2K9YA

Epha2 dimeric structure in the lipidic bicelle at ph 5.0
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
41
structure length
41
Chain Sequence
b'EFQTLSPEGSGNLAVIGGVAVGVVLLLVLAGVGFFIHRRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 2
publication title Left-Handed Dimer of EphA2 Transmembrane Domain: Helix Packing Diversity among Receptor Tyrosine Kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 10
structure length 41
sequence length 41
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2k9yA00
4IL6X 2ZT9B 2WPVB 2YIUC 4KT0J 4PV1B 2D2CB 2K9YA 2E75B 2QJKC 4H44B 2O01J 2FYNC 5KKZC 4I7ZB 4OGQB 4RKUJ 2WSCJ 1Q90D 5KLIC 1VF5B 1S5LX 2QIWA 4Y28J 2QJPC 2WSEJ 1ZRTE 2E74B 4H0LB 1JB0J 3C8VA 3LW5J 2WSFJ 2E76B 2QJYC 2QSIA 4H13B 5L8RJ
chains in the Genus database with same CATH superfamily
1FAVA 2KB7P 4WY4A 3L4FA 4QMAA 2FYUE 1SQQK 3CWBG 2L91A 2P1JA 3RL0D 1RF1A 1SVFA 2R3SA 4XFJA 3RK3B 3Q5RA 1VF5B 1T3UA 3KQGA 3HRNA 3AECC 2Q7CA 1SQVK 1GU4A 1X22A 4IL6X 2YKQA 1T3JA 1YJ9P 1RQVA 1NTKE 5AVSB 3H1JJ 1JY2N 3B5NB 4Y99B 5KAFH 4GOFA 1KMIZ 2JKVA 3PHLA 2YXQB 1RQUA 1OVRA 3WU2E 4N6JA 1AV1A 1J1DB 1KYOI 4I7ZC 5AVVB 1ZOYC 5AVTB 2N1TB 1NGMB 1YJWP 3AE2C 3H1HG 1TU3F 3V2QA 2ITAA 2Q6QA 2HR3A 2W6BA 4HKZH 3M9BA 3TYYA 1SS1A 4I6MC 3AE8C 1BGYE 1ZXGA 3CCUP 2GUVA 1SFCA 1NTKD 4W7ZA 5CCHD 2OYOA 3CWBD 1QX8A 3CCVP 2E42A 2W27A 2B87A 3M0DA 4AYCA 3CWBJ 1Q82Q 2M3BA 3FX0A 1L4AB 5H2FE 4IFMA 2ZVOB 2Z5HA 3MD0A 1N8RQ 4PD4E 1J1EB 3L37A 1FZFA 3TGUG 3BATA 5KLVK 3V4WA 1IJDB 3MUDC 4YTPC 3GF3A 3CXHH 1YIJP 5APXA 1M8OB 2QJYB 4L74A 1S5LE 4HJGH 1XTCC 1KILC 3GHGA 1PV3A 3R4YA 3I56P 3NTNA 4O9BA 3KZIH 4NPEA 2KS1B 5B5EH 4ZKUA 1KQGB 1GL2A 4PJ0H 1IFMA 1W2EA 2ZT9D 2R5BA 1IK7A 3L74G 3H1HJ 1GW3A 3GHGC 3KPEA 3BASA 2KSJA 1LP1A 2H43A 3D71A 1SQBE 4U3FG 1SQQG 2YNYA 4MN4C 4IFDK 2HFED 3SFDC 3L70E 1EDIA 2CPSA 3VP8A 3CD6P 3FWNA 4ZMDA 1SQPK 2HODA 3PJSK 3F5HA 1CW5A 3RL0C 1KQSO 2WMMA 4GOEA 2RMZA 3L36A 3EFFK 3CLQA 2JWAA 4EYYQ 2M8RA 3D6YA 1KB9I 4OGQD 2OYHB 1L0LK 2QJKC 3TGUJ 4I7ZB 3L71E 5AVQB 5KJ7A 2Y0DA 4IOIH 3QWOC 4HYTB 3M91A 3B71A 1LWUA 2FFDA 2E74C 4PV1B 1USDA 1H88A 2IDBA 1SLQA 1EQ7A 1ZV8A 1DD4A 5KJ7C 1LTIC 1N7SC 3L74D 4DOJA 3H6PA 3AEBC 3L70D 1LTAC 3WMM0 2WPVB 2KIKA 2E5YA 2M5AA 3TSIA 3L74J 1YTZT 3CCQP 3HE5A 1OVVA 2L5GB 1LTJA 1YHQP 1AVYA 2OYIA 1BCCE 1VQ7P 1RY3A 5GTHE 3H25A 2ZVNB 3L71D 4U3FJ 1SQQJ 2W6AA 3U1AA 5CCHC 5AW0B 1GTWA 2WSSH 1QL2A 2IYPA 1S5LX 2WTYA 4H13D 3Q3DA 3MTUE 5KLVG 5L8RJ 1KILB 4WBAA 3H1IE 3L72D 1AQTA 4EIJA 1LNQA 4I2LC 2VRSA 1NOHA 1NTKK 4L73A 1PGOA 2H88C 5EFWB 3RK2D 4KJMA 3G9RA 1N73A 4NPFX 2J59M 1OW7A 1DD3A 2QVAA 1JY2P 1P84E 5APQA 1SQXE 1KN7A 1N86A 1EZVI 4EOTA 3E7KA 2IBZE 2I1KA 5TISH 1BCCD 2C9NY 2WSCJ 1BSNA 4JPZB 3MHVA 1FZCB 1FZAA 2E76D 1PGQA 1LT9C 1T6AA 4R4LA 4D6TD 2PP6A 2GA1A 3FXDA 2E43A 2KSEA 2A45G 4LLHA 4OH8B 2W83C 3RL0B 2N1TA 3H1ID 3H1LG 3B5NC 3CX5H 4Y99C 3NFQA 1ZR4A 1EDLA 1WRGA 2RH0A 2ZFCA 2HPCB 1FBMA 2POHA 2QJKB 2IBZI 3MGNA 2B9BA 2C0WA 1OW8A 1IO4A 2KUBA 1J1DC 1P84D 4H0LD 2N1TC 1SQXD 1QLED 2XNXA 1L0LG 2Y0CA 2K1AA 5KAFE 1IZNB 3OA7A 4DZOA 5KLVJ 4L76A 2BEZF 5B66H 1HGVA 1W5CE 