2K9YA

Epha2 dimeric structure in the lipidic bicelle at ph 5.0
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
41
structure length
41
Chain Sequence
EFQTLSPEGSGNLAVIGGVAVGVVLLLVLAGVGFFIHRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Left-Handed Dimer of EphA2 Transmembrane Domain: Helix Packing Diversity among Receptor Tyrosine Kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
total genus 10
structure length 41
sequence length 41
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2k9yA00
2O01J 1JB0J 3LW5J 5L8RJ 2WSCJ 2YIUC 4H0LB 2QSIA 2ZT9B 4KT0J 2K9YA 2QJKC 5KLIC 1S5LX 2D2CB 2E76B 2QJPC 5KKZC 4I7ZB 2FYNC 4RKUJ 1ZRTE 1Q90D 4IL6X 2QJYC 4PV1B 2QIWA 2WSFJ 2WPVB 4OGQB 4H44B 4Y28J 1VF5B 2WSEJ 4H13B 2E74B 2E75B 3C8VA
chains in the Genus database with same CATH superfamily
3NXSA 3L70E 3SWYA 1X9VA 2ZXXA 1N7SA 1LT1A 3H1IG 3GF3A 4IL6E 3L70J 5CJ0A 2K3RA 3BCCG 2C9NY 2P1JA 1AQ5A 1GL2C 1SVFA 3H1IJ 5AVXB 3FWNA 3T97A 2SPZA 1FJPA 2WPQA 1VF5D 1J1DB 3BCCJ 3RK2C 2OYHA 2ZYGA 4L75A 1L0NE 1X22A 1S5LX 1R5LA 4PD4H 1AVYA 1J2JB 5H2FH 4ZKPA 1IO4A 4AQRD 1OFCX 1CZQA 2E76B 2G3AA 2YKPA 1NU1G 1M7LA 1AA0A 2D2CC 4U3FG 5E79E 5KLVD 2WITA 1S5LE 2E75C 1SQQK 1K05A 1BGYG 1NO4A 2FYUD 2W6BA 2WPSA 3BASA 1ZR2A 1H0TB 1HGVA 3USSA 2WPRA 1L4AC 2R5BA 3L73D 1OW6A 2J58A 1OMIA 1SQQD 2PFXA 3HD7B 2K9JB 3CMAP 1K8AQ 1KILC 3L73G 2PP6A 4W7ZA 1RF1B 1WMKA 1NVOA 2AXTE 4H44C 1PV3A 4M3LA 2FYUG 3UIAA 3L75D 2V4HA 3GG2A 1QVGO 2P67A 2O01J 2GUSA 2P2UA 1YHQP 1GL2D 1RQUA 1TU3F 1IFNA 4GOFA 3RL0g 5GTIH 4NPEA 3CXHE 1JOCA 2WMMA 2YMKA 2GUVA 5GTIE 1SQXG 4XFJA 2A45I 1IFJA 3P7KA 3HE5B 2NPSB 1L0ND 4DOJA 1BE3G 4JYCA 3L75J 2YMYA 2E42A 1MFZA 2LXBA 2AEFA 3O6QA 3PLNA 1N73B 3IN6A 3MP7B 3D71A 3RK3C 2JP3A 1SQQJ 3L73J 3EFGA 4YXDC 1G2CB 1VQ6P 2FYUJ 3OAKA 4HB1A 2OYIA 1VQLP 1LWUC 1U7MA 2WSFH 4EYYQ 5GTHE 2N1TB 5KLVJ 3Q5PA 1LTSC 1FDIA 3AE4C 4OGQB 3TDKA 1MUUA 2WSSH 3V6IA 