2K9YA

Epha2 dimeric structure in the lipidic bicelle at ph 5.0
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
41
structure length
41
Chain Sequence
EFQTLSPEGSGNLAVIGGVAVGVVLLLVLAGVGFFIHRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Left-Handed Dimer of EphA2 Transmembrane Domain: Helix Packing Diversity among Receptor Tyrosine Kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
total genus 10
structure length 41
sequence length 41
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2k9yA00
1VF5B 2K9YA 5KLIC 2E76B 2FYNC 5L8RJ 4OGQB 2E75B 2D2CB 4H0LB 2WSFJ 4KT0J 4IL6X 2WPVB 2QJYC 2E74B 2QJKC 3C8VA 2WSCJ 2YIUC 2QJPC 4I7ZB 4PV1B 1ZRTE 4Y28J 4H13B 2QIWA 2O01J 2QSIA 1JB0J 1S5LX 2WSEJ 2ZT9B 5KKZC 1Q90D 4H44B 3LW5J 4RKUJ
chains in the Genus database with same CATH superfamily
4IOIH 1YQ4C 1NOHA 3H1KG 3NMDA 1RQUA 4C7NA 1S2EA 2HPCA 1M8OB 2BEQD 3P32A 2E76C 4H0LB 4WY4C 3C1LA 1NU1J 2YKPA 4HKZH 2JWAA 1IFNA 1Q2NA 2KNCA 4LGDE 3U1AA 3SWYA 1OFCX 3RK2D 1R5SA 1RE4C 2IBZD 2NPSB 2QEXP 2C0WA 3QWOC 1ZOYC 1WRGA 2WSCJ 3B8EB 3H1KE 3I5CA 3AE1C 3D70A 3FGAD 2H43A 1NTZE 1L0NK 4H44C 1X22A 4NPDA 1SQBG 5BU8B 3CWBG 1L0LD 2XKMA 4I6MC 3MHVA 2AEJA 1NAFA 1JM0A 2K3RA 1RH5B 2IFMA 2K37A 2W6JH 3U59A 5CJ4A 2C9LY 1SQXJ 3M06A 5AW8B 3U1CA 2OYIC 5AW4B 1DD4A 1GW4A 2QM8A 4ZKPA 1AFOA 2LR2A 4O9BA 2FFDC 4LC1A 3TGUG 1SQQK 1OVVA 2Q6QA 3F5HA 3HD7D 3VP9A 2OTKE 5AVQB 3RK3D 1SQPG 1BSHA 3CD6P 3WUTA 4WVZA 2Q3IA 5CMZA 5H2FE 1JY2O 1BCCE 1XTGB 1MKMA 3HRNA 1SLQA 2QJYC 4L76A 3W68A 1BGYE 1ZXGA 3PHLA 5B5EH 4W80A 1EZVI 4H13C 3OA7A 2WPSA 3MTUE 4HYTB 4MN4C 4N78D 2ZT9C 4DJGA 1JY2N 2YXRB 1IFPA 2KZIA 3L74G 3ABVC 2LXCB 2W6AA 2B9BA 2YIUB 1A02J 1L0NE 2UWJE 1L0NG 2WT7B 2GA1A 4ASWA 1NGMB 3H1HJ 4K3AA 3K5BA 2FYUG 1PP9D 2BCCJ 3GF7A 5KJ7A 2WSFH 3G71P 2BEZF 5TISH 1G1IA 1SS1A 2Q3EA 3GMAA 1FZFA 2J5UA 2FYNC 3WU2E 3P8MC 4XA4A 2NPSD 1S1CX 3HD7A 2CPSA 2IPPA 5AVSB 5K5GB 1YHQP 1KB9E 1SQQE 1BE3G 1N86A 4D6TJ 1NTMD 1JOCA 3EQ2A 1JY2P 2WITA 4AYCA 1NTZJ 2FYUK 2YKOA 2W6BA 1SQBE 1L0LK 2QJKC 3L73E 4DT0A 1X79B 1ZR2A 3L70D 3H32B 1U7JA 3F89A 3E1IA 3NTNA 2NPSA 3AE8C 2R3CA 2JEEA 3GW6A 4PV1B 1IFMA 1VF5C 4GDOA 4NPEA 1FC2C 1URQB 1NU1E 5B66H 1Y47A 2WSSH 1KYOH 1EXIA 3H1LJ 3M9QA 4EYYQ 3FXDA 2WWWA 1LWUC 2KIKA 3CI9A 3QH9A 3LW5J 3L70J 3AE4C 5APUA 4RESB 2JO1A 4YXDC 2ZT9D 1KV4A 1MUUA 4NPFX 1LTAC 1BE3D 3W67A 2P7JA 1ZR4A 4HH2A 3I56P 4OGQD 1LTTC 1LWUA 3USSA 3L75D 5DJTB 1SQQG 1N7SC 1JY3O 5CCHC 1NAYA 4U3FG 4DZOA 5M1BA 1XTCC 1ZP0C 2O01N 1A02F 1VQ4P 1E5WA 2KZJA 5APYA 1KZUB 1PGPA 2MKVA 1PL5A 1OX3A 1LTIC 1SFCD 4EDFA 3RL0g 1EZVG 1GK6A 2O01H 1PGOA 2PGDA 2ZVOB 5BU5A 3O8ZA 1M1JC 2NPSC 1VQ7P 2ZAEB 1NTZD 2AEFA 2WQYC 3H1HE 2ZXXA 2FFDA 3IN6A 2FYNB 3CLQA 1L4AC 1NTKD 2P58A 4IL6H 5CCHA 2R5DA 3GHGC 1SQVE 2Y9ZA 3FXEA 5AVUB 1KB9H 1DIPA 1NTKG 1T8ZA 2Y0EA 5KLIC 2NZ2A 2OTLP 4OGQB 1AVOA 2FY8A 4EI2A 1FDIA 4GOFA 1BCCG 4N3YB 3L75G 5AW2B 2M3BA 2H7HA 2ZJSE 1IFIA 1YTZI 1RE4A 1NJIQ 1FZBA 3AEEC 1BCCD 1BDCA 2JDIH 3L35A 1HTLC 2JR8A 1KFNA 1USDA 4I7ZB 3FX0A 2AXTE 4L73A 1OZHA 2CPBA 3HE5B 2YNYA 1URQD 2K88A 3PH0A 3L72J 1LWUB 4I2LC 4JYCA 3V5BA 4AUWA 1LTSC 3V2NA 4PV1D 3KDPB 1Q81Q 1N7SD 2B87A 4OVNF 1SFCA 3KZIE 1P84D 1ZV8A 1JB0J 1L0ND 1L0LG 1ZW0A 1KQSO 1M57D 2ZXEB 2JWDA 1BDDA 1N73C 1HJBA 1N7SB 3N7NA 1KILD 2ZYAA 2G3AA 2IZ1A 5L8RJ 1LP1B 1SQVK 3SFDC 5KAIH 3A5TA 3TNUB 3D6ZA 1JY3N 2D2CB 1H8AA 1VQLP 4U3FE 1N7LA 3L72D 1DH3A 2Y0CA 2YMKA 4H0LD 2B88A 1OW6A 2Z4EA 2W27A 4UB6H 2Q1KA 4B86A 2OYHC 1AQTA 1KQFB 3OAKA 1CI6A 4JF7A 1YYCA 2IFNA 1PPJD 3CWBE 5TJHA 5AW0B 3RBXA 1KQLA 4C7RA 1AQ5A 2I8DA 1RHZB 3TK1A 1KQGB 3CX5I 2LXBA 2E74C 3L4FA 1M90Q 1NKNA 2QJPC 3HD7C 3L70E 4YXWH 1YJWP 1CZQA 5KLVJ 2HFED 1IFDA 2KP8A 5GTHH 1Q82Q 2IBZG 1NTKK 1S5LE 1JTHB 5KJ7C 1T3JA 2KUBA 2JP3A 3MUDC 1SQXK 1HBWA 4L75A 2KB7P 3PJSK 3MD0A 2NRGA 1SQVJ 2KI7B 2IYPA 4H44D 1GL2A 1OXZA 1PP9G 5APXA 1UIXA 2JJLA 3BRVB 3G4SP 4YTPC 1VQ8P 1ZLLA 1T3UA 3D6YA 2KYVA 1FDMA 1EDJA 3CXHH 1BE3E 5KAFE 5APVA 1OWAA 3H1IG 3V4QA 1H0TB 5CHXA 3L75E 1X9VA 5KLVE 2Y0DA 5CCGA 2HR3A 1QL2A 2FYZA 3SSUA 2KK7A 2IX7C 1NH4A 4BXLA 1S3JA 1BGYG 3V2RA 2QM7A 4BRYB 1VQPP 1VQ6P 2A06G 3RK3C 2BCCE 5KLVK 3BATA 1H0TA 2K9JB 1VDFA 4H0LC 4WY4B 1AA0A 3H1HD 1GU4A 2LKMA 1NTMG 1NVOA 2WSEJ 1T2KD 3RBZA 4OH8B 2WT7A 1NTKE 2SPZA 3L71G 1EZVD 1Q90D 4ZKUA 1SQVD 1R5LA 1JCCA 1LTJC 2N1TC 3AEFC 3HUSC 3CPWO 1JMBA 2ZYGA 2WMMA 3AE5C 3WUUA 2KOGA 2A45I 2J59M 3EFGA 2A45H 2ZFCA 1FDOA 3H1JG 1CW5A 3A0HE 5KAIE 5KLIB 2FBWC 2R3SA 3L36A 3N4XA 4IL6X 3V2QA 1DEEG 1JMMA 3BASA 1ZMEC 5AVVB 2O1KA 2XNDH 4I1LA 4OWFA 3S1KA 2PRRA 2RKLA 1Q7YQ 1KYOD 1PV3A 2H89C 2KSEA 1GL2B 3L73J 3OW2O 2N9BA 2YKQA 5GTIE 3CX5E 1FOSF 4D6TD 2HLOA 3BCCJ 2R44A 2W8ZA 3PP5A 2Q5UA 4R4MA 3V4WA 1LP1A 3KQGA 4I7ZC 3CCMP 1PZQA 2XDJA 4R4LA 1G2CA 2QIWA 2QSIA 2M3EA 1OVUA 2W90A 3GHGA 2AXCA 3HTKA 2YO3A 3L71D 1HVVA 1SP4A 3EFFK 3MUDA 5CJ0A 1P84E 3PTZA 2P1JA 1JO5A 3M91A 4GODA 4WWIA 2YXQB 3SFEC 1DX7A 2E76B 1QL1A 2GUVA 4BWNA 3H1KJ 1EDKA 1KILE 1EC5A 1S4XA 2K9JA 2ZVNB 2WSFJ 1NU1G 1N2DC 4GT1A 1P84H 5TISE 1J2JB 1CI6B 2I1KA 3AEDC 4U3FD 1PGQA 3L72E 1DD3A 1T6AA 3L74D 3AEAC 3BCCE 5APQA 5CCGD 2V7QH 2OARA 5APTA 5AW3B 2V7QJ 1KTMA 4RJTA 1VQMP 3CWBD 3R2PA 1PPJE 1RE3C 2PP6A 4GIFA 5KTBA 3C9IA 1Y9BA 2N1TD 3G9RA 3D71A 2OYHA 4Y99B 1SQBJ 3AEGC 1YIJP 3CWBJ 2XV5A 1J1DB 1LJ2A 3E1RA 3P7KA 3CMAP 2POHA 2QJPB 1CSBA 3HD7B 2OYIB 1QEXA 2OQQA 5CBNA 4IFMA 2AXTH 1SQXG 2E5YA 4RO0A 3KHUA 3R4YA 2E75C 5KKZC 1GZLA 3B4SA 3NFQA 3TNUA 1SFCC 5AVZB 3CL3D 3TGUJ 1L4AA 3VOPA 2D2CD 3VN0A 3B5NA 2FFDB 3G3ZA 1JTHA 1SQPJ 3CCVP 1VQNP 2I1JA 4PV1C 3HTKB 3LW5H 4KHXA 1GMJA 3MZWB 1RF1A 1GDTA 1L4AD 1PGJA 2A06D 2MJZA 1SQPD 1W2EA 2M0BA 2WPVB 2Z5IA 2WSEH 3M0DC 2IYOA 4JQ0D 5DJUB 1QVFO 2QVAA 1YBKA 3AE9C 1FJPA 4PD4I 3Q5SA 1IO4A 3P8CE 1TU3F 1M1JA 3HE4A 2KSJA 3FWLA 3L74J 1GW3A 4WY4A 2PAJA 1UIIA 5GTIH 1M1KQ 4XFJA 2BCCD 1OMIA 2FXOA 2FXPA 4PD4H 5BVZA 2N1TA 2V4HA 1L0NJ 1LTJA 1IFJA 1NKZB 1X0TA 3HUSA 4TLFA 3RK3B 3H1HG 3TDKA 1N7SA 2FYUJ 2O1JA 2BCCG 5AVXB 3WMM0 2W83C 1KFMA 3H1LD 4EIJA 1L2PA 4H44B 4H13D 1P84I 1EZVE 3UIAA 3Q5PA 1URQA 1OW8A 4PJ0E 3PRJA 1VF5D 1W5CE 3B5ND 3KYQA 2Q9IA 2HYNA 2OGUA 4L74A 1BE3J 1LGHB 1M1JB 2WSCH 3E7KA 3HE4B 4Y99C 4D6TG 3CCRP 1KILB 3O6QB 5GTHE 4N6JA 1NTZG 2L91A 1NTMK 2AEMA 1L4AB 4CPGA 5E79H 4LLHA 1HWTC 1NWQA 2FYUD 