1L4AA 3L35A 1HVVA 1SP4A 3N7NA 3A0HE 3AEAC 2WSCH 1VQNP 2Y9ZA 4YPCA 2ZXXA 1H0TB 1AFOA 1URQA 1YYCA 2QJPC 1JY3N 3B4SA 1VQPP 1YQ3C 5BU8B 1FZEA 2D2CD 2I8DA 1J1EC 2LXCB 2QG4A 3P8MC 1MFTA 2KS1A 3L73G 1VL2A 1RE4A 1MV8A 1JOCA 5CCGA 3E1RA 1A02J 3H1LJ 2QJYC 4M3LA 2WT7B 2R44A 1VQ4P 2WITA 2ZXEB 2IFMA 3V6IA 2XDJA 1JB0J 1KFNA 1U7JA 1NTKG 1OMIA 1L0LJ 4C7NA 1Q7YQ 1KYOE 2KNCB 5TJHA 2C0XA 1JM0A 1JTHB 3GW6A 1CZQA 1LT9B 1AA0A 3O6QA 4IL6H 4RO0A 3RK2C 2YIUB 2AEFA 1L0NE 2ZT9B 1T2KD 3JCUH 2OYHA 1N2DC 4RKUJ 4KHXA 3OW2O 1DIPA 4B86A 5E79E 3CXHI 4K35A 2AXTE 2R3CA 2A45H 4UB8E 2FYNB 1DH3A 5APYA 1KD1Q 3D70A 1NYHA 4DT0A 3LIEA 4NPDA 3L73D 2OYHC 1BGYG 1M90Q 2KK7A 1M7LA 1NAYA 3T97B 1NTME 3AE4C 5CBNA 3L73J 4C7RA 1N7LA 2FYUD 2FKWB 2AEJA 1JUNA 1KYOD 2ZYGA 2M0BA 3ZDMA 1G2CA 4PV1C 4OGQB 2YKPA 2UWJE 1BDCA 2IFNA 1L0ND 1VPCA 3KDPB 5AW4B 3M9QA 4H0LC 3CC2P 2Z5IA 3AE9C 3CCSP 3Q5PA 4KT0J 1JCCA 1JY2O 1M1JC 1NTKJ 3MUDA 1EDKA 1GK6A 2WVRA 2OTLP 2QJPB 4N78E 3RK3E 2XU6A 1AQ5A 2NRGA 3H1HE 2BASA 2P10A 3CC4P 1JO5A 1KILA 1RH5B 1SQXK 2JO1A 1NTMD 3HD7D 5KKZC 2GM4A 3Q5SA 1IFPA 3V2RA 3WUVA 1YI2P 3P32A 4DCKA 4JBZA 1FC2C 2IZ0A 2A06E 3N4XA 1LTSC 1BGYD 2O1KA 2FYZA 3CCEP 3U1CA 2KXPB 1HJ0A 1E79H 3OAKA 4JYCA 1BGYJ 3VMAA 1IC2A 5APVA 1T8ZA 1FZCA 1X79B 3A0BE 4H13B 3L70G 1KB9E 1VQLP 1VF5D 3S1KA 4ASVA 1HH0A 4C46A 4PD4D 3W68A 1VQKP 3NMDA 3RK2B 1FZCC 3SWFA 2HPCA 3GMAA 3L71G 3AEEC 2A06D 3OJAB 2QRXA 2QA4P 3WU2H 2BCCE 1GU5A 1HUCA 2E76B 1M56D 2E75D 2FXOA 1FZBA 1VDFA 2K9JA 3L72G 4LC1A 1T2KC 1H8AA 1BE3E 2V7QJ 2ZJSE 4GIFA 3A2AA 1YQ4C 1N7SA 1LJ2A 4UB6E 4ASWA 1ZMEC 1OFCX 1JY3P 5CMZA 1NTZE 5AVRB 2HLOA 2AXCA 1AVOA 1H0TA 5KLIB 2Q5UA 1SQBD 1BCCG 3G71P 4YXDC 3CCLP 1SQVE 1VQ8P 4H0LB 3ITKA 2Q3IA 1YBKA 2WSFJ 2K88A 1M1JB 5H2FH 3CMAP 5CCHA 1GD2E 4D6TG 1AJYA 3L70J 2BCCD 4PD4H 1YJNP 3AEFC 3C1LA 5GTIE 5APWA 1Y8AA 4W80A 3H1IG 2K37A 2Y9YA 2FY8A 3CI9A 3CX5I 1NU1E 4H44D 1URQD 1BE3D 2Q3EA 2WT7A 3MIWA 3VMZA 5KKZB 2FYUK 1EZVE 3TK1A 3RBZA 1S5LH 3L71J 2XV5A 5AW1B 2J58A 1HBWA 1NTZD 1M57D 2ZYAA 3BCCE 3H1KE 1SQXG 1VQMP 2WQYC 2RN0A 2IBZG 2V7QH 5AW7B 1L0NK 1YTZI 3AE5C 2D2CB 2B87B 1ZLLA 1SQVD 5CJ4A 3L72J 2QM8A 3UIAA 5CCGD 3HD7C 2KNCA 1M1KQ 5KAIH 1JTHA 1LT9A 1MFZA 2W8ZA 1FU1A 4K3AA 3JSVC 2NPSD 3S4RA 3PRJA 2WSFH 1G1JA 1MUUA 2WZ7A 3B5NA 1NU1D 1OWAA 1BCCJ 4WY4D 1EZVD 1LTGC 1IFIA 2YIUC 2ZT9C 1UIIA 1PP9E 2O01J 3V5BA 3BCCD 3H1KD 1Q90D 1QVGO 4D6TJ 3TNUB 3AE1C 3H1IJ 3VYIA 1FE6A 1FS0E 2IPPA 2K3RA 2FYNC 4R4MA 3SFEC 2W6JH 1USEA 1X9VA 3LW5J 2IBZD 2YO2A 3NXSA 3L75E 4RJTA 1SQXJ 1KILE 2H89C 3VMYA 1ZP0C 2E75C 3K5BA 4OGQC 1EXIA 1Q86Q 1DEBA 1GW4A 3G4SP 1PP9D 5APSA 3IFMA 1RHZB 3BRTB 2R32A 3LIDA 5AVUB 3SWYA 1NH4A 1FZGA 3PP5A 1SQPE 1ZR2A 1FDIA 2MJZA 5GTHH 3WUUA 1SFCD 4BXLA 2HG5D 3U59A 1FDMA 1R8EA 1KQLA 2O01H 1PFIA 1Z56A 3CCJP 4CPGA 3PH0A 1R5LA 4W7YA 3CMEP 2W90A 2A45I 1KV4A 1OVUA 4WB4A 4XE5B 2WSEJ 3L75D 2Y0EA 3IN6A 1OW6A 1DEEG 1SQBK 2FYUG 1KTMA 2M5AB 1Y9BA 5AVZB 1ZW0A 3LW5H 3H1JE 3BVHA 4H44C 3AE6C 1JMMA 1LTJB 1X0TA 3HD7B 1OZHA 1P84H 3M0AA 1PL5A 1FOSF 2OYIB 2PAJA 1NHLA 2KLUA 1L0NG 2JDIH 2OTJP 4BRYB 1SQPD 4U7JA 3CXHE 1KORA 2G3AA 3G6EP 1CI6B 4H13C 2K9YA 3CL3D 1JY3O 