3TF5A 4RESB 1JTHB 2AEMA 1LJ2A 1ZP0C 2ZVNB 3MUDA 1KZUB 4LC1A 2D2CD 1VQMP 3GLMA 4AUWA 3H32A 1SFCA 1KQSO 3GMAA 2BCCG 1K04A 1SQVK 1URQA 3KYQA 1KC8Q 2LR2A 2K37A 3VYIA 1IFMA 3TGUE 1NTKE 3AEEC 2E76C 2IYPA 1LTBC 2MKVA 2QJPB 1J1DC 4XE5B 2C0XA 3RK3D 5CCHA 1DD3A 1JM0A 1SQPE 1NTZG 1S4XA 2QM8A 2O1JA 3MUDC 5AVUB 2E74D 2FFDB 4WY4D 1MKMA 3GHGB 1IFIA 2B9BA 1S72P 2HPCB 3GHGC 3M9BA 5APWA 3WUUA 3CXHI 1LT9B 3MGNA 3W68A 2ITAA 2FYNB 1EDKA 4PD4E 3P8CE 2Y9YA 5APQA 5APYA 4O9BA 1WRGA 1U7JA 1Y9BA 1L0LG 2CPBA 2ZJSE 3M9HA 1IFPA 2R3SA 4JF7A 4YPCA 1L4AB 3B5NA 1NAFA 2VRSA 1Y47A 1LTAC 3H1HG 5KLVE 1ZOYC 1URQC 3H1KE 3AE3C 3SFDC 2I1JA 3G4SP 3CCLP 5KLIB 1RF0A 1XTCC 3N7NA 5L8RJ 1NU1D 3WUTA 5KAIH 2PAJA 3H1KJ 2YIUC 4H0LB 1SQPG 1NAYA 5K5GB 1K73Q 1SS1A 1D7MA 1AV1A 4I1LA 3V4WA 4KHXA 3U59A 5KTBA 1LWUB 2L91A 1M1JA 2IPPA 5KLIC 4D6TD 3M0AA 2B87A 1N7SD 4IFMA 1SQXD 1Q7YQ 2W90A 1OVUA 3BCCE 4BXLA 3JCUE 3FXDA 2KS1A 1RE4A 3I56P 1LWUA 1CSBA 4DCKA 1DEBA 2IBZE 3OA7A 1VQ8P 1GL2A 2A45H 2OYHC 1VF5B 4A7PA 1G1IA 3B5NC 2CK3H 1DH3A 4I2LC 1LNQA 1FC2C 1YJ9P 1USEA 2E76D 1KN7A 1N7LA 5KAFE 3TGUD 1S5LH 1SQBG 3CWBG 3CX5H 2XU6A 1ZW0A 1NHLA 1RF0C 2R44A 3A2AA 3B5NB 1L4AA 3MTUE 1EDLA 1EZVE 4TLFA 2FFDC 1ZLLA 1BDDA 2FYZA 3A5TA 3CC4P 1JUNA 1PGOA 4QMAA 1FOSF 1PGJA 1FS0E 4H13D 1LT9A 2JDIH 4ZNCA 1SQBK 1BSNA 5CHXA 3AEAC 3H1HE 1QL1A 3GHGA 4Z1MH 2OYIC 1BGYE 1AJYA 3H1JG 5CBNA 2ZT9C 1Q90D 4AYCA 1RE3C 5AVTB 2P7JA 4W80A 1BCCJ 3VMAA 1RF1C 2NPSD 5AW3B 1NTZD 2YO2A 4DZOA 4ZKUA 5DJUB 1KFNA 4WWIA 3GF7A 2Z5IA 2O01H 3RL0D 2B89A 2Q5UA 2V7QJ 1URQB 2W6JH 1PPJG 3HTKA 5AW0B 3VP9A 5KAFH 3Q2YA 1HTLC 1NGMB 2E43A 1IC2A 1PP9J 2IFMA 1PP9D 4UB8E 1JTHA 1FDOA 1LTJC 4GKGA 2IBZD 2KSJA 1LP1B 3L36A 2KIKA 3TNUA 5KKZB 1Q2NA 3H1LD 4MN4C 1NTMG 3KPEA 3L4FA 2KOGA 2N1TA 3P32A 4H44D 1U57A 3V5BA 1KQGB 3L74D 1G2CA 1UIXA 1NTMJ 4JQ0D 4OVNF 1SQPJ 4TT3H 3CCMP 1EC5A 1BCCD 3SWKA 1RE4C 5CCHD 5KKZC 2J5UA 3HUSC 1YYCA 1NKZB 3O6QB 