UUS A;  4CSW A;  4BDZ A;  3DEW A;  4ZDL A;  5K7Z A;  4J00 A;  3OIP A;  5GP9 A;  1ZGW A;  5AIP A;  1E0E A;  5LGU A;  2K02 A;  1WVR A;  3K70 C;  1BI2 A;  3F6O A;  4L5I A;  4PGH A;  2EIK H;  4KDP A;  3RJP A;  2VOP A;  3IC7 A;  2DA6 A;  2XAQ A;  2ZFU A;  4BQQ A;  1OYY A;  5GTI C;  3VFZ A;  3D5S C;  3QWL A;  1U5T A;  3WOD F;  1BOB A;  3W3C A;  5ICG A;  1FT9 A;  4A3K J;  1UCR A;  4I6Z A;  3SDB A;  2OTJ I;  1HXD A;  2MA3 A;  2LK2 A;  3HL2 A;  1TWH J;  6PAX A;  4RB3 C;  2JN6 A;  4RAZ A;  1SD4 A;  4XK4 A;  1E2X A;  2BE5 F;  4YFK F;  3S2D J;  1ETV A;  3K4J A;  3HG9 A;  1O7F A;  3LSI A;  1T95 A;  2VT2 A;  2DOF A;  3ZRG A;  1BN5 A;  2NVQ J;  2W84 A;  3HXL A;  1TWC J;  2LFB A;  1XN7 A;  2HDC A;  4XR6 A;  2E7W A;  3LST A;  4M6X A;  2H1L A;  3T5X A;  4EV0 A;  4B1R A;  5J1R A;  2E2J J;  1X1B A;  4MGR A;  3ZOB A;  1ZGJ A;  1XTA A;  1ZYR F;  2OPT A;  1DGW Y;  4HBL A;  5GAD J;  1RES A;  1XX5 A;  2P7C B;  4KYW A;  3VWB A;  3T0Y A;  2M4K A;  4ZYA A;  4YG2 F;  3J80 K;  4U7D A;  2EZH A;  5EF6 A;  3GZN B;  3O8H A;  1JUM A;  4UVB A;  4JYK A;  2L3D A;  4RS8 A;  4LLL A;  2VBW A;  4E6K G;  2M30 A;  1Z1D A;  3DBL B;  3E6M A;  2FU4 A;  3HHH A;  3CF5 F;  4HAM A;  3EUK L;  1J9I A;  5ICF A;  2Z99 A;  5E1Z B;  1UHW A;  2UXX A;  1X2N A;  4RBO A;  5HLI A;  2QSH X;  2X6W A;  3GTO J;  2JWT A;  4LG0 A;  4C2M J;  1IO2 A;  2R3S A;  4EAT A;  3SJM A;  3KP4 A;  1YIJ I;  1SFE A;  1YRN B;  3KEY A;  2VQH A;  4A3M J;  2DI3 A;  3AKZ A;  2EIJ H;  1YIO A;  4RLQ A;  2BOL A;  3LAJ A;  1B72 A;  1TZL A;  1GDT A;  1B4A A;  1WI9 A;  4M3B A;  3HJE A;  5K7F A;  1JUS A;  2H09 A;  1Z21 A;  2IP2 A;  1J7K A;  2Y9Z A;  4M9Z A;  5FRO A;  1KU3 A;  4E70 A;  2NRA C;  2HZT A;  4CCM A;  2B9S A;  1BC8 C;  4IRH A;  4JX5 A;  1N25 A;  3CDL A;  3D1N I;  1MMS A;  3IWF A;  3JW4 A;  2B63 J;  5D5W B;  3HZJ A;  2IS6 A;  5FD6 A;  2O61 A;  4XRS A;  3QYB A;  5EG0 A;  4G9Y A;  2QQA A;  1MGT A;  1UMQ A;  4U87 A;  4E4H A;  1XS9 A;  3TP0 A;  2W1O A;  4G7O F;  2KDZ A;  4MHG A;  1JKO C;  5B1B H;  3TP3 A;  2F4O B;  3WU2 C;  4XL9 A;  3RDI A;  2WWY A;  2NXN B;  2N8G A;  3V7S A;  2L9N A;  3JSO A;  2K9N A;  2MH2 A;  4HLX A;  3NQO A;  1OCR H;  3D5R C;  2VBZ A;  1FMV A;  1BA5 A;  2O03 A;  2ZB9 A;  4DYQ A;  2ISZ A;  5H20 A;  4BHC A;  3R0A A;  2A6H F;  4B3A A;  1R5G A;  2WBM A;  3HOZ J;  3K1P A;  1YYV A;  1N78 A;  2M7B A;  3FIS A;  5E3N A;  2V9K A;  2HU9 A;  3HDD A;  2QSG X;  1VF9 A;  3F0C A;  1G8X A;  3CDH A;  2K86 A;  2OA4 A;  2DYS H;  3FIW A;  4MEY F;  2PJP A;  2EV5 A;  2M3A A;  2WY7 Q;  4LD5 A;  2PFB A;  1ZN2 A;  3H1C A;  4FIS A;  2LLK A;  2RRE A;  3QU3 A;  5F0H A;  2EZI A;  1Y6I A;  2X1E A;  3CCR I;  3H9J A;  2Y30 A;  3KX2 A;  1G3S A;  2HXI A;  3FXJ A;  2FBK A;  1J2X A;  4GXO A;  2NOJ B;  3IRR A;  1QVT A;  3WHB A;  5LGT A;  1XMA A;  4FT8 A;  4IEJ A;  5KHD A;  3O8G A;  2NS7 A;  1I3Q J;  4D5F A;  1X1C A;  1RUO A;  2LC2 A;  4ZZD A;  2Y69 H;  2WAQ A;  5DCM A;  2DJN A;  1XPX A;  2HOA A;  4C2T A;  3LQQ A;  3HEF A;  4CCK A;  2Y0S A;  1LE8 A;  1RZ4 A;  3C7J A;  3NRV A;  5DS9 A;  5HNF A;  2WB1 A;  2ELK A;  4PJL A;  2RN7 A;  2FUG 2;  4C2U A;  4HV6 A;  1WH7 A;  2CUJ A;  2R7X A;  3UR3 C;  2PMH A;  4MNU A;  2VL8 A;  4ITV A;  2XC7 A;  3OS2 A;  1LEB A;  2HQ5 A;  2DW4 A;  2CW7 A;  4P9F A;  3PQK A;  2HTJ A;  3L2V A;  4XOP A;  1ERD A;  3MZH A;  2K27 A;  1YIT I;  2QUF A;  4OU0 A;  3I4N J;  1LEA A;  2P7V B;  2HGC A;  2JJ7 A;  3RI4 A;  5KK1 A;  2DU9 A;  1D5Y A;  1TC3 C;  4D9J A;  2EFW A;  5CLS A;  4LIU A;  4X1E A;  4N9H A;  3DPU A;  3Q0V A;  1EH8 A;  4CCJ A;  5ILU A;  4Q47 A;  2PMZ N;  2KMU A;  4F52 A;  3I59 A;  1P7I A;  4II3 A;  1VTN C;  2VOD A;  3FF5 A;  5FO5 A;  3SQN A;  4XKB A;  1SVL A;  4YIR X;  2E2I J;  1OR7 C;  3KYD B;  4Y7N J;  4A3L J;  3E3V A;  3BTC A;  1H89 C;  2LKP A;  4QWQ A;  2V4J C;  1OFC X;  1K78 B;  3HGY A;  2I8D A;  1QPI A;  1PVE