1GL2D 3A7OA 4JF7A 3KZIE 2P7JA 1KC8Q 5AVXB 5B5EE 1HJBA 1VQ6P 3PLNA 4PJ0E 1VQ5P 1PPJE 3FGAD 5BVZA 1NTZK 2NPSC 1NTMG 1NAFA 1N73B 1JCDA 2V4HA 3EFGA 1NJIQ 3H1JD 3FWLA 2Q1KA 1K04A 2KZIA 2E76C 3P8CE 4WY4C 2WSEH 3AE7C 4AQRD 4DJGA 3CWBE 3USSA 1RF1C 1Y47A 1OXZA 1G1IA 3CXHD 2E74D 1QL1A 1JMBA 3KXDA 4OWFA 1M1JA 4TLFA 1NU1K 2E75B 2FYUJ 5AW6B 3EQ2A 1LTTC 5KJ7D 1U57A 3HE4B 3A0HH 1H89A 5KLIC 1N7SD 1U7MA 3BRVB 2WPQA 1K05A 3C9IA 5AW9B 1S9KE 1PPJD 1NKNA 3M9HA 2PGDA 1PGJA 1L0NJ 3AE3C 3V2NA 3H32B 2A06G 1ZRTE 3P8CD 1LGHB 1BSHA 3CCRP 2P58A 1JNMA 1OX3A 2OTKE 2NZ2A 2PFXA 5DJUB 2QE7H 1GZLA 1NTMJ 1SFCC 4EDFA 3HTKB 3HUSB 1WT6A 1IK9A 3WUTA 1FOSE 3P7KA 4H44B 1URQB 2D2CC 3ABVC 3M0DC 1S9KD 1PGPA 3A5TA 3TDKA 2AEMA 2MKVA 2CPBA 1S4XA 1SQBG 1S3JA 4RESB 4JYBA 1HTLC 1KYOH 1DX7A 3II6A 5AW8B 1GK4A 3TGUE 3RBXA 4N78D 3RK3D 2QM7A 3V4QA 1ZRTD 4N3YB 2KYVA 1K73Q 3H1HD 5AW2B 4JQ0D 2BCCG 5KTBA 3TNUA 4I1LA 5C39A 2YMYA 4PD4I 2JWDA 2WPRA 2KI7B 1XTGB 5KAIE 1IFDA 3F89A 2RKLA 2NPSB 5E79H 1BDDA 4HB1A 1BE3G 3VOPA 3B5ND 2AXTH 1IFNA 4BWNA 3W67A 1GL2C 4UB8H 1PZQA 1KFMA 5TISE 3JC22 1NTZG 2O3JA 1VQOP 2QSIA 5CBOA 4WY4B 1ZN5A 4C7NB 3L74E 1X8YA 1RF1B 2B88A 2N1TD 1SQVG 4WWIA 1UIXA 2QIWA 2OQQA 3V2PA 2HYNA 3RL0g 3A3YB 3O6QB 3PTZA 2JEEA 3TGUD 1KB9D 3GG2A 3IF4A 4U3FE 1GDTA 1SQQE 3CX5E 1HWTC 2LXBA 1NVOA 4YXWH 4AUWA 2P2UA 2JR8A 4Y28J 3SSUA 2WPSA 4GODA 5DJTB 1NU1G 1SQBJ 2YXRB 3VN0A 1K8AQ 1EZVG 1A02F 3L72E 3TF5A 1L4AD 2JP3A 1WMKA 3BCCG 3EWKA 3H1KG 3VMXA 1MKMA 2BEQD 3MZWB 1LWUC 4WVZA 2BCCJ 2FFDC 5B66E 1S1CX 3I55P 3KHUA 1G2CB 1D7MA 2R5DA 3IR9A 2QEXP 1LTBC 4IFFA 2B89A 2XZRA 3HD7A 1BE3J 1LT1A 4U3FD 3QH9A 1SQQD 1SFCB 2IYOA 3CX5D 4BRYA 5APTA 1PIXA 1CSBA 1CI6A 1NTZJ 5AVWB 3GLMA 3S9OA 2I1JA 3A0BH 1NO4A 4D6TE 2YO3A 1L2PA 2FXMA 1LTJC 3CCMP 1SQVJ 1KB9H 3AEDC 2LKMA 2OYIC 1YITP 2ZYDA 5AW5B 3RGUA 1J2JB 1PP9G 1E5WA 2ZAEB 2GUSA 2Q9IA 4GT1A 2YMKA 3B8EB 1NTMK 2PRRA 5M1BA 2FXPA 3GHGB 3D6ZA 2IZ1A 5CJ0A 1NU1J 2OGUA 5KLVE 4EI2A 2LR2A 1KZUB 1R5SA 1GL2B 1QEXA 3RK3C 1VF5C 3SWKA 3T97A 2G8YA 1N73C 3FXEA 2KLVA 3BCCJ 3L75G 3H1KJ 3MP7B 3GF7A 4IL6E 2XNDH 5CHXA 3HE4A 4UB6H 1LP1B 3M06A 3G3ZA 3JCUE 1K9MQ 3CC7P 3C8VA 1P84I 2J5UA 4PV1D 2M3EA 4TT3H 5K5GB 3CPWO 1SQPG 4OVNF 3H32A 2H8PD 1S2EA 2HODB 2OARA 1MZ9A 1EC5A 3E1IA 1IFJA 3IAOA 3O8ZA 2E74B 3VP9A 5KLVD 1NKZB 3VTPC 2CK3H 3H1LE 2WWWA 2K9JB 1KQFB 2JJLA 5GTIH 1GMJA 1PP9J 3KYQA 5BU5A 2E5TA 1N7SB 1JEKA 1LWUB 4A7PA 4ZNCA 1Q2NA 2SPZA 2FFDB 1RF0A 2N9BA 1HF9A 3HTKA 2O1JA 3HUSA 3H1JG 1L0LE 3Q2YA 4LGDE 4HH2A 1RE3A 1EDJA 1W2BO 1L4AC 2KZJA 1KILD 2O01N 1RF0C 2N9YB 1HGZA 2P67A 3HUSC 3L75J 2DW3A 1FJPA 1VQ9P 3HE5B 1Q81Q 1URQC 2H7HA 3H1LD 3R2PA 2Z4EA 4GKGA 1S72P 1RE3C 3AEGC 4XA4A 1QVFO 1QGKB 4L75A 1EXJA 1PPJG 5AVYB 4Z1MH 2IX7C 2KP8A 5AW3B 2FBWC 2NPSA 1SQPJ 3Q1MA 2YKOA 1OIPA 1NWQA 4ZKPA 4GDOA 2KOGA 1FJKA 5APUA 1RE4C 3L73E 1L0LD 2C9LY 5CCGC 1FDOA 2XKMA 3I5CA
chains in the Genus database with same CATH topology