4C46A 1KILD 1KQLA 2Y0EA 3BRVB 3V2PA 3AE9C 4BRYA 1JO5A 2KYVA 1RE3A 5BU5A 2AXTH 2WSFJ 2HFED 2XZRA 2N1TC 3L71E 3KQGA 3KZIH 2NZ2A 1SQXE 2N9BA 2OTJP 1L0NK 1RY3A 3P8MC 4RO0A 2QA4P 5CJ4A 1GW3A 3RGUA 4EI2A 1T8ZA 1EZVI 2M0BA 2Q7CA 1M56D 1VF5C 1YBKA 3QH9A 1M1KQ 2WSCJ 2M5AA 1JY2O 2KI7B 2N9YB 1RF1A 2OQQA 2K9JA 2WSCH 3S1KA 3HD7A 1HWTC 2JKVA 4GT1A 1KORA 1J1EC 1YTZT 3RL0C 1LT9C 1PGPA 3KZIE 3CCJP 1BCCE 1H89A 3CL3D 1H0TA 3MIWA 2W27A 1HVVA 5AW7B 2XNXA 1N2DC 5M1BA 1CI6B 4PJ0H 4R4MA 4RKUJ 3CCVP 1PPJE 3HUSA 3L35A 4W7YA 1SQXK 1NTKK 1EZVD 2FXMA 2QVAA 5AVRB 1UIIA 3H6PA 3PP5A 4BWNA 4PD4D 1CW5A 3CXHD 4IOIH 3T97B 1KILE 4D6TG 3V2QA 1NTME 1GU5A 1OW7A 1RQVA 1M8OB 3VTPC 2A45G 1VQ4P 1M57D 1ZV8A 1GW4A 2E75B 2RH0A 3L72D 5AVWB 1FZCC 1G1JA 1JY3N 1N7SB 3R2PA 3AEBC 3RK2D 2JWDA 2H89C 3TGUJ 1ZMEC 3EFFK 2W6AA 3VP8A 1FZGA 4EDFA 2BEQD 1VL2A 3VMYA 2ZFCA 2POHA 3PTZA 3SSUA 5BU8B 2BEZF 2IZ1A 1FZAA 1NU1K 2KLUA 3B4SA 3Q1MA 1Q86Q 2P10A 5C39A 2Q3IA 1DEEG 1EXJA 1PP9G 3A3YB 3CXHH 2Y9ZA 1X79B 3JCUH 2ZXEB 4H0LC 4I7ZB 3RBZA 2WQYC 1SQBD 3CWBD 5EFWB 2YO3A 4B86A 1JY2N 1NH4A 1NU1E 1Y8AA 2PGDA 2WSEH 3H1HJ 1CI6A 3FWLA 1BGYJ 3HUSB 1VQKP 1BE3E 4N78E 1KYOE 3VMXA 2NRGA 4H13B 2KXPB 2FXOA 2IDBA 1JY3P 3EQ2A 1X0TA 2FY8A 3H1LG 3S4RA 3SWFA 3Q3DA 3R4YA 3IFMA 2KUBA 3A0BH 1NKNA 2Q1KA 1SQVJ 4OGQC 3FXEA 3IR9A 2M5AB 1LTJA 1GK6A 1LTTC 3H1LE 5TISE 1Z56A 1NTMK 3GW6A 5AW4B 4DJGA 3L70G 5CCHC 1PFIA 1USDA 1PP9E 1VQ9P 3NFQA 2ZT9B 1KMIZ 3AECC 3MD0A 4HJGH 3D6ZA 1FZCA 1J1EB 1FZBA 3RL0B 3E7KA 1QL2A 2D2CB 3OW2O 1URQD 1H8AA 1KD1Q 5E79H 1S9KE 2BCCE 3E1RA 2FXPA 3JSVC 3N4XA 3Q5SA 3G3ZA 4BRYB 2B88A 4GIFA 3CCSP 3WMM0 3M0DC 3V2RA 1M90Q 3M06A 1VDFA 3MHVA 1FZEA 1SFCD 2WPVB 4YTPC 2RKLA 2YXQB 4WVZA 2E5TA 2R5DA 2WTYA 5AW9B 1YITP 2E74B 1T3JA 3VOPA 1BDCA 1P84H 4HKZH 5B66E 3L71J 4D6TE 3A0BE 4U3FD 1LP1A 1NOHA 5AW6B 3TNUB 3I55P 1PL5A 2QJKB 2IYOA 1N73C 1KILB 3QWOC 1KB9H 1DX7A 5CCGA 3CLQA 1KYOH 1HH0A 1P84D 