A;  1JJ6 C;  2HQA A;  3LA3 A;  5B1A H;  4ZC3 A;  3BLY A;  1OCC H;  5J1U A;  5KAF C;  3HM5 A;  2ZSI B;  4P96 A;  4DQ2 A;  2IA2 A;  3Q9S A;  3MZY A;  4M3G A;  4MFE A;  1L3L A;  1JJ8 C;  1OMI A;  3WGH A;  4XRM A;  2VE9 A;  3GCM A;  3O6B B;  2XF5 A;  1IRG A;  1EF4 A;  3I4M J;  3OSG A;  2ACJ A;  1HC8 A;  2JUC A;  4ASN A;  3PUF A;  3BTL A;  4Z6Y A;  2MC4 A;  3DEU A;  4HNT A;  5HDK A;  3REO A;  2FD5 A;  1D0Z A;  1V5G A;  3IH4 A;  1XGM A;  3C2G A;  1ETW A;  4QSH A;  1HW2 A;  3V8K A;  2D45 A;  3BC8 A;  4F3Q A;  3S2H J;  4OIQ F;  3F23 A;  3DPT A;  1W7P B;  4RMN A;  1XDS A;  2K7L A;  4RAF A;  2KIF A;  4KMU X;  3PIO F;  2EFN A;  2R7D A;  3C2B A;  1YFH A;  1LPQ A;  1JGS A;  2QCO A;  2XB0 X;  4HX8 A;  3I56 I;  5BMZ A;  2DT7 B;  2PBI A;  2QZ8 A;  3D0S A;  5LRR A;  3BJO A;  2BXY A;  1HDP A;  1VZ0 A;  4BE1 A;  3JR9 A;  2L02 A;  2L54 A;  3IP4 B;  4I02 A;  3WE2 A;  5IT9 Z;  4QPO A;  3PSF A;  4G8X A;  2K9Q A;  1W0T A;  4RGU A;  2VUM J;  1ZG5 A;  1SFO J;  1AA7 A;  2DPU A;  2VXZ A;  3J7Y J;  4YEJ A;  3QU6 A;  2JK3 A;  2DDA A;  3L2C A;  2V1X A;  1O3T A;  2OV7 A;  2MH9 A;  1P4W A;  4UUS B;  3J81 Z;  2DA5 A;  2M5W A;  4AUX A;  4DBR A;  1S7E A;  2ID3 A;  3MD2 A;  5CKT A;  3BJA A;  3NEU A;  2LG4 A;  4PUS A;  4NC8 A;  2KIS A;  1ITY A;  1W5T A;  2VI6 A;  2A69 F;  2ZJQ F;  5FFZ A;  5D5U B;  1R4M B;  1WHU A;  1LKX A;  2IGN A;  2XF7 A;  3G6E I;  1R5H A;  3F8C A;  5D5X B;  4ZTF A;  1U5T B;  1S3J A;  2JPB A;  4KJZ A;  3MKW B;  3K70 D;  2BV6 A;  4PSW A;  1FWZ A;  2GM4 A;  2LYC A;  4F55 A;  3CCY A;  1AHD P;  3DTE A;  3LA7 A;  1T56 A;  1R00 A;  2DMT A;  1EA3 A;  4CUG A;  5BNG A;  2IRF G;  1K61 A;  2PQ8 A;  1TWG J;  5J47 A;  4XKC A;  3S2W A;  1JGG A;  2YU9 J;  5ICE A;  5JR3 A;  1MJ9 A;  1G4D A;  4IHV A;  1K6Y A;  2DDB A;  1D0X A;  5ILS A;  2ADU A;  4ENJ A;  4BGD A;  2QBY A;  5FGM A;  4I7H A;  5HDG A;  4IQJ A;  4JX6 A;  1K7A A;  1I1G A;  1E3H A;  1POG A;  1IF1 A;  1IRZ A;  3MVP A;  5AIQ A;  2P6S A;  1SD6 A;  3MKL A;  1IDY A;  2HKO A;  3QOE A;  4A5N A;  4UV8 A;  3HKZ A;  3SZT A;  2ZXI A;  2STT A;  2QM3 A;  3L00 A;  4PSX A;  1ETK A;  4IL6 C;  3HSF A;  2STW A;  1YS7 A;  5HDN A;  1OYW A;  2M0C A;  2GZW A;  2F5F A;  3R0J A;  1PP8 F;  2DQR A;  1WJE A;  3MZ8 A;  4B48 A;  5HOO A;  2Z33 A;  1FTZ A;  1TWF J;  1RUN A;  2G0E A;  3KLN A;  4XQF A;  5HLH A;  3PO3 J;  1HOM A;  2L9V A;  4NHJ A;  4HST A;  2JZY A;  5E18 F;  1XSX A;  3WG7 H;  2FBI A;  1FIA A;  4BUP A;  2L0K A;  3CCV I;  4UB8 C;  5C4J J;  4EJU A;  3CO6 C;  4LG0 B;  2KJC A;  1DGR M;  4PFO A;  5HLG A;  2VOO A;  3CCL I;  2LSO A;  3OV8 A;  2NS0 A;  3I5U A;  1T39 A;  2GBY A;  3WTZ A;  2QLZ A;  2VC0 A;  3FXL A;  3O3K A;  2EWN A;  3TOA A;  1T08 B;  1B72 B;  2DTZ A;  2Z5U A;  2K85 A;  3CDI A;  4XON A;  5IP9 J;  1JI8 A;  4M6Y A;  4MIM A;  5GPC A;  3LWF A;  2OD5 A;  5H6R A;  2VBY A;  4RB2 C;  2PI0 A;  4AIJ A;  1TBX A;  4NB5 A;  2R93 J;  2PEX A;  5IT3 A;  3H0D A;  2LTP A;  2V1U A;  3FMQ A;  4A0Z A;  2XAU A;  1S72 I;  3PFI A;  1R7J A;  2KKO A;  2P6T A;  1BIA A;  1NTC A;  1FMW A;  1HDD C;  3ZQF A;  2YX7 A;  4LLN A;  2HQN A;  4MQV A;  3SZG A;  1O3Q A;  1RIO H;  2JVG A;  3EUH A;  2ZXW H;  2AQE A;  2H94 A;  5AON A;  1YO5 C;  3M8E A;  2M2E A;  3SEQ A;  2E5N A;  3TW7 A;  4IXA A;  1ZH5 A;  1V4R A;  1T33 A;  2LKX A;  1W1W E;  2PMU A;  3W6K B;  9ANT A;  2GWR A;  4XID A;  1U6G A;  3KZY A;  1KQ0 A;  2R7Z J;  1MMD A;  3SFI A;  3OYK A;  3CCE I;  4AYB A;  1RPW A;  4KIB A;  2HOE A;  3I3L A;  1JHF A;  3LSM A;  2XUB A;  2R5Z A;  2M45 A;  3QPL A;  4PZJ A;  3ABM H;  4IZZ A;  2L4A A;  2P5V A;  3V7C A;  2ZO4 A;  5M3F J;  2CGP A;  2LY9 A;  5L3B A;  2KIU A;  2GOM A;  4ZTJ A;  1LVK A;  5D8L B;  1IUY A;  1HF0 A;  4OMY A;  1XMX A;  2A61 A;  3EET A;  4MTE A;  3PNY A;  1R6R A;  1I5Z A;  1VQP I;  2Y75 A;  3RPU A;  4EJT A;  4CGZ A;  1ZTR A;  4XLH A;  3DV8 A;  4QPQ A;  2VAS A;  1HLV A;  2HNH A;  4Y13 A;  4MLO A;  4M3F A;  1F4K A;  1D3Y A;  3FMS A;  5DTD A;  1UHS A;  2A05 A;  4ESF A;  4A3B J;  3GME A;  3VSL A;  4FET A;  1GHC A;  3M1C A;  1D1C A;  3ZQG A;  1JKR C;  1ODD A;  5DM7 F;  3OS0 A;  2XKO A;  4R1H A;  2XPU A;  5F0F A;  4S05 A;  2Q1Z B;  4LIV A;  4KFC A;  3G3Z A;  5EYR A;  5F0C A;  3J81 K;  3GZ6 A;  3RKQ A;  1U78 A;  5DCM B;  2AHQ A;  4BXX J;  4DJA A;  1KQ8 A;  1KA8 A;  3ML6 A;  2L9R A;  3OOU A;  2XRN A;  1IV8 A;  4IRI A;  1G3W A;  1VI0 A;  1LE8 B;  4G6D A;  2A07 F;  3KYC B;  3W2A A;  3LSG A;  4OIO F;  4HDV A;  1MND A;  3CC7 I;  4YRV A;  5EDN A;  3BCA A;  2HYF A;  2KJB A;  1R1V A;  4OWR B;  2BY1 A;  1VQO I;  1OLT A;  5J1Y A;  1ZQ3 P;  3P7N A;  5IYD J;  4L9V A;  2ELJ A;  1IXC A;  2GQQ A;  3FZV A;  4CZZ A;  3N4M A;  2F5D A;  2NYX A;  3T8T A;  2CS3 A;  2H6C A;  4CIC A;  2M4G A;  3CMY A;  5JVG F;  2JA5 J;  3VOE A;  1KQ9 A;  4KIT B;  3HOX J;  1B59 A;  2HPI A;  5LBQ A;  4ENK A;  3U1D A;  2XSJ C;  1MKM A;  2L4M A;  1UJ8 A;  2MBF A;  5EZG A;  4MQ9 F;  2RDP A;  2W48 A;  5K5Q A;  3I59 B;  4V2F A;  4U0V A;  1QNT A;  2CRG A;  4BBS J;  2YU3 A;  1FJL A;  2VKE A;  1IN6 A;  1TNS A;  2XAG A;  2VQG A;  1KON A;  1TQP A;  1SMY F;  2KIQ A;  3CTA A;  1J5Y A;  1QPM A;  4M9X A;  2R7O A;  1ETX A;  3BP8 A;  1VQ8 I;  3CJT B;  1KU2 A;  4BJ5 C;  1S7O A;  5HS9 A;  1XC5 A;  1ORK A;  3ULQ B;  4HNV A;  1HST A;  1T0F A;  2DBB A;  3BDD A;  2EA4 A;  4A93 J;  5FKN A;  4L0Y B;  2IW5 A;  1XGO A;  2VKD A;  2BXZ A;  2MW8 A;  2BHZ A;  5B5E C;  2CFX A;  5D4R A;  1SVM A;  4FE4 A;  4DIQ A;  1ZR4 A;  2H6B A;  2F5C A;  3K2Z A;  3KP2 A;  1UHM A;  2DOA A;  2OQR A;  3CUQ A;  1U9N A;  4ABZ A;  4CH7 A;  4XLA A;  1QZE A;  2P4W A;  1QO0 D;  3R6S A;  2QA4 I;  5J4Y A;  4AIH A;  4Y15 A;  3HRU A;  3KP7 A;  3IAM 2;  1HKT A;  1QBJ A;  4I76 A;  3OR1 C;  4E7H A;  4HV5 A;  2E1O A;  2A5W A;  3M8J A;  4HLY A;  5D5V B;  3JCU C;  1XCV A;  5M3M J;  3CJN A;  1ETQ A;  1AKH A;  2FJ1 A;  1U9O A;  2MD0 A;  3DBH B;  1Z3X A;  2XHK A;  4XSZ F;  4RAG A;  3OYJ A;  2Y31 A;  5LLQ A;  1Y1V J;  4RM3 A;  3GFL A;  3HPG A;  1MBJ A;  3KP6 A;  4UXN A;  3LFU A;  2CQK A;  4A0X A;  5CPR B;  2VON A;  2PX9 A;  5GPA A;  3S93 A;  1KU7 A;  4BXU A;  3CCS I;  3KP3 A;  1RR8 C;  1RI7 A;  2CFO A;  2UUZ A;  2LBF A;  5E20 A;  1N77 A;  4GFB A;  3FK6 A;  1WFX A;  1W7P D;  2R5Y A;  2FNP A;  1STZ A;  3L09 A;  3CES A;  3MWM A;  3IL2 A;  2FF4 A;  4CCN A;  4IHX A;  1UST A;  1S9H A;  3IRQ A;  2OAZ A;  3CCJ I;  5E17 F;  1PDN C;  4AWX B;  2YPR A;  4Y4R A;  4RAY A;  1JT0 A;  4EQQ A;  1QGP A;  2MD5 A;  2FNA A;  2JRM A;  2VJ4 A;  3MKY B;  4E7J A;  3DXJ F;  3BR0 A;  3KFW X;  3LFK A;  3IUO A;  3G4S I;  1WCM J;  1CQT A;  4EVI A;  2QVO A;  2ZBK A;  4GO1 A;  2QQ9 A;  2W00 A;  5K5O A;  1J09 A;  4M71 A;  1TT0 A;  3U9G A;  3GXO A;  2E71 A;  4CZC A;  1V55 H;  1NG7 A;  2OF7 A;  3M7G A;  5LFA A;  2E36 A;  4MO7 A;  3W2V A;  1VQ4 I;  3GTP J;  2HDD A;  2BZT A;  1RKT A;  1Z6R A;  3IAS 2;  1A6Q A;  2E7X A;  4HPQ A;  4XMY A;  2DPD A;  4AD9 A;  2KT0 A;  4EM2 A;  4XLP F;  3GTK J;  1ETO A;  1MH4 A;  2DMQ A;  5L3E A;  2WAQ N;  3C1D A;  1NG6 A;  1PUE E;  2CUZ A;  3BZ6 A;  2P81 A;  4KUM A;  1ACI A;  2QBY B;  1LB2 A;  2RV8 A;  2JA6 J;  2WAF A;  1BR4 A;  1ZRC A;  3G2B A;  3U2R A;  2V26 A;  1SFK A;  4FX4 A;  1TNT A;  2O3F A;  2V79 A;  3H0G J;  2LRE A;  1Z0X A;  1IRX A;  4O3M A;  2IA0 A;  2WB1 N;  3FM5 A;  2HDW A;  4D5C A;  3A2K A;  5L3F A;  5HOD A;  4DZP A;  3LAP A;  2HYG D;  1SFU A;  5DYM A;  4IOC F;  1VND A;  2ZKZ A;  2CW8 A;  2EQR A;  2ETH A;  3U1K A;  3CCM I;  1ZG3 A;  1ZLK A;  1T38 A;  2H8W A;  4PGG A;  1FYM A;  1LDK B;  2F5E A;  3SDG A;  5L3C A;  3VDX A;  2O5R A;  3RZO J;  2R7S A;  1H9G A;  4W97 A;  2Z1D A;  4G6Q A;  2XGE A;  4NBQ A;  3QYE A;  1P4A A;  3ZCO A;  4D1Q A;  3OYF A;  3F22 A;  1MSF C;  2F6C A;  4OIN F;  5FFX