1M56D 1J1EC 1KYOE 2R5BA 1N8RQ 4GOEA 3H1JD 4TT3H 3CX5D 4Y28J 2FKWB 3AECC 1SFCB 3MP7B 4D6TE 1GL2C 1SQXE 3AE7C 3BRTB 3IFMA 4OGQC 3Q1MA 4JBZA 2HPCB 1EDLA 1QX8A 4EOTA 1SVFA 1FE6A 2O01J 5CCHD 1LT1A 3H1LG 3S9OA 1HF9A 4AQRD 5KLVD 5KAFH 1FBMA 1QVGO 2QE7H 3L71E 4ZNCA 3L70G 4GKGA 3RL0D 2H8PD 4UB8E 5H2FH 4A7PA 5E79E 4IFDK 4UB6E 3CCEP 1FU1A 1EQ7A 1G2CB 2E5TA 3HE5A 1NYHA 1Q86Q 1GD2E 1JUNA 5KJ7D 1SQQJ 3VMZA 2E43A 4U3FJ 3H25A 3M0DA 1IC2A 2Q7CA 3RK2B 3L74E 1GTWA 3BCCD 1RF1C 3VYIA 3JCUE 1VPCA 1E79H 2CK3H 2R32A 3GF3A 1FS0E 5AW6B 1S5LH 3V6IA 4PD4E 1Y8AA 1BSNA 1Z56A 1IJDB 1YQ3C 1ZRTE 5AVYB 1YI2P 1YTZT 2E76D 4DOJA 3CCQP 2OYOA 1G1JA 2M8RA 3EWKA 3VTPC 2QJKB 4W7ZA 1LT9C 2G8YA 1KN7A 3A7OA 1J1DC 1K04A 1K05A 2H88C 3T97B 2OYHB 2C0XA 1EXJA 3CC2P 3GHGB 1NTKJ 1AVYA 1VF5B 1FJKA 3AEBC 1OIPA 2E42A 3CXHE 4WB4A 4JYBA 1URQC 2E75B 3H1IE 1FZGA 1HGZA 1MFZA 1BCCJ 1WMKA 1IK7A 1GL2D 3FWNA 2M5AA 3L75J 3OJAB 3VMAA 1FZCC 1J1EB 1X8YA 1VQ9P 2L5GB 3ITKA 3RL0B 2XZRA 1DEBA 1JEKA 2A06E 1HJ0A 1KORA 1SQPE 1JCDA 1PPJG 1VQ5P 3WUVA 1FZCA 1LTBC 3CC7P 3L37A 3IR9A 1KC8Q 4KJMA 2BASA 3TGUE 3P8CD 1FZAA 2A45G 3L72G 1S9KE 4K35A 1ZN5A 1RQVA 5C39A 3AE2C 4Z1MH 3M9BA 5B5EE 3TF5A 1HUCA 1S5LX 1LT9A 1IZNB 1L0LJ 3A0BH 2OTJP 3B71A 1LTGC 1H89A 2OYIA 2IDBA 2J58A 4W7YA 3IF4A 3A0HH 2K9YA 3H1LE 3NXSA 2WZ7A 2RN0A 5AVRB 2QA4P 1YITP 2P2UA 2HG5D 4YPCA 1VQKP 1D7MA 4KT0J 1JNMA 1LNQA 1OVRA 1K73Q 1VL2A 5EFWB 1JY3P 1RY3A 2IBZE 3GG2A 1KMIZ 2KNCB 5AVTB 2QG4A 3H1KD 2E74B 3JSVC 2Y9YA 3TSIA 3C8VA 3CCJP 3KZIH 2B89A 3M9HA 1KILC 2FXMA 2KLVA 3A0BE 2FYUE 1SQBK 1L0LE 2N9YB 1SQPK 3LIEA 4ZMDA 2N1TB 3HUSB 5KLVG 2C9NY 2QRXA 3II6A 3TYYA 1RE3A 2HODA 1FAVA 3Q2YA 3H1JE 1S72P 1EDIA 2RH0A 3CX5H 3A3YB 4QMAA 2YMYA 1SQXD 1NHLA 1QGKB 3A2AA 3MGNA 1PIXA 2DW3A 4BRYA 3SWKA 3VMYA 1NU1K 3PLNA 3Q5RA 3B5NB 1VQOP 4C7NB 1PFIA 1H88A 1GK4A 4RKUJ 3RK3E 1SQVG 3T97A 3VMXA 1PP9J 1GU5A 5APWA 1R8EA 3G6EP 2IBZI 1KB9I 3H1IJ 1BGYD 1N73B 2WTYA 3WU2H 3LIDA 3SWFA 2M5AB 2WPRA 1MV8A 1KD1Q 3ZDMA 2E75D 2JKVA 1RF0A 1FOSE 4N78E 5CBOA 1IK9A 2KS1B 2WVRA 5B66E 2YIUC 1BGYJ 3KPEA 2D2CC 3CCUP 4JPZB 2IZ0A 1WT6A 3H32A 2P10A 3JC22 1RF1B 4PD4D 4WY4D 1W2BO 3Q3DA 2XNXA 1ZRTD 3S4RA 1YJ9P 3GLMA 1USEA 2RMZA 3JCUH 2PFXA 5APSA 1PP9E 1NTMJ 2GUSA 1LTJB 2Z5HA 4HJGH 2WPQA 3L71J 1AJYA 4U7JA 3M0AA 1LT9B 1MZ9A 1QLED 4IFFA 3CMEP 4WBAA 3VP8A 3CCLP 1KB9D 1SQQD 2HODB 4DCKA 2KS1A 2KXPB 1MFTA 3AE3C 4IL6E 3CXHD 1NO4A 1NTME 3H1JJ 4M3LA 3BVHA 2K1AA 3H1ID 5AW9B 3I55P 1K9MQ 1SQBD 3CCSP 3L73D 1YJNP 4UB8H 3AE6C 5AW7B 1RF0C 1KYOI 1NTZK 1U57A 5AW5B 2ITAA 3KXDA 1T2KC 1K8AQ 1FZCB 2GM4A 2ZYDA 3CXHI 3MIWA 4XE5B 2KLUA 4HB1A 3L73G 3RL0C 2P67A 5KKZB 4ASVA 2XU6A 3BCCG 1M7LA 1NU1D 2YO2A 3B5NC 3CC4P 1KILA 2QJYB 3O6QA 3H6PA 1U7MA 3TGUD 5AVWB 1FZEA 3RGUA 3RK2C 4C46A 1HH0A 1N73A 5AW1B 2VRSA 4H13B 5CCGC 1S9KD 1OW7A 1HGVA 2O3JA 1AV1A 3IAOA 2ZT9B 4PJ0H 2B87B 2E74D 3V2PA
chains in the Genus database with same CATH topology