1QX8A 4LGDE 2JR8A 3HTKB 3KDPB 2Q3EA 2AEJA 1HUCA 2W8ZA 3L71D 4KT0J 4UB6H 2QE7H 2H43A 2HG5D 3V4QA 2YKOA 2JWAA 3A0HH 3WU2H 1T6AA 3W67A 1ZRTD 3MZWB 4Y99C 1W2EA 1ZRTE 3H1IE 3M9QA 4IL6X 1K9MQ 3A7OA 4C7NB 1GD2E 1QEXA 3AEFC 5AVSB 2G8YA 1L0NJ 4H0LD 5CMZA 3U1AA 2FYUE 3K5BA 2QM7A 2RN0A 5B5EH 2O01N 2KLVA 1KYOD 3VN0A 3AE1C 1KB9D 1NTKG 1T3UA 2O1KA 3BCCD 3IF4A 3M91A 1EZVG 3O8ZA 4U3FJ 3CCRP 3H1ID 3AE5C 2KZIA 4PJ0E 4WY4C 3LW5J 5AVYB 3CX5D 1A02F 1N86A 3CPWO 2A06E 4U3FE 4HYTB 1SQPK 2Z5HA 1JEKA 5AVZB 3HD7D 3TK1A 3F5HA 3FGAD 3AE2C 3G6EP 4RJTA 3HE4A 5CCGD 1W2BO 1NTZK 2ZYDA 1QVFO 3RK2B 5KJ7A 1SQBE 3CWBE 2H7HA 2MJZA 3BRTB 3C1LA 1BGYD 1GL2B 1HGZA 2ZYAA 3CI9A 2FYNC 3CX5E 3H1HD 3CCEP 1AFOA 1SQBJ 3CWBJ 1SQVG 3B8EB 3HD7C 1FBMA 2QG4A 2KS1B 2CPSA 2K88A 3P8CD 4GDOA 4GODA 3WUVA 2M3BA 2M8RA 2B87B 1WT6A 5DJTB 3L70D 1M1JB 3LW5H 1VPCA 3S9OA 1SQVD 1JY3O 2R3CA 1FAVA 2YKQA 3G9RA 3L75E 4L74A 1JB0J 2LXCB 3AE7C 4CPGA 1VQ5P 4LLHA 5CCGC 3H1JD 4WY4A 1PPJD 1Q81Q 1HJBA 3H1JE 3CC2P 1R8EA 3AE6C 3RBXA 2R32A 1YJNP 1NTKD 4NPFX 2HODA 3L74G 1P84I 1S1CX 2KSEA 3AE8C 3VMZA 4YXWH 2WT7B 1BE3D 1R5SA 4N78D 4L76A 1L0LD 3D70A 3G71P 1FE6A 3TYYA 2K1AA 4Y99B 4WBAA 2IBZG 1YQ3C 5KJ7C 2XNDH 1OX3A 4OH8B 2QEXP 3TGUG 1FOSE 2IZ0A 3AEGC 1HBWA 1W5CE 1T2KC 1HF9A 3TSIA 3B71A 4GOEA 1OW8A 2OARA 2HODB 3NTNA 2WT7A 2HPCA 3RK3B 4Y28J 2ZT9D 3L37A 3NMDA 3ABVC 4UB8H 5AW5B 5KLVK 2HR3A 4WY4B 1N73A 5TISH 2C9LY 2FKWB 3L72J 2IFNA 2BCCD 4IL6H 4HH2A 4OWFA 5APSA 1JCCA 4PV1D 1PGQA 2OGUA 1FDMA 1L2PA 2YXRB 1SFCB 3H32B 3L74E 4ASVA 2I1KA 2QSIA 5CBOA 1OVVA 3KXDA 2E5YA 5APTA 1GU4A 1QLED 2QJPC 2FYUK 2RMZA 3AEDC 3C9IA 1LTGC 3V2NA 3Q5RA 1S2EA 2OYIB 2JJLA 4L73A 1OWAA 5AVQB 3HE4B 5KLVG 1H88A 3CCQP 1EXIA 2WZ7A 1SQPD 3L72G 2HLOA 1MFTA 1NTMD 2KP8A 3CD6P 1SQQG 1OXZA 2KB7P 2V7QH 1DIPA 2JO1A 1SQVE 3I5CA 2WVRA 4ZMDA 2FBWC 2Q9IA 4JBZA 3PJSK 3H1LJ 5AW2B 2NPSA 1LGHB 1IFDA 3HE5A 4K3AA 1L0LK 4IFFA 2AXCA 2OTKE 1YTZI 