A;  3BG9 A;  5IP7 J;  3HRM A;  1ON1 A;  1XB4 A;  4RGR A;  2ZCW A;  1PUF A;  1K79 A;  2D1V A;  2K5C A;  3UNG C;  3LSR A;  1E3O C;  2JSC A;  3I53 A;  2LH9 A;  1OKR A;  3I71 A;  4PCQ A;  3OYC A;  3DU5 A;  3F72 A;  2KRF A;  3OYA A;  1NK3 P;  2HOS A;  1BC7 C;  4A3D J;  1GUU A;  2MLK A;  1W36 C;  1X58 A;  2LY2 A;  3RQ4 A;  3VYT B;  1Y0U A;  3HTS B;  2M8E A;  3JRB A;  1MMG A;  2OZ6 A;  4ZH4 F;  5J8F A;  2DAO A;  3PSI A;  1IGN A;  1VQ9 I;  1Y0N A;  3P9I A;  1YS6 A;  1LDJ A;  1CF7 A;  2EZL A;  3IHU A;  3HOW J;  2CMP A;  4A6D A;  3RYP A;  4C30 A;  1IN4 A;  5E8G A;  2CV1 A;  1L0O C;  1IXR C;  5JHU A;  3EDP A;  5FD5 A;  2OCE A;  1Z6T A;  4NC7 A;  3IV5 A;  2O0Y A;  2VBX A;  1A5J A;  1V3F A;  2X48 A;  3Q0W A;  3H5R A;  3C3W A;  3QP6 A;  5B3S H;  3EUH C;  4N9I A;  4ZYG A;  1GXQ A;  2GAU A;  3BR2 A;  3LOC A;  2FBH A;  2CYY A;  4BAY A;  2E2H J;  1W4M A;  1ZEL A;  3CME I;  2QWW A;  4F92 B;  2R7R A;  1F1Z A;  4BU2 A;  2ID6 A;  4M73 A;  2R5Z B;  2RAE A;  4N0B A;  2GA2 A;  2WC2 A;  2IXS A;  1WQ2 A;  3SYT A;  1EH7 A;  3ROU A;  1HW1 A;  3FM3 A;  1QQI A;  1YW7 A;  1ZRF A;  2B0L A;  5IY5 H;  1DPR A;  3WTY C;  5J3L A;  2K9S A;  3HB9 A;  4GGG A;  2NVU B;  3E5Q A;  1MDM A;  1BR2 A;  4QTR A;  4FHT A;  2LOO A;  1JHH A;  3IWZ A;  4BNC A;  3K9T A;  4IVN A;  3BG3 A;  3CP2 A;  4D7M A;  3M07 A;  2HQR A;  1O3R A;  2DFH A;  2L7F P;  3LMM A;  4DBQ A;  1MMN A;  4AVP A;  5DCF A;  3HOU J;  2ZME A;  5HS7 A;  4HW0 A;  2GIZ A;  3ZMT A;  2EB7 A;  2CW0 F;  3VSK A;  2X85 A;  1Y8R B;  3FXK A;  3WE3 A;  4JK1 X;  3FDY A;  2KHM A;  3E6B A;  4DW6 A;  3GTM J;  2DT6 A;  3C18 A;  4LFU A;  3ONQ A;  1WZ2 A;  3HOV J;  2ZNY A;  2DA3 A;  3HUG B;  5KCM A;  4M6V A;  4WXD A;  1SAX A;  4I09 A;  1MJA A;  2XAJ A;  3KZZ A;  3VYU B;  5J6X A;  3WTT C;  3ELK A;  4ETS A;  4DNC A;  3L2W A;  2A5Y B;  3GO5 A;  3M1E A;  2ESN A;  3HOY J;  1HW5 A;  3DFG A;  4B09 A;  3V7R A;  2JMW A;  3DQV C;  1F43 A;  2BY2 A;  2PJR A;  3W6V A;  1MBG A;  4AID A;  2KRH A;  2X6O A;  3GW2 A;  3KE2 A;  1P7J A;  3ZMU A;  2LR8 A;  3BTI A;  4PK4 A;  3ERM A;  4DYC A;  1AU7 A;  1V5F A;  4AVZ A;  5TRD A;  3HRS A;  3S1Q J;  1MZB A;  4PFP A;  4LIT A;  3NAR A;  2M1B A;  3F8N A;  5LD2 C;  1UEL B;  4KN4 X;  2PG4 A;  1Y56 A;  2A6T A;  2RNG A;  1RR7 A;  4AIK A;  4Y17 A;  2ICW G;  2LMD A;  1RKW A;  4KT6 A;  1JT6 A;  2I10 A;  5ERI A;  1T2K A;  1IJW C;  3HKZ N;  1VFC A;  4E7K A;  4LLG F;  2WV1 A;  1XDU A;  2BEO A;  4OIP F;  2DT5 A;  5H6Q A;  4A5M A;  1J59 A;  1WJB A;  2R92 J;  3M9A A;  1HBX G;  3W6J B;  3S15 J;  3E5X A;  3RSN A;  3CO7 C;  3GFJ A;  2IA1 A;  3DBR B;  4J01 A;  5CVJ A;  4BJT A;  5CVI A;  2G7U A;  1O7L A;  3BR5 A;  3PUB A;  4EJW A;  4L18 B;  3OOP A;  3H36 A;  4LB5 A;  2FQ3 A;  3MEX A;  1NH3 A;  2YSR A;  3A4C A;  2V7F A;  4V2G A;  3ZPL A;  5M5X J;  2LRD A;  5H2F C;  2XPV A;  3BZK A;  2C6Y A;  1P92 A;  3QQA A;  1WH5 A;  1FOX A;  3AG3 H;  2PMZ A;  2Q2E A;  4CO8 A;  4A3E J;  4EEF G;  1T0F C;  4KIF A;  2G7H A;  1GT0 C;  1NK2 P;  3TBI A;  2EIN H;  4HG2 A;  3S1N J;  3J7Z I;  3OYB A;  4KT5 C;  4F93 B;  3CUQ B;  3R60 A;  1RRJ A;  2RVC A;  2LD5 A;  4FE7 A;  4R8H A;  3ZP5 A;  4NNJ A;  1FX7 A;  3BY6 A;  3CUQ C;  3FBN B;  4B47 A;  1U5T C;  4HDU A;  4K2E A;  1XGN A;  1F9N A;  5LGN A;  1WJF A;  1V54 H;  4A3C J;  1IXS B;  1AKH B;  4P9U A;  1HKS A;  3WGG A;  2FML A;  1BJA A;  1R9T J;  1JUP A;  2FRH A;  1GVJ A;  3PIP F;  3KZI C;  3K10 A;  4M72 A;  2M0M A;  2XF6 A;  3E0J B;  1DP7 P;  3HC7 A;  2IGK A;  1JXS A;  3CCQ I;  4WF2 A;  3B02 A;  3CJQ B;  1MNE A;  3DU6 A;  1HCR A;  2W85 A;  2X6X A;  4BEH A;  3FHZ A;  2LBF B;  1YLF A;  5HS8 A;  1ZG1 A;  1G6N A;  3ZMS A;  2PLY A;  2R5Y B;  3ERE D;  2QGU A;  3I54 A;  1IUF A;  5A2Q Z;  3GF2 A;  3FKJ A;  2KQR A;  1DUX C;  2QQB A;  2PN6 A;  2LF8 A;  4BHP A;  4L9T A;  3VOD A;  2HPM A;  3PO2 J;  3ABL H;  2DK5 A;  2MSY A;  