1VF5B 3AEBC 2E76B 1YQ4C 5KLIC 2NZ2A 1RQUA 1KILE 2E75B 4OGQB 2BEQD 4H0LB 2E76C 1FDIA 1WMKA 2WSFJ 1IK7A 3AEDC 1DD3A 3AEAC 3AEEC 2V7QJ 1HJ0A 1KORA 1KTMA 1ZOYC 2WSCJ 3D71A 3D70A 1Y9BA 3AE1C 3FGAD 3G9RA 4I7ZB 4H44C 3AEGC 1RQVA 4PV1D 3AE2C 4Z1MH 2OQQA 3D6YA 1JB0J 1S5LX 1DD4A 2E75C 3B71A 3R4YA 5KKZC 2IDBA 2D2CD 2K9YA 2G3AA 5L8RJ 3D6ZA 3SFDC 2D2CB 4KT0J 4PV1C 2YMKA 4H0LD 1GMJA 1OW6A 1VL2A 1MKMA 1KQFB 1KMIZ 2WPVB 2QJYC 2E74B 3AE9C 3C8VA 1KQGB 4H13C 3Q5SA 2E74C 2QJPC 1TU3F 2ZT9C 3ABVC 3Q2YA 4XFJA 1OMIA 2FXPA 1NGMB 1PIXA 2JP3A 3Q5RA 3GF7A 2BEZF 4H13D 4H44B 3GMAA 4RKUJ 3RK3E 2J5UA 2FYNC 3Q5PA 1OW8A 4H44D 1S1CX 1UIXA 1VF5D 4YTPC 1R8EA 2QJKC 2E75D 2YIUC 2D2CC 3AE8C 4PV1B 2P10A 4GDOA 1VF5C 4TT3H 4Y28J 3AECC 3Q1MA 3Q3DA 3AE7C 4OGQC 3GLMA 4H0LC 2O01J 1EXIA 2WSEJ 3S9OA 1HF9A 1AJYA 1Q90D 4U7JA 3LW5J 3AEFC 3AE4C 4YXDC 2JO1A 3AE5C 2ZT9D 3AE3C 1FDOA 1NYHA 4OGQD 2FBWC 4IL6X 5M1BA 1ZP0C 3H25A 3AE6C 1ZMEC 1U57A 2MKVA 1PL5A 1PV3A 2H89C 3GF3A 3RL0g 1YQ3C 1ZRTE 2E76D 3O6QA 4R4MA 2WQYC 4I7ZC 3IN6A 4R4LA 3EWKA 4H13B 1OW7A 2G8YA 2QIWA 2QSIA 3IAOA 2ZT9B 2H88C 1K04A 1K05A 3T97B 1EXJA 1DIPA 2E74D 3SFEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF5 B;  2K9Y A;  5KLI C;  2E76 B;  2FYN C;  5L8R J;  4OGQ B;  2E75 B;  2D2C B;  4H0L B;  2WSF J;  4KT0 J;  4IL6 X;  2WPV B;  2QJY C;  2E74 B;  2QJK C;  3C8V A;  2WSC J;  2YIU C;  2QJP C;  4I7Z B;  4PV1 B;  1ZRT E;  4Y28 J;  4H13 B;  2QIW A;  2O01 J;  2QSI A;  1JB0 J;  1S5L X;  2WSE J;  2ZT9 B;  5KKZ C;  1Q90 D;  4H44 B;  3LW5 J;  4RKU J; 
#chains in the Genus database with same CATH topology
 4IOI H;  1YQ4 C;  1NOH A;  3H1K G;  3NMD A;  1RQU A;  4C7N A;  1S2E A;  2HPC A;  1M8O B;  2BEQ D;  3P32 A;  2E76 C;  4H0L B;  4WY4 C;  3C1L A;  1NU1 J;  2YKP A;  4HKZ H;  2JWA A;  1IFN A;  1Q2N A;  2KNC A;  4LGD E;  3U1A A;  3SWY A;  1OFC X;  3RK2 D;  1R5S A;  1RE4 C;  2IBZ D;  2NPS B;  2QEX P;  2C0W A;  3QWO C;  1ZOY C;  1WRG A;  2WSC J;  3B8E B;  3H1K E;  3I5C A;  3AE1 C;  3D70 A;  3FGA D;  2H43 A;  1NTZ E;  1L0N K;  4H44 C;  1X22 A;  4NPD A;  1SQB G;  5BU8 B;  3CWB G;  1L0L D;  2XKM A;  4I6M C;  3MHV A;  2AEJ A;  1NAF A;  1JM0 A;  2K3R A;  1RH5 B;  2IFM A;  2K37 A;  2W6J H;  3U59 A;  5CJ4 A;  2C9L Y;  1SQX J;  3M06 A;  5AW8 B;  3U1C A;  2OYI C;  5AW4 B;  1DD4 A;  1GW4 A;  2QM8 A;  4ZKP A;  1AFO A;  2LR2 A;  4O9B A;  2FFD C;  4LC1 A;  3TGU G;  1SQQ K;  1OVV A;  2Q6Q A;  3F5H A;  3HD7 D;  3VP9 A;  2OTK E;  5AVQ B;  3RK3 D;  1SQP G;  1BSH A;  3CD6 P;  3WUT A;  4WVZ A;  2Q3I A;  5CMZ A;  5H2F E;  1JY2 O;  1BCC E;  1XTG B;  1MKM A;  3HRN A;  1SLQ A;  2QJY C;  4L76 A;  3W68 A;  1BGY E;  1ZXG A;  3PHL A;  5B5E H;  4W80 A;  1EZV I;  4H13 C;  3OA7 A;  2WPS A;  3MTU E;  4HYT B;  4MN4 C;  4N78 D;  2ZT9 C;  4DJG A;  1JY2 N;  2YXR B;  1IFP A;  2KZI A;  3L74 G;  3ABV C;  2LXC B;  2W6A A;  2B9B A;  2YIU B;  1A02 J;  1L0N E;  2UWJ E;  1L0N G;  2WT7 B;  2GA1 A;  4ASW A;  1NGM B;  3H1H J;  4K3A A;  3K5B A;  2FYU G;  1PP9 D;  2BCC J;  3GF7 A;  5KJ7 A;  2WSF H;  3G71 P;  2BEZ F;  5TIS H;  1G1I A;  1SS1 A;  2Q3E A;  3GMA A;  1FZF A;  2J5U A;  2FYN C;  3WU2 E;  3P8M C;  4XA4 A;  2NPS D;  1S1C X;  3HD7 A;  2CPS A;  2IPP A;  5AVS B;  5K5G B;  1YHQ P;  1KB9 E;  1SQQ E;  1BE3 G;  1N86 A;  4D6T J;  1NTM D;  1JOC A;  3EQ2 A;  1JY2 P;  2WIT A;  