1QGKB 1E5WA 3WU2E 3L75G 3PRJA 2H88C 5KJ7D 4EIJA 1IK9A 4C7NA 4U7JA 2H8PD 2O3JA 2E75D 2KZJA 5KAIE 1T2KD 2A06G 2UWJE 1XTGB 5AW1B 4I7ZC 2WWWA 4DT0A 1VQPP 4JYBA 3IAOA 1GZLA 4PV1C 1ZR4A 3L74J 4N6JA 1JCDA 1JNMA 1PZQA 3B5ND 2QJYC 4C7RA 3U1CA 1S9KD 3CMEP 2DW3A 3CC7P 2A06D 2QIWA 3PHLA 4ASWA 3CCUP 1NWQA 2LKMA 1IJDB 3L72E 1ZXGA 2Z4EA 1KFMA 3C8VA 1KILA 2Q6QA 1MZ9A 3PH0A 1KQFB 2JEEA 1YIJP 1ZN5A 2OYHB 1E79H 1PIXA 2BASA 1DD4A 2C0WA 2IX7C 4I6MC 1RH5B 3ZDMA 2YNYA 1EQ7A 4H13C 2XKMA 5H2FE 5APVA 1BCCG 1IK7A 2N1TD 2HYNA 1GTWA 1NTZJ 1A02J 1KV4A 4K35A 4OGQD 1RHZB 2FFDA 1X8YA 1SQQE 3JC22 4XA4A 1NTZE 1VQNP 3F89A 3E1IA 1OZHA 2I8DA 2GA1A 1SFCC 1YQ4C 1FU1A 1HJ0A 2L5GB 1EDIA 1JMBA 3CX5I 2ZVOB 3M0DA 4PD4I 4WB4A 1FZCB 3D6YA 3BVHA 3BATA 3ITKA 3OJAB 3FX0A 5B5EE 1SP4A 1L0NG 1LTIC 2KNCB 4H44B 1AVOA 1GMJA 2WSEJ 3H25A 1SLQA 5BVZA 2BCCJ 1LTJB 4NPDA 1FZFA 1NYHA 1M1JC 2NPSC 1NTKJ 5APXA 3H1KD 1MV8A 1N7SC 2J59M 3LIEA 4JPZB 4N3YB 5AW8B 3SFEC 1N8RQ 1YJWP 3H1KG 1JMMA 4KJMA 3II6A 1AQTA 2E74C 2W83C 3LIDA 2Y0CA 1BSHA 3A0HE 1YI2P 2Y0DA 2P58A 1GDTA 1NJIQ 1L4AD 2YIUB 2K9YA 2QJKC 2XV5A 1Q82Q 5GTHH 1KB9I 3L71G 1KB9E 1L0LE 2KNCA 2M3EA 1KYOI 4R4LA 1VQ7P 2ZAEB 1GK4A 1IZNB 1EDJA 1SQXJ 3KHUA 2KK7A 2QJYB 1OIPA 2PRRA 1L0LJ 1FJKA 3HRNA 4D6TJ 1BE3J 4IFDK 1P84E 4PV1B 5B66H 1S3JA 1OVRA 2XDJA 2IBZI 1VQOP 4UB6E 3EWKA 5APUA 4EOTA 2GM4A 1NU1J 3RK3E 5TJHA 1JY2P 3L73E 1KTMA 2OYOA 2OTLP 3H1JJ 5AVVB 2QRXA
chains in the Genus database with same CATH topology
2E76D 4OGQC 3GF3A 4PV1D 1VF5D 2QSIA 2ZT9B 1KMIZ 3AECC 4H13D 3D6ZA 1S5LX 2D2CB 2E76B 2G3AA 2QJPC 3AEAC 4Z1MH 2D2CC 2FXPA 1AJYA 3AEDC 2E75C 2ZT9C 1K05A 3Q5RA 3Q5SA 1Q90D 1OW6A 1OMIA 2WPVB 4YTPC 1EXIA 1DIPA 1WMKA 2E74B 3GF7A 2JO1A 1PV3A 4H44C 2FBWC 2V7QJ 2O01J 3Q2YA 1RQUA 1TU3F 3RL0g 1PL5A 2YMKA 1FDOA 4XFJA 2H88C 4H44D 4KT0J 1U57A 4U7JA 1KQGB 2E75D 1UIXA 3O6QA 4TT3H 3IN6A 4I7ZC 3D71A 2JP3A 5KKZC 3IAOA 4YXDC 2J5UA 4PV1C 