3JRC A;  2V9V A;  1B8I A;  4IHS A;  3FX3 A;  2GXG A;  1XMK A;  3W2W A;  1YW8 A;  2E35 A;  1TP4 A;  5E3O A;  4EGZ A;  2FE3 A;  5DD8 A;  3SFZ A;  4RGS A;  1BI3 A;  3I55 I;  2P5K A;  1G59 A;  3JTH A;  4U0Y A;  4XSX F;  2QKM B;  4BQN A;  2RKH A;  4JOM A;  2Z2S B;  3DTI A;  2MC3 A;  2DA2 A;  2A68 F;  4Y52 J;  2UXN A;  3GBG A;  5IOZ A;  1ZR2 A;  1PJR A;  4PJJ A;  2BBY A;  1Q1H A;  3BG7 A;  2KIM A;  3ZQQ A;  3RKX A;  3TQN A;  5FKO A;  3G73 A;  1R4N B;  1TQI A;  3GZ5 A;  1KYW A;  2BYV E;  1IN5 A;  1P4X A;  2DFF A;  4W1U A;  4C3H J;  4QIW N;  4KA4 A;  4E7L A;  3PNV A;  1ZHF A;  3AL0 B;  3GEZ A;  3AAF A;  2ISY A;  3BTJ A;  3RKY A;  5BOX A;  2EK5 A;  1BW5 A;  3OL3 A;  2JA7 J;  2M34 A;  1FLI A;  1ZLJ A;  5CJ9 A;  2B7E A;  2GXB A;  3WGI A;  2K4J A;  3PQJ A;  2EIM H;  2LF7 A;  2CG4 A;  4L5J A;  3M8F A;  1ZAR A;  2CSO A;  1WGX A;  1D1A A;  2JA2 A;  1WRJ A;  2AO9 A;  5EG0 B;  3PL8 A;  4G7Z F;  2EZK A;  2ECB A;  1WJC A;  4LMY A;  1VQ7 I;  4M3D A;  1MBE A;  2VQC A;  1FSH A;  3DTK A;  2DYR H;  1QHH D;  2F5V A;  2KDO A;  3QP5 A;  1FTT A;  5D6E A;  3OYN A;  5JVT A;  3CD6 I;  4BL0 B;  3OYH A;  2VN2 A;  1S7A A;  3I9V 2;  2EJR A;  4PJN A;  2VC1 A;  3BR3 A;  3KEO A;  1I27 A;  1YX5 A;  3ASO H;  3ZQH A;  3B73 A;  5C3E J;  4F91 B;  3S1M J;  4FX0 A;  1KZH A;  3J7A Y;  2V6C A;  4UVC A;  5EJC A;  2MYS A;  5GTH C;  3AFH A;  3KCC A;  3MMY B;  2EV6 A;  1MSE C;  5IPA A;  4BBR J;  3J7A O;  2XVC A;  1S5L C;  4P5O A;  5GAE J;  2DLL A;  2FOK A;  5EGO A;  1X2M A;  2VB6 A;  3C2H A;  1ZGA A;  3SHF A;  3WU0 A;  3H3Z A;  2AXT C;  3I58 A;  4IOA F;  2D1H A;  1PUF B;  1QVU A;  2DQL A;  2L7M P;  4HX4 A;  4LG3 A;  3V4G A;  1ZRD A;  3HGG A;  1X1D A;  2CQN A;  1A35 A;  1Z05 A;  4MFD A;  4YEL A;  5IT9 K;  1R49 A;  2JTV A;  5JLX A;  3UKG A;  3KPH A;  4ZJZ A;  1MD0 A;  2EV0 A;  3BT9 A;  3I0T A;  1G2H A;  5FB2 A;  4HQM A;  4Z2Y A;  1F5T A;  5FRM A;  4BYY A;  4DZJ A;  3K4B A;  3KYL A;  3K69 A;  4BHB A;  4HX7 A;  4JP0 A;  1LJ9 A;  4U0W A;  1XSD A;  1X19 A;  2E34 A;  2R4G A;  4XN0 A;  5TJJ A;  3VYR B;  3DKW A;  4Q5S F;  2DTR A;  4II2 A;  2K3P A;  3K4M A;  1O3S A;  2CQX A;  1RET A;  1CF7 B;  3E7L A;  1OR7 A;  1OCP A;  2Y0M A;  3CLO A;  1W36 D;  2XIG A;  2A3S A;  2JRT A;  5ICC A;  3Q5F A;  1X1A A;  2D5V A;  3MN2 A;  3TO9 A;  3JTG A;  2FMY A;  2R0Q C;  3BQY A;  2FA5 A;  3TDU C;  3E6D A;  5L3G A;  4V19 K;  2IJL A;  3WTS C;  3FKI J;  3FXQ A;  2HKX A;  4HZF A;  1UG0 A;  2ZNZ A;  1BBY A;  1H9T A;  4ZDO A;  3WTU C;  1DU6 A;  2QKL B;  1R23 A;  4UV9 A;  4CXF A;  3EYI A;  1ONV A;  2HVS A;  5LRS A;  4KN7 X;  2F48 A;  3A0H C;  3AG1 H;  4IF4 A;  1TQM A;  3NAU A;  5F6F A;  4S04 A;  3CUO A;  1GV2 A;  5E3M A;  1X4P A;  3M4O J;  3LSJ A;  2WTE A;  1E3P A;  4A2U A;  2M87 A;  2HVQ A;  4IRG A;  1MDM B;  2ZFW A;  2F2E A;  3K6G A;  3S16 J;  3GWZ A;  3FXU A;  3FBI B;  4L9N A;  3F8F A;  4PJ0 C;  2COB A;  4XN3 A;  3PJR A;  1CGP A;  2XKP A;  2VT3 A;  2ZJ2 A;  1W7P A;  4A12 A;  3CC4 I;  3LQR A;  4P1W A;  1TW3 A;  2ZME B;  1FBU A;  1TLH B;  1VQL I;  4KMF A;  5A2Q K;  2FSW A;  4I98 B;  3WTV C;  1LFB A;  2K3F A;  2MLG A;  3A0B C;  2HYJ A;  3OSF A;  3IH3 A;  2E1M B;  5FKK A;  3OIO A;  3RPU D;  3P5J A;  3S3N A;  1YE9 A;  1IN7 A;  2JT1 A;  4IHW A;  5M5W J;  3CLQ A;  1B6A A;  2XGC A;  3Q9V A;  2O8K A;  2OC6 A;  1XSV A;  1YI2 I;  1R71 A;  1K6O A;  4FCY A;  2RQP A;  1H8A C;  4XKW A;  3JRF A;  2E1M C;  3S17 J;  5K7H A;  2KL4 A;  3JRD A;  2W57 A;  2ESH A;  3CZ6 A;  3RQI A;  3S1R J;  4UUT A;  4BAC A;  5EEG A;  1U3E M;  1S29 A;  1IC8 A;  1XG1 A;  2PJR B;  3DEE A;  4EM1 A;  2MG4 A;  2VKH A;  1X1P A;  5GAH J;  3BRO A;  3H5A A;  1D5V A;  3DLL F;  3QAH A;  3GTJ J;  4A3G J;  1WJ5 A;  5ED4 A;  4L5E A;  2X51 A;  1MBH A;  2X4H A;  2ZXJ A;  2HR3 A;  2DFI A;  1Z67 A;  5IYB J;  1HKQ A;  2DN0 A;  1Z9C A;  4XRS G;  1B9N A;  5E79 C;  1IRF A;  