4AYC A;  1NTZ J;  2FYU K;  2YKO A;  2W6B A;  1SQB E;  1L0L K;  2QJK C;  3L73 E;  4DT0 A;  1X79 B;  1ZR2 A;  3L70 D;  3H32 B;  1U7J A;  3F89 A;  3E1I A;  3NTN A;  2NPS A;  3AE8 C;  2R3C A;  2JEE A;  3GW6 A;  4PV1 B;  1IFM A;  1VF5 C;  4GDO A;  4NPE A;  1FC2 C;  1URQ B;  1NU1 E;  5B66 H;  1Y47 A;  2WSS H;  1KYO H;  1EXI A;  3H1L J;  3M9Q A;  4EYY Q;  3FXD A;  2WWW A;  1LWU C;  2KIK A;  3CI9 A;  3QH9 A;  3LW5 J;  3L70 J;  3AE4 C;  5APU A;  4RES B;  2JO1 A;  4YXD C;  2ZT9 D;  1KV4 A;  1MUU A;  4NPF X;  1LTA C;  1BE3 D;  3W67 A;  2P7J A;  1ZR4 A;  4HH2 A;  3I56 P;  4OGQ D;  1LTT C;  1LWU A;  3USS A;  3L75 D;  5DJT B;  1SQQ G;  1N7S C;  1JY3 O;  5CCH C;  1NAY A;  4U3F G;  4DZO A;  5M1B A;  1XTC C;  1ZP0 C;  2O01 N;  1A02 F;  1VQ4 P;  1E5W A;  2KZJ A;  5APY A;  1KZU B;  1PGP A;  2MKV A;  1PL5 A;  1OX3 A;  1LTI C;  1SFC D;  4EDF A;  3RL0 g;  1EZV G;  1GK6 A;  2O01 H;  1PGO A;  2PGD A;  2ZVO B;  5BU5 A;  3O8Z A;  1M1J C;  2NPS C;  1VQ7 P;  2ZAE B;  1NTZ D;  2AEF A;  2WQY C;  3H1H E;  2ZXX A;  2FFD A;  3IN6 A;  2FYN B;  3CLQ A;  1L4A C;  1NTK D;  2P58 A;  4IL6 H;  5CCH A;  2R5D A;  3GHG C;  1SQV E;  2Y9Z A;  3FXE A;  5AVU B;  1KB9 H;  1DIP A;  1NTK G;  1T8Z A;  2Y0E A;  5KLI C;  2NZ2 A;  2OTL P;  4OGQ B;  1AVO A;  2FY8 A;  4EI2 A;  1FDI A;  4GOF A;  1BCC G;  4N3Y B;  3L75 G;  5AW2 B;  2M3B A;  2H7H A;  2ZJS E;  1IFI A;  1YTZ I;  1RE4 A;  1NJI Q;  1FZB A;  3AEE C;  1BCC D;  1BDC A;  2JDI H;  3L35 A;  1HTL C;  2JR8 A;  1KFN A;  1USD A;  4I7Z B;  3FX0 A;  2AXT E;  4L73 A;  1OZH A;  2CPB A;  3HE5 B;  2YNY A;  1URQ D;  2K88 A;  3PH0 A;  3L72 J;  1LWU B;  4I2L C;  4JYC A;  3V5B A;  4AUW A;  1LTS C;  3V2N A;  4PV1 D;  3KDP B;  1Q81 Q;  1N7S D;  2B87 A;  4OVN F;  1SFC A;  3KZI E;  1P84 D;  1ZV8 A;  1JB0 J;  1L0N D;  1L0L G;  1ZW0 A;  1KQS O;  1M57 D;  2ZXE B;  2JWD A;  1BDD A;  1N73 C;  1HJB A;  1N7S B;  3N7N A;  1KIL D;  2ZYA A;  2G3A A;  2IZ1 A;  5L8R J;  1LP1 B;  1SQV K;  3SFD C;  5KAI H;  3A5T A;  3TNU B;  3D6Z A;  1JY3 N;  2D2C B;  1H8A A;  1VQL P;  4U3F E;  1N7L A;  3L72 D;  1DH3 A;  2Y0C A;  2YMK A;  4H0L D;  2B88 A;  1OW6 A;  2Z4E A;  2W27 A;  4UB6 H;  2Q1K A;  4B86 A;  2OYH C;  1AQT A;  1KQF B;  3OAK A;  1CI6 A;  4JF7 A;  1YYC A;  2IFN A;  1PPJ D;  3CWB E;  5TJH A;  5AW0 B;  3RBX A;  1KQL A;  4C7R A;  1AQ5 A;  2I8D A;  1RHZ B;  3TK1 A;  1KQG B;  3CX5 I;  2LXB A;  2E74 C;  3L4F A;  1M90 Q;  1NKN A;  2QJP C;  3HD7 C;  3L70 E;  4YXW H;  1YJW P;  1CZQ A;  5KLV J;  2HFE D;  1IFD A;  2KP8 A;  5GTH H;  1Q82 Q;  2IBZ G;  1NTK K;  1S5L E;  1JTH B;  5KJ7 C;  1T3J A;  2KUB A;  2JP3 A;  3MUD C;  1SQX K;  1HBW A;  4L75 A;  2KB7 P;  3PJS K;  3MD0 A;  2NRG A;  1SQV J;  2KI7 B;  2IYP A;  4H44 D;  1GL2 A;  1OXZ A;  1PP9 G;  5APX A;  1UIX A;  2JJL A;  3BRV B;  3G4S P;  4YTP C;  1VQ8 P;  1ZLL A;  1T3U A;  3D6Y A;  2KYV A;  1FDM A;  1EDJ A;  3CXH H;  1BE3 E;  5KAF E;  5APV A;  1OWA A;  3H1I G;  3V4Q A;  1H0T B;  5CHX A;  3L75 E;  1X9V A;  5KLV E;  2Y0D A;  5CCG A;  2HR3 A;  1QL2 A;  2FYZ A;  3SSU A;  2KK7 A;  2IX7 C;  1NH4 A;  4BXL A;  1S3J A;  1BGY