1K04A 2E76C 2YIUC 1KQFB 2ZT9C 1GMJA 4H44B 2O01J 1VF5D 4PV1C 3SFDC 3AE7C 1AJYA 2D2CC 3ABVC 4OGQB 1OW8A 4XFJA 3Q5RA 1Q90D 1VF5B 3AEFC 1S5LX 4Y28J 2MKVA 2YMKA 2E74D 4H0LD 2WSEJ 3AECC 3IN6A 1OW6A 1JB0J 4H13D 3AE1C 1HF9A 4H0LC 3Q3DA 5M1BA 5L8RJ 1KTMA 4IL6X 3AE9C 3D6YA 2FXPA 3Q5PA 4H44D 4KT0J 1Y9BA 3D6ZA 1OMIA 3Q2YA 1RQVA 3GMAA 4OGQD 2E75B 2QJKC 4R4MA 2FYNC 4I7ZB 1U57A 3AEEC 4H44C 2BEZF 3SFEC 3AE6C 4YTPC 5KLIC 3GF3A 2JP3A 2H88C 1WMKA 1PL5A 1VF5C 1K05A 3RK3E 3EWKA 3G9RA 1MKMA 2G8YA 1KMIZ 1OW7A 3B71A 3O6QA 2BEQD 3LW5J 3AEAC 1DD3A 4U7JA 1RQUA 2E76B 2E74C 2P10A 1KORA 1S1CX 2G3AA 2WQYC 2ZT9B 2E75D 3AE3C 3AE5C 4PV1B 4H13C 1PV3A 3GF7A 3R4YA 1KILE 2D2CB 2K9YA 2H89C 2JO1A 1ZP0C 2IDBA 2E75C 5KKZC 3Q5SA 4RKUJ 2WSCJ 4I7ZC 1KQGB 4OGQC 1ZOYC 1EXIA 2V7QJ 1NGMB 1DD4A 1DIPA 2QJPC 3AEGC 1ZRTE 3AE2C 1YQ4C 2E76D 3C8VA 1TU3F 2ZT9D 1YQ3C 2J5UA 3AEBC 1EXJA 2QSIA 4PV1D 1IK7A 4R4LA 1ZMEC 1PIXA 2D2CD 4TT3H 4Z1MH 2WPVB 3FGAD 3GLMA 3D70A 2FBWC 3S9OA 1NYHA 1FDIA 3Q1MA 2NZ2A 1HJ0A 1UIXA 3T97B 2QIWA 3AE8C 1VL2A 2OQQA 4GDOA 4YXDC 3RL0g 3AE4C 1R8EA 3IAOA 3AEDC 2E74B 4H0LB 3D71A 1FDOA 2WSFJ 2QJYC 3H25A 4H13B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL6 X;  2ZT9 B;  2WPV B;  2YIU C;  4KT0 J;  4PV1 B;  2D2C B;  2K9Y A;  2E75 B;  2QJK C;  4H44 B;  2O01 J;  2FYN C;  5KKZ C;  4I7Z B;  4OGQ B;  4RKU J;  2WSC J;  1Q90 D;  5KLI C;  1VF5 B;  1S5L X;  2QIW A;  4Y28 J;  2QJP C;  2WSE J;  1ZRT E;  2E74 B;  4H0L B;  1JB0 J;  3C8V A;  3LW5 J;  2WSF J;  2E76 B;  2QJY C;  2QSI A;  4H13 B;  5L8R J; 
#chains in the Genus database with same CATH topology
 1FAV A;  2KB7 P;  4WY4 A;  3L4F A;  4QMA A;  2FYU E;  1SQQ K;  3CWB G;  2L91 A;  2P1J A;  3RL0 D;  1RF1 A;  1SVF A;  2R3S A;  4XFJ A;  3RK3 B;  3Q5R A;  1VF5 B;  1T3U A;  3KQG A;  3HRN A;  3AEC C;  2Q7C A;  1SQV K;  1GU4 A;  1X22 A;  4IL6 X;  2YKQ A;  1T3J A;  1YJ9 P;  1RQV A;  1NTK E;  5AVS B;  3H1J J;  1JY2 N;  3B5N B;  4Y99 B;  5KAF H;  4GOF A;  1KMI Z;  2JKV A;  3PHL A;  2YXQ B;  1RQU A;  1OVR A;  3WU2 E;  4N6J A;  1AV1 A;  1J1D B;  1KYO I;  4I7Z C;  5AVV B;  1ZOY C;  5AVT B;  2N1T B;  1NGM B;  1YJW P;  3AE2 C;  3H1H G;  1TU3 F;  3V2Q A;  2ITA A;  2Q6Q A;  2HR3 A;  2W6B A;  4HKZ H;  3M9B A;  3TYY A;  1SS1 A;  4I6M C;  3AE8 C;  1BGY E;  1ZXG A;  3CCU P;  2GUV A;  1SFC A;  1NTK D;  4W7Z A;  5CCH D;  2OYO A;  3CWB D;  1QX8 A;  3CCV P;  2E42 A;  2W27 A;  2B87 A;  3M0D A;  4AYC A;  3CWB J;  1Q82 Q;  2M3B A;  3FX0 A;  1L4A B;  5H2F E;  4IFM A;  2ZVO B;  2Z5H A;  3MD0 A;  1N8R Q;  4PD4 E;  1J1E B;  3L37 A;  1FZF A;  3TGU G;  3BAT A;  5KLV K;  3V4W A;  1IJD B;  3MUD C;  4YTP C;  3GF3 A;  3CXH H;  1YIJ P;  5APX A;  1M8O B;  2QJY B;  4L74 A;  1S5L E;  4HJG H;  1XTC C;  1KIL C;  3GHG A;  1PV3 A;  3R4Y A;  3I56 P;  3NTN A;  4O9B A;  3KZI H;  4NPE A;  2KS1 B;  5B5E H;  4ZKU A;  1KQG B;  1GL2 A;  4PJ0 H;  1IFM A;  1W2E A;  2ZT9 D;  2R5B A;  1IK7 A;  3L74 G;  3H1H J;  1GW3 A;  3GHG C;  3KPE A;  3BAS A;  2KSJ A;  1LP1 A;  2H43 A;  3D71 A;  1SQB E;  4U3F G;  1SQQ G;  2YNY A;  4MN4 C;  4IFD K;  2HFE D;  3SFD C;  3L70 E;  1EDI A;  2CPS A;  3VP8 A;  3CD6 P;  3FWN A;  4ZMD A;  1SQP K;  2HOD A;  3PJS K;  3F5H A;  1CW5 A;  3RL0 C;  1KQS O;  2WMM A;  4GOE A;  2RMZ A;  3L36 A;  3EFF K;  3CLQ A;  2JWA A;  4EYY Q;  2M8R A;  3D6Y A;  