4GYI A;  3GTG J;  3K4C A;  3VPR A;  3JRG A;  2DXI A;  3F9K A;  3JRA A;  2YR2 A;  4YFX F;  3H3U A;  4IPA A;  1LFP A;  3CQZ J;  1LDD A;  3DCF A;  2X0L A;  3HSR A;  4CYC A;  1S6L A;  2W25 A;  2CV2 A;  2ELH A;  3BWG A;  3HSE A;  1R1T A;  4AC0 A;  1FZP B;  4XLE A;  3WHC A;  5DUK A;  2VLA A;  5LHH A;  1QA6 A;  1Z7U A;  3E5U A;  1KYZ A;  2CJJ A;  3F8B A;  3ABU A;  1C0W A;  4ESB A;  2Q8K A;  3G1L A;  4BE2 A;  1BM9 A;  3RPQ A;  1IG7 A;  2P8T A;  2P5L C;  1MNM C;  2IS2 A;  4UY8 I;  3PNT A;  1SD5 A;  2EFO A;  2E1C A;  2HXO A;  4XIC A;  5LEK A;  3A1Y A;  3OR2 C;  5DM6 F;  3FMR A;  3LSH A;  5FKM A;  5FJ8 J;  4BY1 J;  4HRI A;  4NC6 A;  2V1N A;  5DUI A;  4O6J A;  4XRF A;  4A3J J;  1FBS A;  1T6S A;  4L0Z B;  3KP5 A;  4EMS A;  3QPT A;  1WKM A;  3MQ0 A;  3F3X A;  1HSJ A;  2Q2E B;  1DPU A;  4A69 C;  1GVD A;  3OYG A;  1O57 A;  1ZRE A;  1I6X A;  4G12 A;  1D8K A;  1VQ6 I;  5C4X J;  2VJ5 A;  4JX4 A;  1DQU A;  1YQA A;  2E60 A;  3BPV A;  3KIO A;  3HOS A;  2L9S A;  1MMA A;  2O6G E;  2IVM A;  2IS1 A;  4EJV A;  1J75 A;  4A0Y A;  1IAW A;  1S8N A;  2VJJ A;  2EFQ A;  3BJ6 A;  3L7W A;  1N75 A;  1R36 A;  2EBI A;  1EV7 A;  2XRL A;  5KNL A;  1BR1 A;  2KPM A;  4C3I J;  4HEA 2;  1JKQ C;  4BH9 A;  2H1K A;  2ZC2 A;  2RQQ A;  4G6T B;  2JVH A;  5FLX Z;  2MGQ A;  1Y1W J;  3FHN A;  4I01 A;  2Y0S N;  3NWS A;  2LVS A;  1YG2 A;  2WAD A;  1BI1 A;  1FBQ A;  2KFD A;  2ME6 A;  3O2P E;  4BS9 A;  5IYC J;  1B9M A;  1VQN I;  1Y8Q B;  4LK0 F;  3L1P A;  2DCE A;  2QEX I;  4BEH B;  3IKT A;  2W24 A;  2MFZ A;  2WAE A;  2JUG A;  3HTU A;  3OL4 A;  4XNF A;  2KZV A;  4BJ6 C;  2J5P A;  2XRO A;  2Z3Y A;  4CYD A;  5FLM J;  2DA7 A;  1R58 A;  1ZKG A;  2AQF A;  4NQW A;  4U88 A;  5E1X A;  5E3L A;  2IGO A;  1LVA A;  4RB0 A;  3M3Y J;  3MAJ A;  1B8I B;  3TL4 X;  3GX4 X;  3HHG A;  2XPW A;  1OCO H;  4PJM A;  1W0U A;  5BPI A;  4GDF A;  4RDU A;  1U8R A;  4M3E A;  5LHG A;  5ILV A;  1YJW I;  1IW7 F;  4BDY A;  4KIG A;  3CMA I;  1X4O A;  4D7N A;  2IAI A;  1OJL A;  3ECO A;  3H9G A;  5E8I A;  4XOR A;  3BG5 A;  3VEP A;  3G71 I;  5CVV A;  1KGS A;  3OYD A;  1ENH A;  1AOY A;  1WSU A;  1TTY A;  3ABK H;  2RNJ A;  3H5N A;  3QOP A;  4EJO A;  2Y48 A;  3KEQ A;  3NWT A;  2JSP A;  2HZD A;  3K4L A;  1EH6 A;  4FAS D;  5BQT A;  1OYI A;  5HNH A;  3L2U A;  1IDZ A;  2L7Z A;  4RA2 A;  4QLC U;  2Z9O A;  2BW3 A;  2QSF X;  3RZD J;  3K2A A;  3ZQC A;  2TCT A;  3AG4 H;  2EPF A;  1APL C;  2FOW A;  4G94 A;  3S14 J;  2XGX A;  5EEA A;  1OCT C;  4NDL A;  3TKY A;  2CWE A;  1UZC A;  4M9S A;  2J5O A;  3WTW C;  3ZMV A;  2X1C A;  2FQ4 A;  4FTH A;  2HEO A;  4IKF A;  3QPH A;  3ZQI A;  2ECC A;  2LKS A;  1QRY A;  3GFI A;  2LDU A;  3BOQ A;  1U8B A;  2HVR A;  1WPK A;  1DDN A;  5F1J A;  1FOW A;  4ENM A;  3WTX C;  4XLN F;  1V5E A;  2X6Y A;  2VXD A;  4UB6 C;  4HOB A;  4TV7 A;  5BPD A;  3BQZ A;  1KU9 A;  1FYL A;  2GIV A;  5JLW A;  2KZG A;  3IH2 A;  1USS A;  5HVQ C;  2KLO A;  3F8M A;  3MKZ A;  3DPL C;  5F27 A;  4HF1 A;  4UVA A;  3RKW A;  2OZU A;  1XCB A;  2Q0O A;  5D8K B;  4IO9 F;  4LB6 B;  1JE8 A;  2NNN A;  4Y33 A;  5EGO B;  4AU7 A;  5IP6 A;  3GVA A;  3OYE A;  1EKE A;  2ZJR F;  4CCL A;  1FP2 A;  2P0W A;  1ZK8 A;  3FXR A;  4E7S A;  3OY9 A;  1LQ1 A;  2COM A;  2LNB A;  3TGN A;  2HOT A;  3V42 A;  5TGT A;  2X9D A;  1D1B A;  4G7H F;  2DOE A;  2HFH A;  3ABT A;  4EM0 B;  1FYK A;  3GUD A;  3QPS A;  2HI3 A;  4BQO A;  1I6H J;  2DJI A;  1FP1 D;  1FY7 A;  4YII A;  4IX7 A;  1QHG A;  2AS5 F;  2NVX J;  1WWX A;  5K5R A;  3OYL A;  1W5C C;  4WX9 A;  3OYI A;  2QYO A;  3TOB A;  2DA4 A;  3BG6 A;  1ULY A;  1Y39 A;  2XB5 A;  3G1M A;  3LA2 A;  2NS8 A;  4LGW A;  1NHA A;  4M74 A;  2IBD A;  4IQ4 A;  4I0B A;  3S3M A;  1JTY A;  1A04 A;  2Z16 A;  3FXO A;  2CU7 A;  1U2W A;  3R4K A;  1R5I D;  4KNY A;  1X3U A;  3A01 A;  4B3X A;  3RIR A;  4OOI A;  1B1B A;  3I4P A;  3HIF A;  3EPZ A;  3SZP A;  3L2Q A;  4CDG A;  5B66 C;  2V6E A;  3CP8 A;  4EGY A;  2IEK A;  2CH0 A;  4ANJ A;  4ON0 A;  1UG2 A;  1OPC A;  1SD7 A;  2HS5 A;  3ZR8 X;  1DP3 A;  5LHI A;  2CUE A;  1TW2 A;  1P2F A;  2O8X A;  3ESW B;  1GLN A;  3CF2 A;  1D8J A;  5KAI C;  1ETY A;  2H8R A;  1BW6 A;  1SMT A;  5F1R A;  4HF0 A;  3JAM Z;  5FLX K;  1FOY A;  1K4T A;  4P55 A;  4B4C A;  3S32 A;  5JFR A;  3K4K A;  3ZGK A;  3DP7 A;  3RYR A;  4KIS A;  1BJZ A;  2MAB A;  3BR6 A;  3A03 A;  4A6E A;  4CA0 A;  1I50 J;  1WJA A;  1GV5 A;  3OWT A;  3WU1 B;  4IHT A;  1J0R A;  4C3J J;  3H3V K;  1YHQ I;  3E97 A;  4L9J A;  4LJZ F;  1XGS A;  4JQF A;  4WK8 F;  1YX3 A;  1T98 A;  3P9K A;  5JI6 A;  4DGW B;  2HWV A;  2UV1 A;  3EYY A;  3V8L A;  3ECH A;  1OIS A;  2OQG A;  1TT5 B;  5CYV A;  5K1Y A;  3CCU I;  4BKX A;  5DEQ A;  2CUF A;  2AXL A;  4MEX F;  2DA1 A;  1P9Q C;  2L7K A;  3K1N A;  4XKV A;  5BS6 A;  2XSD C;  2O9L A;  3H9Q A;  1O4X A;  1RC9 A;  2CV0 A;  2RGV A;  2W82 A;  2A6E F;  4Y3O A;  5F08 A;  3H92 A;  1Z7L A;  2NAZ A;  2OJE D;  5IOY A;  4YIF A;  2K4B A;  1ZAO A;  4X0G A;  3TDZ C;  2K9L A;  3K0L A;  2V1D A;  2TDX A;  5JHF A;  4ZYE A;  1H88 C;  3ZN0 A;  2TRT A;  3P9C A;  1K83 J;  4BE0 A;  3BZC A;  3V8J A;  1YRN A;  5KVR A;  4S0H B;  2E19 A;  4FQG A;  3COA C;  3LSK A;  3OS1 A;  4R79 A;  3CC2 I;  4CYC B;  2FXA A;  4XM3 A;  1JKP C;  1X3W B;  2VQL A;  5J8C A;  3X2Q H;  4U7B A;  5EZH A;  1A31 A;  4WCG A;  1X3Z B;  1R22 A;  3ZMD A;  3TO7 A;  1FOK A;  1K4S A;  3OIQ A; 
#chains in the Genus database with same CATH homology
 1CQT A;  1WCM J;  2R0Q C;  2Y9Y A;  3BQY A;  3I4N J;  2JJ7 A;  1FEX A;  1D5Y A;  1TC3 C;  3FKI J;  4AYB N;  4X1E A;  3Q0V A;  2OF7 A;  1DU6 A;  2PMZ N;  4MO7 A;  1P7I A;  3GTP J;  1MH3 A;  2HDD A;  1RKT A;  3NAU A;  1GV2 A;  2E2I J;  4Y7N J;  3TED A;  4A3L J;  5E3M A;  3M4O J;  2KT0 A;  3LSJ A;  3BTC A;  3GTK J;  1ETO A;  1MH4 A;  1H89 C;  2DMQ A;  2WAQ N;  2M8G X;  1OFC X;  3HGY A;  1QPI A;  2P81 A;  1JJ6 C;  3S16 J;  2JA6 J;  1LFU P;  5J1U A;  3HM5 A;  2YUS A;  2VPR A;  1JJ8 C;  2COB A;  3H0G J;  4M3G A;  4MFE A;  1Z0X A;  2WB1 N;  4D5C A;  4XRM A;  2NVT J;  5HOD A;  4DZP A;  1EF4 A;  3I4M J;  3OSG A;  2K40 A;  1VND A;  2EQR A;  1MBK A;  3BTL A;  1LFB A;  3SDG A;  3RZO J;  2HYJ A;  2JA8 J;  2FD5 A;  3OSF A;  3IH3 A;  2M9H A;  3IH4 A;  4W97 A;  3OIO A;  5FKK A;  4IHW A;  2XGE A;  5M5W J;  2O8K A;  1ETW A;  2XGC A;  3PM1 A;  4QSH A;  1MSF C;  4FCY A;  1SAN A;  1H8A C;  3S2H J;  3JRF A;  3S17 J;  4A3I J;  5K7H A;  3JRD A;  4A3F J;  3B6C A;  1A6I A;  3BG9 A;  3RQI A;  5IP7 J;  3S1R J;  4UUT A;  5M5Y J;  1IC8 A;  1XG1 A;  3C2B A;  2QCO A;  2XB0 X;  2MG4 A;  1PUF A;  3LSR A;  3Q3S A;  3LNQ A;  2DMN A;  1HDP A;  3JR9 A;  3GTJ J;  4A3G J;  1E3O C;  4L5E A;  2K9Q A;  1MBH A;  1W0T A;  5IYB J;  2DN0 A;  2VUM J;  2HOS A;  1NK3 P;  4A3D J;  1SFO J;  1GUU A;  4XRS G;  3GTG J;  1X58 A;  3VPR A;  3JRG A;  3JRB A;  3JRA A;  2JK3 A;  5FKL A;  3CQZ J;  1IGN A;  3DCF A;  2NOG A;  1Q1V A;  4CYC A;  4UUS B;  2EZL A;  2DA5 A;  3LSP A;  4AUX A;  1S7E A;  2ID3 A;  2CQQ A;  2O7O A;  4X6A J;  3HOW J;  4AC0 A;  3WHC A;  1ITY A;  2VI6 A;  1DU0 A;  1IV6 A;  2CJJ A;  3ZQL A;  3G1L A;  3IV5 A;  1IG7 A;  1A5J A;  2X48 A;  1MNM C;  3Q0W A;  3GTQ J;  2HXO A;  4XIC A;  3LOC A;  3BR2 A;  2VKV A;  2E2H J;  2GM4 A;  5FKM A;  1AHD P;  5FJ8 J;  3CCY A;  4BY1 J;  4A3J J;  1T56 A;  2DMT A;  2ID6 A;  5BNG A;  2RAE A;  2R5Z B;  1K61 A;  1TWG J;  1JGG A;  2YU9 J;  2GLO A;  5F04 A;  4A69 C;  1WI3 A;  1GVD A;  4IHV A;  4IHY A;  4G12 A;  5J3L A;  2K9S A;  3HB9 A;  5C4X J;  4JX4 A;  4QTR A;  1MBF A;  4JX6 A;  3FK7 A;  1POG A;  1FIP A;  2ME0 A;  2Y2Z A;  1IRZ A;  3BG3 A;  3MVP A;  3MKL A;  1IDY A;  4D7M A;  3G1O A;  3JRH A;  2L7F P;  3B6A A;  2EBI A;  2XRL A;  1ETK A;  3HOU J;  1F36 A;  4C3I J;  1JKQ C;  2H1K A;  2M0C A;  2LP0 A;  4J19 