1ZRTE 3AE9C 4IL6X 2QJYC 3Q5PA 3AEFC 2QIWA 2G8YA 2WSFJ 4H0LD 1FDIA 3AE4C 4OGQB 1ZP0C 2NZ2A 3C8VA 1KQFB 3AE1C 2D2CD 3GLMA 1PIXA 3AE5C 1DD4A 1K04A 3GMAA 3LW5J 1VF5C 4H13C 2WSCJ 3AEEC 1IK7A 2E76C 2OQQA 2MKVA 4OGQD 1DD3A 3FGAD 3AE2C 1KORA 2E74D 1MKMA 5M1BA 4R4MA 1YQ4C 2FYNC 4RKUJ 1HJ0A 3Q3DA 4GDOA 1Y9BA 3T97B 1KILE 4H44B 1OW7A 1RQVA 3H25A 1GMJA 2WSEJ 2E75B 3S9OA 1NYHA 3AEBC 3G9RA 2H89C 1ZMEC 1JB0J 1NGMB 3AE7C 3SFEC 1ZOYC 2BEQD 1VL2A 3AE3C 3SFDC 5L8RJ 1R8EA 2E74C 3AE6C 2BEZF 2YIUC 4H0LB 3Q1MA 1S1CX 2P10A 3AE8C 3D6YA 2K9YA 2QJKC 3D70A 5KLIC 1EXJA 4R4LA 1YQ3C 4H0LC 4I7ZB 2WQYC 3AEGC 1HF9A 4PV1B 3B71A 1OW8A 3EWKA 4Y28J 1VF5B 2ZT9D 3RK3E 4H13B 2IDBA 3ABVC 1KTMA 3R4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O01 J;  1JB0 J;  3LW5 J;  5L8R J;  2WSC J;  2YIU C;  4H0L B;  2QSI A;  2ZT9 B;  4KT0 J;  2K9Y A;  2QJK C;  5KLI C;  1S5L X;  2D2C B;  2E76 B;  2QJP C;  5KKZ C;  4I7Z B;  2FYN C;  4RKU J;  1ZRT E;  1Q90 D;  4IL6 X;  2QJY C;  4PV1 B;  2QIW A;  2WSF J;  2WPV B;  4OGQ B;  4H44 B;  4Y28 J;  1VF5 B;  2WSE J;  4H13 B;  2E74 B;  2E75 B;  3C8V A; 
#chains in the Genus database with same CATH topology
 3NXS A;  3L70 E;  3SWY A;  1X9V A;  2ZXX A;  1N7S A;  1LT1 A;  3H1I G;  3GF3 A;  4IL6 E;  3L70 J;  5CJ0 A;  2K3R A;  3BCC G;  2C9N Y;  2P1J A;  1AQ5 A;  1GL2 C;  1SVF A;  3H1I J;  5AVX B;  3FWN A;  3T97 A;  2SPZ A;  1FJP A;  2WPQ A;  1VF5 D;  1J1D B;  3BCC J;  3RK2 C;  2OYH A;  2ZYG A;  4L75 A;  1L0N E;  1X22 A;  1S5L X;  1R5L A;  4PD4 H;  1AVY A;  1J2J B;  5H2F H;  4ZKP A;  1IO4 A;  4AQR D;  1OFC X;  1CZQ A;  2E76 B;  2G3A A;  2YKP A;  1NU1 G;  1M7L A;  1AA0 A;  2D2C C;  4U3F G;  5E79 E;  5KLV D;  2WIT A;  1S5L E;  2E75 C;  1SQQ K;  1K05 A;  1BGY G;  1NO4 A;  2FYU D;  2W6B A;  2WPS A;  3BAS A;  1ZR2 A;  1H0T B;  1HGV A;  3USS A;  2WPR A;  1L4A C;  2R5B A;  3L73 D;  1OW6 A;  2J58 A;  1OMI A;  1SQQ D;  2PFX A;  