1KB9 I;  4OGQ D;  2OYH B;  1L0L K;  2QJK C;  3TGU J;  4I7Z B;  3L71 E;  5AVQ B;  5KJ7 A;  2Y0D A;  4IOI H;  3QWO C;  4HYT B;  3M91 A;  3B71 A;  1LWU A;  2FFD A;  2E74 C;  4PV1 B;  1USD A;  1H88 A;  2IDB A;  1SLQ A;  1EQ7 A;  1ZV8 A;  1DD4 A;  5KJ7 C;  1LTI C;  1N7S C;  3L74 D;  4DOJ A;  3H6P A;  3AEB C;  3L70 D;  1LTA C;  3WMM 0;  2WPV B;  2KIK A;  2E5Y A;  2M5A A;  3TSI A;  3L74 J;  1YTZ T;  3CCQ P;  3HE5 A;  1OVV A;  2L5G B;  1LTJ A;  1YHQ P;  1AVY A;  2OYI A;  1BCC E;  1VQ7 P;  1RY3 A;  5GTH E;  3H25 A;  2ZVN B;  3L71 D;  4U3F J;  1SQQ J;  2W6A A;  3U1A A;  5CCH C;  5AW0 B;  1GTW A;  2WSS H;  1QL2 A;  2IYP A;  1S5L X;  2WTY A;  4H13 D;  3Q3D A;  3MTU E;  5KLV G;  5L8R J;  1KIL B;  4WBA A;  3H1I E;  3L72 D;  1AQT A;  4EIJ A;  1LNQ A;  4I2L C;  2VRS A;  1NOH A;  1NTK K;  4L73 A;  1PGO A;  2H88 C;  5EFW B;  3RK2 D;  4KJM A;  3G9R A;  1N73 A;  4NPF X;  2J59 M;  1OW7 A;  1DD3 A;  2QVA A;  1JY2 P;  1P84 E;  5APQ A;  1SQX E;  1KN7 A;  1N86 A;  1EZV I;  4EOT A;  3E7K A;  2IBZ E;  2I1K A;  5TIS H;  1BCC D;  2C9N Y;  2WSC J;  1BSN A;  4JPZ B;  3MHV A;  1FZC B;  1FZA A;  2E76 D;  1PGQ A;  1LT9 C;  1T6A A;  4R4L A;  4D6T D;  2PP6 A;  2GA1 A;  3FXD A;  2E43 A;  2KSE A;  2A45 G;  4LLH A;  4OH8 B;  2W83 C;  3RL0 B;  2N1T A;  3H1I D;  3H1L G;  3B5N C;  3CX5 H;  4Y99 C;  3NFQ A;  1ZR4 A;  1EDL A;  1WRG A;  2RH0 A;  2ZFC A;  2HPC B;  1FBM A;  2POH A;  2QJK B;  2IBZ I;  3MGN A;  2B9B A;  2C0W A;  1OW8 A;  1IO4 A;  2KUB A;  1J1D C;  1P84 D;  4H0L D;  2N1T C;  1SQX D;  1QLE D;  2XNX A;  1L0L G;  2Y0C A;  2K1A A;  5KAF E;  1IZN B;  3OA7 A;  4DZO A;  5KLV J;  4L76 A;  2BEZ F;  5B66 H;  1HGV A;  1W5C E;  1L4A A;  3L35 A;  1HVV A;  1SP4 A;  3N7N A;  3A0H E;  3AEA C;  2WSC H;  1VQN P;  2Y9Z A;  4YPC A;  2ZXX A;  1H0T B;  1AFO A;  1URQ A;  1YYC A;  2QJP C;  1JY3 N;  3B4S A;  1VQP P;  1YQ3 C;  5BU8 B;  1FZE A;  2D2C D;  2I8D A;  1J1E C;  2LXC B;  2QG4 A;  3P8M C;  1MFT A;  2KS1 A;  3L73 G;  1VL2 A;  1RE4 A;  1MV8 A;  1JOC A;  5CCG A;  3E1R A;  1A02 J;  3H1L J;  2QJY C;  4M3L A;  2WT7 B;  2R44 A;  1VQ4 P;  2WIT A;  2ZXE B;  2IFM A;  3V6I A;  2XDJ A;  1JB0 J;  1KFN A;  1U7J A;  1NTK G;  1OMI A;  1L0L J;  4C7N A;  1Q7Y Q;  1KYO E;  2KNC B;  5TJH A;  2C0X A;  1JM0 A;  1JTH B;  3GW6 A;  1CZQ A;  1LT9 B;  1AA0 A;  3O6Q A;  4IL6 H;  4RO0 A;  3RK2 C;  2YIU B;  2AEF A;  1L0N E;  2ZT9 B;  1T2K D;  3JCU H;  2OYH A;  1N2D C;  4RKU J;  4KHX A;  3OW2 O;  1DIP A;  4B86 A;  5E79 E;  3CXH I;  4K35 A;  2AXT E;  2R3C A;  2A45 H;  4UB8 E;  2FYN B;  1DH3 A;  5APY A;  1KD1 Q;  3D70 A;  1NYH A;  4DT0 A;  3LIE A;  4NPD A;  3L73 D;  2OYH C;  1BGY G;  1M90 Q;  2KK7 A;  1M7L A;  1NAY A;  3T97 B;  1NTM E;  3AE4 C;  5CBN A;  3L73 J;  4C7R A;  1N7L A;  2FYU D;  2FKW B;  2AEJ A;  1JUN A;  1KYO D;  2ZYG A;  2M0B A;  3ZDM A;  1G2C A;  4PV1 C;  4OGQ B;  2YKP A;  2UWJ E;  1BDC A;  2IFN A;  1L0N D;  1VPC A;  3KDP B;  5AW4 B;  3M9Q A;  4H0L C;  3CC2 P;  2Z5I A;  3AE9 C;  3CCS P;  3Q5P A;  4KT0 J;  1JCC A;  1JY2 O;  1M1J C;  1NTK J;  3MUD A;  1EDK A;  1GK6 A;  2WVR A;  2OTL P;  2QJP B;  