G;  3V2R A;  2QM7 A;  4BRY B;  1VQP P;  1VQ6 P;  2A06 G;  3RK3 C;  2BCC E;  5KLV K;  3BAT A;  1H0T A;  2K9J B;  1VDF A;  4H0L C;  4WY4 B;  1AA0 A;  3H1H D;  1GU4 A;  2LKM A;  1NTM G;  1NVO A;  2WSE J;  1T2K D;  3RBZ A;  4OH8 B;  2WT7 A;  1NTK E;  2SPZ A;  3L71 G;  1EZV D;  1Q90 D;  4ZKU A;  1SQV D;  1R5L A;  1JCC A;  1LTJ C;  2N1T C;  3AEF C;  3HUS C;  3CPW O;  1JMB A;  2ZYG A;  2WMM A;  3AE5 C;  3WUU A;  2KOG A;  2A45 I;  2J59 M;  3EFG A;  2A45 H;  2ZFC A;  1FDO A;  3H1J G;  1CW5 A;  3A0H E;  5KAI E;  5KLI B;  2FBW C;  2R3S A;  3L36 A;  3N4X A;  4IL6 X;  3V2Q A;  1DEE G;  1JMM A;  3BAS A;  1ZME C;  5AVV B;  2O1K A;  2XND H;  4I1L A;  4OWF A;  3S1K A;  2PRR A;  2RKL A;  1Q7Y Q;  1KYO D;  1PV3 A;  2H89 C;  2KSE A;  1GL2 B;  3L73 J;  3OW2 O;  2N9B A;  2YKQ A;  5GTI E;  3CX5 E;  1FOS F;  4D6T D;  2HLO A;  3BCC J;  2R44 A;  2W8Z A;  3PP5 A;  2Q5U A;  4R4M A;  3V4W A;  1LP1 A;  3KQG A;  4I7Z C;  3CCM P;  1PZQ A;  2XDJ A;  4R4L A;  1G2C A;  2QIW A;  2QSI A;  2M3E A;  1OVU A;  2W90 A;  3GHG A;  2AXC A;  3HTK A;  2YO3 A;  3L71 D;  1HVV A;  1SP4 A;  3EFF K;  3MUD A;  5CJ0 A;  1P84 E;  3PTZ A;  2P1J A;  1JO5 A;  3M91 A;  4GOD A;  4WWI A;  2YXQ B;  3SFE C;  1DX7 A;  2E76 B;  1QL1 A;  2GUV A;  4BWN A;  3H1K J;  1EDK A;  1KIL E;  1EC5 A;  1S4X A;  2K9J A;  2ZVN B;  2WSF J;  1NU1 G;  1N2D C;  4GT1 A;  1P84 H;  5TIS E;  1J2J B;  1CI6 B;  2I1K A;  3AED C;  4U3F D;  1PGQ A;  3L72 E;  1DD3 A;  1T6A A;  3L74 D;  3AEA C;  3BCC E;  5APQ A;  5CCG D;  2V7Q H;  2OAR A;  5APT A;  5AW3 B;  2V7Q J;  1KTM A;  4RJT A;  1VQM P;  3CWB D;  3R2P A;  1PPJ E;  1RE3 C;  2PP6 A;  4GIF A;  5KTB A;  3C9I A;  1Y9B A;  2N1T D;  3G9R A;  3D71 A;  2OYH A;  4Y99 B;  1SQB J;  3AEG C;  1YIJ P;  3CWB J;  2XV5 A;  1J1D B;  1LJ2 A;  3E1R A;  3P7K A;  3CMA P;  2POH A;  2QJP B;  1CSB A;  3HD7 B;  2OYI B;  1QEX A;  2OQQ A;  5CBN A;  4IFM A;  2AXT H;  1SQX G;  2E5Y A;  4RO0 A;  3KHU A;  3R4Y A;  2E75 C;  5KKZ C;  1GZL A;  3B4S A;  3NFQ A;  3TNU A;  1SFC C;  5AVZ B;  3CL3 D;  3TGU J;  1L4A A;  3VOP A;  2D2C D;  3VN0 A;  3B5N A;  2FFD B;  3G3Z A;  1JTH A;  1SQP J;  3CCV P;  1VQN P;  2I1J A;  4PV1 C;  3HTK B;  3LW5 H;  4KHX A;  1GMJ A;  3MZW B;  1RF1 A;  1GDT A;  1L4A D;  1PGJ A;  2A06 D;  2MJZ A;  1SQP D;  1W2E A;  2M0B A;  2WPV B;  2Z5I A;  2WSE H;  3M0D C;  2IYO A;  4JQ0 D;  5DJU B;  1QVF O;  2QVA A;  1YBK A;  3AE9 C;  1FJP A;  4PD4 I;  3Q5S A;  1IO4 A;  3P8C E;  1TU3 F;  1M1J A;  3HE4 A;  2KSJ A;  3FWL A;  3L74 J;  1GW3 A;  4WY4 A;  2PAJ A;  1UII A;  5GTI H;  1M1K Q;  4XFJ A;  2BCC D;  1OMI A;  2FXO A;  2FXP A;  4PD4 H;  5BVZ A;  2N1T A;  2V4H A;  1L0N J;  1LTJ A;  1IFJ A;  1NKZ B;  1X0T A;  3HUS A;  4TLF A;  3RK3 B;  3H1H G;  3TDK A;  1N7S A;  2FYU J;  2O1J A;  2BCC G;  5AVX B;  3WMM 0;  2W83 C;  1KFM A;  3H1L D;  4EIJ A;  1L2P A;  4H44 B;  4H13 D;  1P84 I;  1EZV E;  3UIA A;  3Q5P A;  1URQ A;  1OW8 A;  4PJ0 E;  3PRJ A;  1VF5 D;  1W5C E;  3B5N D;  3KYQ A;  2Q9I A;  2HYN A;  2OGU A;  4L74 A;  1BE3 J;  1LGH B;  1M1J B;  2WSC H;  3E7K A;  3HE4 B;  4Y99 C;  4D6T G;  3CCR P;  1KIL