A;  3JRE A;  1Y1W J;  2MGQ A;  4DW6 A;  3GTM J;  4BY7 J;  3Q0U A;  3HBL A;  1FTZ A;  3HOV J;  2Y0S N;  1TWF J;  2LVS A;  4DYR A;  5FLV A;  2DA3 A;  2G0E A;  4M6V A;  2ME6 A;  2QF7 A;  5IYC J;  3PO3 J;  1HOM A;  2DMP A;  3L1P A;  1FIA A;  2YS9 A;  2L0K A;  3HOY J;  5C4J J;  5FLM J;  2DA7 A;  2JMW A;  1F43 A;  1ZKG A;  3W6V A;  1MBG A;  2X6O A;  2DMU A;  5E3L A;  1P7J A;  1JTX A;  3M3Y J;  5C44 J;  2LR8 A;  2GBY A;  3BTI A;  3K7A J;  1B8I B;  1BL0 A;  3GTL J;  4DYC A;  1AU7 A;  2EH3 A;  2XPW A;  1B72 B;  2DTZ A;  1Z77 A;  3S1Q J;  1W0U A;  4LOC A;  3NAR A;  4RDU A;  3BR1 A;  3A02 A;  3TW6 A;  4M3E A;  5IP9 J;  4MIM A;  2NVY J;  2XGD A;  5GPC A;  3A01 B;  2FX0 A;  1RR7 A;  4D7N A;  2IAI A;  1RKW A;  1OJL A;  3JRI A;  2R93 J;  1JT6 A;  2LTP A;  3BG5 A;  2I10 A;  1TWA J;  1ENH A;  1IJW C;  4UUS A;  3HKZ N;  1NTC A;  1VFC A;  1HDD C;  3DEW A;  5K7Z A;  2WV1 A;  5GP9 A;  1ZGW A;  3ZQF A;  2R92 J;  1IDZ A;  3S15 J;  2L7Z A;  3RZD J;  3K2A A;  3ZQC A;  2TCT A;  1APL C;  3S14 J;  2DA6 A;  2M2E A;  3TW7 A;  5EEA A;  1OCT C;  4NDL A;  1T33 A;  2FQ4 A;  4FTH A;  2LKX A;  3ZQI A;  2ECC A;  9ANT A;  4XID A;  4A3K J;  4I6Z A;  1QRY A;  3BR5 A;  2LK2 A;  2R7Z J;  3SFI A;  1TWH J;  1U8B A;  1RPW A;  1WPK A;  2JN6 A;  4V2G A;  5F1J A;  5M5X J;  2R5Z A;  2XPV A;  3QPL A;  4XK4 A;  3QQA A;  1WH5 A;  4A3E J;  3S2D J;  5M3F J;  1ETV A;  4EEF G;  2LY9 A;  1GT0 C;  1NK2 P;  2NVQ J;  3S1N J;  1HF0 A;  3BQZ A;  1TWC J;  2LFB A;  5JLW A;  2LD5 A;  3IH2 A;  4FE7 A;  1ZTR A;  4B1R A;  5J1R A;  2E2J J;  1HLV A;  4MLO A;  5F27 A;  3ZOB A;  2OPT A;  4M3F A;  5DTD A;  1UHS A;  1RES A;  4A3C J;  1AKH B;  4A3B J;  5EGO B;  5IP6 A;  1R9T J;  1JUP A;  2EZH A;  3ZQG A;  5EF6 A;  1JKR C;  3O8H A;  1JUM A;  1ZK8 A;  2XPU A;  4JYK A;  5F0F A;  2HOT A;  5EYR A;  5F0C A;  3RKQ A;  2X9D A;  1U78 A;  2AHQ A;  4BXX J;  1HCR A;  2L9R A;  3OOU A;  3QPS A;  2HI3 A;  1VI0 A;  1I6H J;  1X2N A;  1LE8 B;  4RBO A;  2R5Y B;  3GTO J;  2JWT A;  3LSG A;  2NVX J;  1IUF A;  4C2M J;  3SJM A;  1YRN B;  5EDN A;  2DA4 A;  3PO2 J;  4A3M J;  2XB5 A;  3G1M A;  2MSY A;  3JRC A;  1B8I A;  2NS8 A;  5J1Y A;  1ZQ3 P;  1B72 A;  5IYD J;  2IBD A;  1GDT A;  1JTY A;  5E3O A;  2CU7 A;  4M3B A;  5K7F A;  1JUS A;  3CMY A;  2JA5 J;  3A01 A;  2Y9Z A;  3HOX J;  2DA2 A;  4Y52 J;  3GBG A;  5IOZ A;  1ZR2 A;  4JX5 A;  2IEK A;  3CDL A;  3D1N I;  5EZG A;  2B63 J;  1UG2 A;  5FKO A;  2W48 A;  4W1U A;  4C3H J;  4V2F A;  2CUE A;  4QIW N;  4XRS A;  5EG0 A;  1UMQ A;  2CRG A;  4BBS J;  1FJL A;  2VKE A;  3TP0 A;  1XS9 A;  3BTJ A;  2KDZ A;  1JKO C;  3TP3 A;  1ETY A;  2H8R A;  1BW5 A;  1BW6 A;  2JA7 J;  2M34 A;  2N8G A;  1ETX A;  2K9N A;  4B4C A;  1XC5 A;  1ORK A;  1WGX A;  1BA5 A;  4DYQ A;  2ZB9 A;  4HNV A;  1BJZ A;  4A93 J;  3BR6 A;  4B3A A;  2AO9 A;  3A03 A;  5FKN A;  5EG0 B;  1I50 J;  1GV5 A;  2EZK A;  2ECB A;  3HOZ J;  4M3D A;  1MBE A;  2MW8 A;  4C3J J;  3H3V K;  3FIS A;  5E3N A;  3HDD A;  1FTT A;  4FE4 A;  1ZR4 A;  1VF9 A;  3F0C A;  3FIW A;  1U9N A;  4ABZ A;  4FIS A;  2LLK A;  3BR3 A;  3ZQH A;  5C3E J;  4BKX A;  2CUF A;  3S1M J;  5F0H A;  2DA1 A;  2EZI A;  4I76 A;  2E1O A;  1MSE C;  5IPA A;  2Y30 A;  5M3M J;  4BBR J;  2HXI A;  1ETQ A;  2XSD C;  1AKH A;  2O9L A;  1O4X A;  2FJ1 A;  1QVT A;  1U9O A;  3WHB A;  5EGO A;  4IEJ A;  1X2M A;  2Y31 A;  3O8G A;  5F08 A;  1Y1V J;  2NS7 A;  1PUF B;  1I3Q J;  1QVU A;  2L7M P;  4D5F A;  1MBJ A;  3HGG A;  5IOY A;  5GPA A;  4MFD A;  2DJN A;  2HOA A;  5JLX A;  3HEF A;  3UKG A;  3BT9 A;  1G2H A;  1H88 C;  3FK6 A;  4GFB A;  4DZJ A;  1LE8 A;  2R5Y A;  5DS9 A;  2TRT A;  1K83 J;  4IHX A;  4JP0 A;  1YRN A;  2ELK A;  4S0H B;  2E19 A;  2CQX A;  1RET A;  4CYC B;  1WH7 A;  3E7L A;  1JKP C;  1OCP A;  5EZH A;  1JT0 A;  2HQ5 A;  2D5V A;  3MN2 A;  3BR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...