4N78 E;  3RK3 E;  2XU6 A;  1AQ5 A;  2NRG A;  3H1H E;  2BAS A;  2P10 A;  3CC4 P;  1JO5 A;  1KIL A;  1RH5 B;  1SQX K;  2JO1 A;  1NTM D;  3HD7 D;  5KKZ C;  2GM4 A;  3Q5S A;  1IFP A;  3V2R A;  3WUV A;  1YI2 P;  3P32 A;  4DCK A;  4JBZ A;  1FC2 C;  2IZ0 A;  2A06 E;  3N4X A;  1LTS C;  1BGY D;  2O1K A;  2FYZ A;  3CCE P;  3U1C A;  2KXP B;  1HJ0 A;  1E79 H;  3OAK A;  4JYC A;  1BGY J;  3VMA A;  1IC2 A;  5APV A;  1T8Z A;  1FZC A;  1X79 B;  3A0B E;  4H13 B;  3L70 G;  1KB9 E;  1VQL P;  1VF5 D;  3S1K A;  4ASV A;  1HH0 A;  4C46 A;  4PD4 D;  3W68 A;  1VQK P;  3NMD A;  3RK2 B;  1FZC C;  3SWF A;  2HPC A;  3GMA A;  3L71 G;  3AEE C;  2A06 D;  3OJA B;  2QRX A;  2QA4 P;  3WU2 H;  2BCC E;  1GU5 A;  1HUC A;  2E76 B;  1M56 D;  2E75 D;  2FXO A;  1FZB A;  1VDF A;  2K9J A;  3L72 G;  4LC1 A;  1T2K C;  1H8A A;  1BE3 E;  2V7Q J;  2ZJS E;  4GIF A;  3A2A A;  1YQ4 C;  1N7S A;  1LJ2 A;  4UB6 E;  4ASW A;  1ZME C;  1OFC X;  1JY3 P;  5CMZ A;  1NTZ E;  5AVR B;  2HLO A;  2AXC A;  1AVO A;  1H0T A;  5KLI B;  2Q5U A;  1SQB D;  1BCC G;  3G71 P;  4YXD C;  3CCL P;  1SQV E;  1VQ8 P;  4H0L B;  3ITK A;  2Q3I A;  1YBK A;  2WSF J;  2K88 A;  1M1J B;  5H2F H;  3CMA P;  5CCH A;  1GD2 E;  4D6T G;  1AJY A;  3L70 J;  2BCC D;  4PD4 H;  1YJN P;  3AEF C;  3C1L A;  5GTI E;  5APW A;  1Y8A A;  4W80 A;  3H1I G;  2K37 A;  2Y9Y A;  2FY8 A;  3CI9 A;  3CX5 I;  1NU1 E;  4H44 D;  1URQ D;  1BE3 D;  2Q3E A;  2WT7 A;  3MIW A;  3VMZ A;  5KKZ B;  2FYU K;  1EZV E;  3TK1 A;  3RBZ A;  1S5L H;  3L71 J;  2XV5 A;  5AW1 B;  2J58 A;  1HBW A;  1NTZ D;  1M57 D;  2ZYA A;  3BCC E;  3H1K E;  1SQX G;  1VQM P;  2WQY C;  2RN0 A;  2IBZ G;  2V7Q H;  5AW7 B;  1L0N K;  1YTZ I;  3AE5 C;  2D2C B;  2B87 B;  1ZLL A;  1SQV D;  5CJ4 A;  3L72 J;  2QM8 A;  3UIA A;  5CCG D;  3HD7 C;  2KNC A;  1M1K Q;  5KAI H;  1JTH A;  1LT9 A;  1MFZ A;  2W8Z A;  1FU1 A;  4K3A A;  3JSV C;  2NPS D;  3S4R A;  3PRJ A;  2WSF H;  1G1J A;  1MUU A;  2WZ7 A;  3B5N A;  1NU1 D;  1OWA A;  1BCC J;  4WY4 D;  1EZV D;  1LTG C;  1IFI A;  2YIU C;  2ZT9 C;  1UII A;  1PP9 E;  2O01 J;  3V5B A;  3BCC D;  3H1K D;  1Q90 D;  1QVG O;  4D6T J;  3TNU B;  3AE1 C;  3H1I J;  3VYI A;  1FE6 A;  1FS0 E;  2IPP A;  2K3R A;  2FYN C;  4R4M A;  3SFE C;  2W6J H;  1USE A;  1X9V A;  3LW5 J;  2IBZ D;  2YO2 A;  3NXS A;  3L75 E;  4RJT A;  1SQX J;  1KIL E;  2H89 C;  3VMY A;  1ZP0 C;  2E75 C;  3K5B A;  4OGQ C;  1EXI A;  1Q86 Q;  1DEB A;  1GW4 A;  3G4S P;  1PP9 D;  5APS A;  3IFM A;  1RHZ B;  3BRT B;  2R32 A;  3LID A;  5AVU B;  3SWY A;  1NH4 A;  1FZG A;  3PP5 A;  1SQP E;  1ZR2 A;  1FDI A;  2MJZ A;  5GTH H;  3WUU A;  1SFC D;  4BXL A;  2HG5 D;  3U59 A;  1FDM A;  1R8E A;  1KQL A;  2O01 H;  1PFI A;  1Z56 A;  3CCJ P;  4CPG A;  3PH0 A;  1R5L A;  4W7Y A;  3CME P;  2W90 A;  2A45 I;  1KV4 A;  1OVU A;  4WB4 A;  4XE5 B;  2WSE J;  3L75 D;  2Y0E A;  3IN6 A;  1OW6 A;  1DEE G;  1SQB K;  2FYU G;  1KTM A;  2M5A B;  1Y9B A;  5AVZ B;  1ZW0 A;  3LW5 H;  3H1J E;  3BVH A;  4H44 C;  3AE6 C;  1JMM A;  1LTJ B;  1X0T A;  3HD7 B;  1OZH A;  1P84 H;  3M0A A;  1PL5 A;  1FOS F;  2OYI B;  2PAJ A;  1NHL A;  2KLU A;  1L0N G;  