B;  3O6Q B;  5GTH E;  4N6J A;  1NTZ G;  2L91 A;  1NTM K;  2AEM A;  1L4A B;  4CPG A;  5E79 H;  4LLH A;  1HWT C;  1NWQ A;  2FYU D;  1M56 D;  1J1E C;  1KYO E;  2R5B A;  1N8R Q;  4GOE A;  3H1J D;  4TT3 H;  3CX5 D;  4Y28 J;  2FKW B;  3AEC C;  1SFC B;  3MP7 B;  4D6T E;  1GL2 C;  1SQX E;  3AE7 C;  3BRT B;  3IFM A;  4OGQ C;  3Q1M A;  4JBZ A;  2HPC B;  1EDL A;  1QX8 A;  4EOT A;  1SVF A;  1FE6 A;  2O01 J;  5CCH D;  1LT1 A;  3H1L G;  3S9O A;  1HF9 A;  4AQR D;  5KLV D;  5KAF H;  1FBM A;  1QVG O;  2QE7 H;  3L71 E;  4ZNC A;  3L70 G;  4GKG A;  3RL0 D;  2H8P D;  4UB8 E;  5H2F H;  4A7P A;  5E79 E;  4IFD K;  4UB6 E;  3CCE P;  1FU1 A;  1EQ7 A;  1G2C B;  2E5T A;  3HE5 A;  1NYH A;  1Q86 Q;  1GD2 E;  1JUN A;  5KJ7 D;  1SQQ J;  3VMZ A;  2E43 A;  4U3F J;  3H25 A;  3M0D A;  1IC2 A;  2Q7C A;  3RK2 B;  3L74 E;  1GTW A;  3BCC D;  1RF1 C;  3VYI A;  3JCU E;  1VPC A;  1E79 H;  2CK3 H;  2R32 A;  3GF3 A;  1FS0 E;  5AW6 B;  1S5L H;  3V6I A;  4PD4 E;  1Y8A A;  1BSN A;  1Z56 A;  1IJD B;  1YQ3 C;  1ZRT E;  5AVY B;  1YI2 P;  1YTZ T;  2E76 D;  4DOJ A;  3CCQ P;  2OYO A;  1G1J A;  2M8R A;  3EWK A;  3VTP C;  2QJK B;  4W7Z A;  1LT9 C;  2G8Y A;  1KN7 A;  3A7O A;  1J1D C;  1K04 A;  1K05 A;  2H88 C;  3T97 B;  2OYH B;  2C0X A;  1EXJ A;  3CC2 P;  3GHG B;  1NTK J;  1AVY A;  1VF5 B;  1FJK A;  3AEB C;  1OIP A;  2E42 A;  3CXH E;  4WB4 A;  4JYB A;  1URQ C;  2E75 B;  3H1I E;  1FZG A;  1HGZ A;  1MFZ A;  1BCC J;  1WMK A;  1IK7 A;  1GL2 D;  3FWN A;  2M5A A;  3L75 J;  3OJA B;  3VMA A;  1FZC C;  1J1E B;  1X8Y A;  1VQ9 P;  2L5G B;  3ITK A;  3RL0 B;  2XZR A;  1DEB A;  1JEK A;  2A06 E;  1HJ0 A;  1KOR A;  1SQP E;  1JCD A;  1PPJ G;  1VQ5 P;  3WUV A;  1FZC A;  1LTB C;  3CC7 P;  3L37 A;  3IR9 A;  1KC8 Q;  4KJM A;  2BAS A;  3TGU E;  3P8C D;  1FZA A;  2A45 G;  3L72 G;  1S9K E;  4K35 A;  1ZN5 A;  1RQV A;  5C39 A;  3AE2 C;  4Z1M H;  3M9B A;  5B5E E;  3TF5 A;  1HUC A;  1S5L X;  1LT9 A;  1IZN B;  1L0L J;  3A0B H;  2OTJ P;  3B71 A;  1LTG C;  1H89 A;  2OYI A;  2IDB A;  2J58 A;  4W7Y A;  3IF4 A;  3A0H H;  2K9Y A;  3H1L E;  3NXS A;  2WZ7 A;  2RN0 A;  5AVR B;  2QA4 P;  1YIT P;  2P2U A;  2HG5 D;  4YPC A;  1VQK P;  1D7M A;  4KT0 J;  1JNM A;  1LNQ A;  1OVR A;  1K73 Q;  1VL2 A;  5EFW B;  1JY3 P;  1RY3 A;  2IBZ E;  3GG2 A;  1KMI Z;  2KNC B;  5AVT B;  2QG4 A;  3H1K D;  2E74 B;  3JSV C;  2Y9Y A;  3TSI A;  3C8V A;  3CCJ P;  3KZI H;  2B89 A;  3M9H A;  1KIL C;  2FXM A;  2KLV A;  3A0B E;  2FYU E;  1SQB K;  1L0L E;  2N9Y B;  1SQP K;  3LIE A;  4ZMD A;  2N1T B;  3HUS B;  5KLV G;  2C9N Y;  2QRX A;  3II6 A;  3TYY A;  1RE3 A;  2HOD A;  1FAV A;  3Q2Y A;  3H1J E;  1S72 P;  1EDI A;  2RH0 A;  3CX5 H;  3A3Y B;  4QMA A;  2YMY A;  1SQX D;  1NHL A;  1QGK B;  3A2A A;  3MGN A;  1PIX A;  2DW3 A;  4BRY A;  3SWK A;  3VMY A;  1NU1 K;  3PLN A;  3Q5R A;  3B5N B;  1VQO P;  4C7N B;  1PFI A;  1H88 A;  1GK4 A;  4RKU J;  3RK3 E;  1SQV G;  3T97 A;  3VMX A;  1PP9 J;  1GU5 A;  5APW A;  1R8E A;  3G6E P;  2IBZ I;  1KB9 I;  3H1I J;  1BGY D;  1N73 B;  2WTY A;  3WU2 H;  3LID A;  3SWF A;  2M5A B;  2WPR A;  1MV8 A;  1KD1 Q;  3ZDM A;  2E75 D;  2JKV A;  1RF0 A;  1FOS E;  4N78 E;  5CBO A;  1IK9 A;  2KS1 B;  2WVR A;  5B66 E;  2YIU C;  1BGY J;  3KPE A;  2D2C C;  3CCU P;  4JPZ B;  2IZ0 A;  1WT6 A;  3H32 A;  2P10 A;  3JC2 2;  1RF1 B;  4PD4 D;  4WY4 D;  1W2B O;  3Q3D A;  2XNX A;  1ZRT D;  3S4R A;  1YJ9 P;  3GLM A;  1USE A;  2RMZ A;  3JCU H;  2PFX A;  5APS A;  1PP9 E;  1NTM J;  2GUS A;  1LTJ B;  2Z5H A;  4HJG H;  2WPQ A;  3L71 J;  1AJY A;  4U7J A;  3M0A A;  1LT9 B;  1MZ9 A;  1QLE D;  4IFF A;  3CME P;  4WBA A;  3VP8 A;  3CCL P;  1KB9 D;  1SQQ D;  2HOD B;  4DCK A;  2KS1 A;  2KXP B;  1MFT A;  3AE3 C;  4IL6 E;  3CXH D;  1NO4 A;  1NTM E;  3H1J J;  4M3L A;  3BVH A;  2K1A A;  3H1I D;  5AW9 B;  3I55 P;  1K9M Q;  1SQB D;  3CCS P;  3L73 D;  1YJN P;  4UB8 H;  3AE6 C;  5AW7 B;  1RF0 C;  1KYO I;  1NTZ K;  1U57 A;  5AW5 B;  2ITA A;  3KXD A;  1T2K C;  1K8A Q;  1FZC B;  2GM4 A;  2ZYD A;  3CXH I;  3MIW A;  4XE5 B;  2KLU A;  4HB1 A;  3L73 G;  3RL0 C;  2P67 A;  5KKZ B;  4ASV A;  2XU6 A;  3BCC G;  1M7L A;  1NU1 D;  2YO2 A;  3B5N C;  3CC4 P;  1KIL A;  2QJY B;  3O6Q A;  3H6P A;  1U7M A;  3TGU D;  5AVW B;  1FZE A;  3RGU A;  3RK2 C;  4C46 A;  1HH0 A;  1N73 A;  5AW1 B;  2VRS A;  4H13 B;  5CCG C;  1S9K D;  1OW7 A;  1HGV A;  2O3J A;  1AV1 A;  3IAO A;  2ZT9 B;  4PJ0 H;  2B87 B;  2E74 D;  3V2P A; 
#chains in the Genus database with same CATH homology
 1VF5 B;  3AEB C;  2E76 B;  1YQ4 C;  5KLI C;  2NZ2 A;  1RQU A;  1KIL E;  2E75 B;  4OGQ B;  2BEQ D;  4H0L B;  2E76 C;  1FDI A;  1WMK A;  2WSF J;  1IK7 A;  3AED C;  1DD3 A;  3AEA C;  3AEE C;  2V7Q J;  1HJ0 A;  1KOR A;  1KTM A;  1ZOY C;  2WSC J;  3D71 A;  3D70 A;  1Y9B A;  3AE1 C;  3FGA D;  3G9R A;  4I7Z B;  4H44 C;  3AEG C;  1RQV A;  4PV1 D;  3AE2 C;  4Z1M H;  2OQQ A;  3D6Y A;  1JB0 J;  1S5L X;  1DD4 A;  2E75 C;  3B71 A;  3R4Y A;  5KKZ C;  2IDB A;  2D2C D;  2K9Y A;  2G3A A;  5L8R J;  3D6Z A;  3SFD C;  2D2C B;  4KT0 J;  4PV1 C;  2YMK A;  4H0L D;  1GMJ A;  1OW6 A;  1VL2 A;  1MKM A;  1KQF B;  1KMI Z;  2WPV B;  2QJY C;  2E74 B;  3AE9 C;  3C8V A;  1KQG B;  4H13 C;  3Q5S A;  2E74 C;  2QJP C;  1TU3 F;  2ZT9 C;  3ABV C;  3Q2Y A;  4XFJ A;  1OMI A;  2FXP A;  1NGM B;  1PIX A;  2JP3 A;  3Q5R A;  3GF7 A;  2BEZ F;  4H13 D;  4H44 B;  3GMA A;  4RKU J;  3RK3 E;  2J5U A;  2FYN C;  3Q5P A;  1OW8 A;  4H44 D;  1S1C X;  1UIX A;  1VF5 D;  4YTP C;  1R8E A;  2QJK C;  2E75 D;  2YIU C;  2D2C C;  3AE8 C;  4PV1 B;  2P10 A;  4GDO A;  1VF5 C;  4TT3 H;  4Y28 J;  3AEC C;  3Q1M A;  3Q3D A;  3AE7 C;  4OGQ C;  3GLM A;  4H0L C;  2O01 J;  1EXI A;  2WSE J;  3S9O A;  1HF9 A;  1AJY A;  1Q90 D;  4U7J A;  3LW5 J;  3AEF C;  3AE4 C;  4YXD C;  2JO1 A;  3AE5 C;  2ZT9 D;  3AE3 C;  1FDO A;  1NYH A;  4OGQ D;  2FBW C;  4IL6 X;  5M1B A;  1ZP0 C;  3H25 A;  3AE6 C;  1ZME C;  1U57 A;  2MKV A;  1PL5 A;  1PV3 A;  2H89 C;  3GF3 A;  3RL0 g;  1YQ3 C;  1ZRT E;  2E76 D;  3O6Q A;  4R4M A;  2WQY C;  4I7Z C;  3IN6 A;  4R4L A;  3EWK A;  4H13 B;  1OW7 A;  2G8Y A;  2QIW A;  2QSI A;  3IAO A;  2ZT9 B;  2H88 C;  1K04 A;  1K05 A;  3T97 B;  1EXJ A;  1DIP A;  2E74 D;  3SFE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...