2JDI H;  2OTJ P;  4BRY B;  1SQP D;  4U7J A;  3CXH E;  1KOR A;  2G3A A;  3G6E P;  1CI6 B;  4H13 C;  2K9Y A;  3CL3 D;  1JY3 O;  1GL2 D;  3A7O A;  4JF7 A;  3KZI E;  2P7J A;  1KC8 Q;  5AVX B;  5B5E E;  1HJB A;  1VQ6 P;  3PLN A;  4PJ0 E;  1VQ5 P;  1PPJ E;  3FGA D;  5BVZ A;  1NTZ K;  2NPS C;  1NTM G;  1NAF A;  1N73 B;  1JCD A;  2V4H A;  3EFG A;  1NJI Q;  3H1J D;  3FWL A;  2Q1K A;  1K04 A;  2KZI A;  2E76 C;  3P8C E;  4WY4 C;  2WSE H;  3AE7 C;  4AQR D;  4DJG A;  3CWB E;  3USS A;  1RF1 C;  1Y47 A;  1OXZ A;  1G1I A;  3CXH D;  2E74 D;  1QL1 A;  1JMB A;  3KXD A;  4OWF A;  1M1J A;  4TLF A;  1NU1 K;  2E75 B;  2FYU J;  5AW6 B;  3EQ2 A;  1LTT C;  5KJ7 D;  1U57 A;  3HE4 B;  3A0H H;  1H89 A;  5KLI C;  1N7S D;  1U7M A;  3BRV B;  2WPQ A;  1K05 A;  3C9I A;  5AW9 B;  1S9K E;  1PPJ D;  1NKN A;  3M9H A;  2PGD A;  1PGJ A;  1L0N J;  3AE3 C;  3V2N A;  3H32 B;  2A06 G;  1ZRT E;  3P8C D;  1LGH B;  1BSH A;  3CCR P;  2P58 A;  1JNM A;  1OX3 A;  2OTK E;  2NZ2 A;  2PFX A;  5DJU B;  2QE7 H;  1GZL A;  1NTM J;  1SFC C;  4EDF A;  3HTK B;  3HUS B;  1WT6 A;  1IK9 A;  3WUT A;  1FOS E;  3P7K A;  4H44 B;  1URQ B;  2D2C C;  3ABV C;  3M0D C;  1S9K D;  1PGP A;  3A5T A;  3TDK A;  2AEM A;  2MKV A;  2CPB A;  1S4X A;  1SQB G;  1S3J A;  4RES B;  4JYB A;  1HTL C;  1KYO H;  1DX7 A;  3II6 A;  5AW8 B;  1GK4 A;  3TGU E;  3RBX A;  4N78 D;  3RK3 D;  2QM7 A;  3V4Q A;  1ZRT D;  4N3Y B;  2KYV A;  1K73 Q;  3H1H D;  5AW2 B;  4JQ0 D;  2BCC G;  5KTB A;  3TNU A;  4I1L A;  5C39 A;  2YMY A;  4PD4 I;  2JWD A;  2WPR A;  2KI7 B;  1XTG B;  5KAI E;  1IFD A;  3F89 A;  2RKL A;  2NPS B;  5E79 H;  1BDD A;  4HB1 A;  1BE3 G;  3VOP A;  3B5N D;  2AXT H;  1IFN A;  4BWN A;  3W67 A;  1GL2 C;  4UB8 H;  1PZQ A;  1KFM A;  5TIS E;  3JC2 2;  1NTZ G;  2O3J A;  1VQO P;  2QSI A;  5CBO A;  4WY4 B;  1ZN5 A;  4C7N B;  3L74 E;  1X8Y A;  1RF1 B;  2B88 A;  2N1T D;  1SQV G;  4WWI A;  1UIX A;  2QIW A;  2OQQ A;  3V2P A;  2HYN A;  3RL0 g;  3A3Y B;  3O6Q B;  3PTZ A;  2JEE A;  3TGU D;  1KB9 D;  3GG2 A;  3IF4 A;  4U3F E;  1GDT A;  1SQQ E;  3CX5 E;  1HWT C;  2LXB A;  1NVO A;  4YXW H;  4AUW A;  2P2U A;  2JR8 A;  4Y28 J;  3SSU A;  2WPS A;  4GOD A;  5DJT B;  1NU1 G;  1SQB J;  2YXR B;  3VN0 A;  1K8A Q;  1EZV G;  1A02 F;  3L72 E;  3TF5 A;  1L4A D;  2JP3 A;  1WMK A;  3BCC G;  3EWK A;  3H1K G;  3VMX A;  1MKM A;  2BEQ D;  3MZW B;  1LWU C;  4WVZ A;  2BCC J;  2FFD C;  5B66 E;  1S1C X;  3I55 P;  3KHU A;  1G2C B;  1D7M A;  2R5D A;  3IR9 A;  2QEX P;  1LTB C;  4IFF A;  2B89 A;  2XZR A;  3HD7 A;  1BE3 J;  1LT1 A;  4U3F D;  3QH9 A;  1SQQ D;  1SFC B;  2IYO A;  3CX5 D;  4BRY A;  5APT A;  1PIX A;  1CSB A;  1CI6 A;  1NTZ J;  5AVW B;  3GLM A;  3S9O A;  2I1J A;  3A0B H;  1NO4 A;  4D6T E;  2YO3 A;  1L2P A;  2FXM A;  1LTJ C;  3CCM P;  1SQV J;  1KB9 H;  3AED C;  2LKM A;  2OYI C;  1YIT P;  2ZYD A;  5AW5 B;  3RGU A;  1J2J B;  1PP9 G;  1E5W A;  2ZAE B;  2GUS A;  2Q9I A;  4GT1 A;  2YMK A;  3B8E B;  1NTM K;  2PRR A;  5M1B A;  2FXP A;  3GHG B;  3D6Z A;  2IZ1 A;  5CJ0 A;  1NU1 J;  2OGU A;  5KLV E;  4EI2 A;  2LR2 A;  1KZU B;  1R5S A;  1GL2 B;  1QEX A;  3RK3 C;  1VF5 C;  3SWK A;  3T97 A;  2G8Y A;  1N73 C;  3FXE A;  2KLV A;  3BCC J;  3L75 G;  3H1K J;  3MP7 B;  3GF7 A;  4IL6 E;  2XND H;  5CHX A;  3HE4 A;  4UB6 H;  1LP1 B;  3M06 A;  3G3Z A;  3JCU E;  1K9M Q;  3CC7 P;  3C8V A;  1P84 I;  2J5U A;  4PV1 D;  2M3E A;  4TT3 H;  5K5G B;  3CPW O;  1SQP G;  4OVN F;  3H32 A;  2H8P D;  1S2E A;  2HOD B;  2OAR A;  1MZ9 A;  1EC5 A;  3E1I A;  1IFJ A;  3IAO A;  3O8Z A;  2E74 B;  3VP9 A;  5KLV D;  1NKZ B;  3VTP C;  2CK3 H;  3H1L E;  2WWW A;  2K9J B;  1KQF B;  2JJL A;  5GTI H;  1GMJ A;  1PP9 J;  3KYQ A;  5BU5 A;  2E5T A;  1N7S B;  1JEK A;  1LWU B;  4A7P A;  4ZNC A;  1Q2N A;  2SPZ A;  2FFD B;  1RF0 A;  2N9B A;  1HF9 A;  3HTK A;  2O1J A;  3HUS A;  3H1J G;  1L0L E;  3Q2Y A;  4LGD E;  4HH2 A;  1RE3 A;  1EDJ A;  1W2B O;  1L4A C;  2KZJ A;  1KIL D;  2O01 N;  1RF0 C;  2N9Y B;  1HGZ A;  2P67 A;  3HUS C;  3L75 J;  2DW3 A;  1FJP A;  1VQ9 P;  3HE5 B;  1Q81 Q;  1URQ C;  2H7H A;  3H1L D;  3R2P A;  2Z4E A;  4GKG A;  1S72 P;  1RE3 C;  3AEG C;  4XA4 A;  1QVF O;  1QGK B;  4L75 A;  1EXJ A;  1PPJ G;  5AVY B;  4Z1M H;  2IX7 C;  2KP8 A;  5AW3 B;  2FBW C;  2NPS A;  1SQP J;  3Q1M A;  2YKO A;  1OIP A;  1NWQ A;  4ZKP A;  4GDO A;  2KOG A;  1FJK A;  5APU A;  1RE4 C;  3L73 E;  1L0L D;  2C9L Y;  5CCG C;  1FDO A;  2XKM A;  3I5C A; 
#chains in the Genus database with same CATH homology
 1K04 A;  2E76 C;  2YIU C;  1KQF B;  2ZT9 C;  1GMJ A;  4H44 B;  2O01 J;  1VF5 D;  4PV1 C;  3SFD C;  3AE7 C;  1AJY A;  2D2C C;  3ABV C;  4OGQ B;  1OW8 A;  4XFJ A;  3Q5R A;  1Q90 D;  1VF5 B;  3AEF C;  1S5L X;  4Y28 J;  2MKV A;  2YMK A;  2E74 D;  4H0L D;  2WSE J;  3AEC C;  3IN6 A;  1OW6 A;  1JB0 J;  4H13 D;  3AE1 C;  1HF9 A;  4H0L C;  3Q3D A;  5M1B A;  5L8R J;  1KTM A;  4IL6 X;  3AE9 C;  3D6Y A;  2FXP A;  3Q5P A;  4H44 D;  4KT0 J;  1Y9B A;  3D6Z A;  1OMI A;  3Q2Y A;  1RQV A;  3GMA A;  4OGQ D;  2E75 B;  2QJK C;  4R4M A;  2FYN C;  4I7Z B;  1U57 A;  3AEE C;  4H44 C;  2BEZ F;  3SFE C;  3AE6 C;  4YTP C;  5KLI C;  3GF3 A;  2JP3 A;  2H88 C;  1WMK A;  1PL5 A;  1VF5 C;  1K05 A;  3RK3 E;  3EWK A;  3G9R A;  1MKM A;  2G8Y A;  1KMI Z;  1OW7 A;  3B71 A;  3O6Q A;  2BEQ D;  3LW5 J;  3AEA C;  1DD3 A;  4U7J A;  1RQU A;  2E76 B;  2E74 C;  2P10 A;  1KOR A;  1S1C X;  2G3A A;  2WQY C;  2ZT9 B;  2E75 D;  3AE3 C;  3AE5 C;  4PV1 B;  4H13 C;  1PV3 A;  3GF7 A;  3R4Y A;  1KIL E;  2D2C B;  2K9Y A;  2H89 C;  2JO1 A;  1ZP0 C;  2IDB A;  2E75 C;  5KKZ C;  3Q5S A;  4RKU J;  2WSC J;  4I7Z C;  1KQG B;  4OGQ C;  1ZOY C;  1EXI A;  2V7Q J;  1NGM B;  1DD4 A;  1DIP A;  2QJP C;  3AEG C;  1ZRT E;  3AE2 C;  1YQ4 C;  2E76 D;  3C8V A;  1TU3 F;  2ZT9 D;  1YQ3 C;  2J5U A;  3AEB C;  1EXJ A;  2QSI A;  4PV1 D;  1IK7 A;  4R4L A;  1ZME C;  1PIX A;  2D2C D;  4TT3 H;  4Z1M H;  2WPV B;  3FGA D;  3GLM A;  3D70 A;  2FBW C;  3S9O A;  1NYH A;  1FDI A;  3Q1M A;  2NZ2 A;  1HJ0 A;  1UIX A;  3T97 B;  2QIW A;  3AE8 C;  1VL2 A;  2OQQ A;  4GDO A;  4YXD C;  3RL0 g;  3AE4 C;  1R8E A;  3IAO A;  3AED C;  2E74 B;  4H0L B;  3D71 A;  1FDO A;  2WSF J;  2QJY C;  3H25 A;  4H13 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...