3HD7 B;  2K9J B;  3CMA P;  1K8A Q;  1KIL C;  3L73 G;  2PP6 A;  4W7Z A;  1RF1 B;  1WMK A;  1NVO A;  2AXT E;  4H44 C;  1PV3 A;  4M3L A;  2FYU G;  3UIA A;  3L75 D;  2V4H A;  3GG2 A;  1QVG O;  2P67 A;  2O01 J;  2GUS A;  2P2U A;  1YHQ P;  1GL2 D;  1RQU A;  1TU3 F;  1IFN A;  4GOF A;  3RL0 g;  5GTI H;  4NPE A;  3CXH E;  1JOC A;  2WMM A;  2YMK A;  2GUV A;  5GTI E;  1SQX G;  4XFJ A;  2A45 I;  1IFJ A;  3P7K A;  3HE5 B;  2NPS B;  1L0N D;  4DOJ A;  1BE3 G;  4JYC A;  3L75 J;  2YMY A;  2E42 A;  1MFZ A;  2LXB A;  2AEF A;  3O6Q A;  3PLN A;  1N73 B;  3IN6 A;  3MP7 B;  3D71 A;  3RK3 C;  2JP3 A;  1SQQ J;  3L73 J;  3EFG A;  4YXD C;  1G2C B;  1VQ6 P;  2FYU J;  3OAK A;  4HB1 A;  2OYI A;  1VQL P;  1LWU C;  1U7M A;  2WSF H;  4EYY Q;  5GTH E;  2N1T B;  5KLV J;  3Q5P A;  1LTS C;  1FDI A;  3AE4 C;  4OGQ B;  3TDK A;  1MUU A;  2WSS H;  3V6I A;  3TF5 A;  4RES B;  1JTH B;  2AEM A;  1LJ2 A;  1ZP0 C;  2ZVN B;  3MUD A;  1KZU B;  4LC1 A;  2D2C D;  1VQM P;  3GLM A;  4AUW A;  3H32 A;  1SFC A;  1KQS O;  3GMA A;  2BCC G;  1K04 A;  1SQV K;  1URQ A;  3KYQ A;  1KC8 Q;  2LR2 A;  2K37 A;  3VYI A;  1IFM A;  3TGU E;  1NTK E;  3AEE C;  2E76 C;  2IYP A;  1LTB C;  2MKV A;  2QJP B;  1J1D C;  4XE5 B;  2C0X A;  3RK3 D;  5CCH A;  1DD3 A;  1JM0 A;  1SQP E;  1NTZ G;  1S4X A;  2QM8 A;  2O1J A;  3MUD C;  5AVU B;  2E74 D;  2FFD B;  4WY4 D;  1MKM A;  3GHG B;  1IFI A;  2B9B A;  1S72 P;  2HPC B;  3GHG C;  3M9B A;  5APW A;  3WUU A;  3CXH I;  1LT9 B;  3MGN A;  3W68 A;  2ITA A;  2FYN B;  1EDK A;  4PD4 E;  3P8C E;  2Y9Y A;  5APQ A;  5APY A;  4O9B A;  1WRG A;  1U7J A;  1Y9B A;  1L0L G;  2CPB A;  2ZJS E;  3M9H A;  1IFP A;  2R3S A;  4JF7 A;  4YPC A;  1L4A B;  3B5N A;  1NAF A;  2VRS A;  1Y47 A;  1LTA C;  3H1H G;  5KLV E;  1ZOY C;  1URQ C;  3H1K E;  3AE3 C;  3SFD C;  2I1J A;  3G4S P;  3CCL P;  5KLI B;  1RF0 A;  1XTC C;  3N7N A;  5L8R J;  1NU1 D;  3WUT A;  5KAI H;  2PAJ A;  3H1K J;  2YIU C;  4H0L B;  1SQP G;  1NAY A;  5K5G B;  1K73 Q;  1SS1 A;  1D7M A;  1AV1 A;  4I1L A;  3V4W A;  4KHX A;  3U59 A;  5KTB A;  1LWU B;  2L91 A;  1M1J A;  2IPP A;  5KLI C;  4D6T D;  3M0A A;  2B87 A;  1N7S D;  4IFM A;  1SQX D;  1Q7Y Q;  2W90 A;  1OVU A;  3BCC E;  4BXL A;  3JCU E;  3FXD A;  2KS1 A;  1RE4 A;  3I56 P;  1LWU A;  1CSB A;  4DCK A;  1DEB A;  2IBZ E;  3OA7 A;  1VQ8 P;  1GL2 A;  2A45 H;  2OYH C;  1VF5 B;  4A7P A;  1G1I A;  3B5N C;  2CK3 H;  1DH3 A;  4I2L C;  1LNQ A;  1FC2 C;  1YJ9 P;  1USE A;  2E76 D;  1KN7 A;  1N7L A;  5KAF E;  3TGU D;  1S5L H;  1SQB G;  3CWB G;  3CX5 H;  2XU6 A;  1ZW0 A;  1NHL A;  1RF0 C;  2R44 A;  3A2A A;  3B5N B;  1L4A A;  3MTU E;  1EDL A;  1EZV E;  4TLF A;  2FFD C;  1ZLL A;  1BDD A;  2FYZ A;  3A5T A;  3CC4 P;  1JUN A;  1PGO A;  4QMA A;  1FOS F;  1PGJ A;  1FS0 E;  4H13 D;  1LT9 A;  2JDI H;  4ZNC A;  1SQB K;  1BSN A;  5CHX A;  3AEA C;  3H1H E;  1QL1 A;  3GHG A;  4Z1M H;  2OYI C;  1BGY E;  1AJY A;  3H1J G;  5CBN A;  2ZT9 C;  1Q90 D;  4AYC A;  1RE3 C;  5AVT B;  2P7J A;  4W80 A;  1BCC J;  3VMA A;  1RF1 C;  2NPS D;  5AW3 B;  1NTZ D;  2YO2 A;  4DZO A;  4ZKU A;  5DJU B;  1KFN A;  4WWI A;  3GF7 A;  2Z5I A;  2O01 H;  3RL0 D;  2B89 A;  2Q5U A;  2V7Q J;  1URQ B;  2W6J H;  1PPJ G;  3HTK A;  5AW0 B;  3VP9 A;  5KAF H;  3Q2Y A;  1HTL C;  1NGM B;  2E43 A;  1IC2 A;  1PP9 J;  2IFM A;  1PP9 D;  4UB8 E;  1JTH A;  1FDO A;  1LTJ C;  4GKG A;  2IBZ D;  2KSJ A;  1LP1 B;  3L36 A;  2KIK A;  3TNU A;  5KKZ B;  1Q2N A;  3H1L D;  4MN4 C;  1NTM G;  3KPE A;  3L4F A;  2KOG A;  2N1T A;  3P32 A;  4H44 D;  1U57 A;  3V5B A;  1KQG B;  3L74 D;  1G2C A;  1UIX A;  1NTM J;  4JQ0 D;  4OVN F;  1SQP J;  4TT3 H;  3CCM P;  1EC5 A;  1BCC D;  3SWK A;  1RE4 C;  5CCH D;  5KKZ C;  2J5U A;  3HUS C;  1YYC A;  1NKZ B;  3O6Q B;  4C46 A;  1KIL D;  1KQL A;  2Y0E A;  3BRV B;  3V2P A;  3AE9 C;  4BRY A;  1JO5 A;  2KYV A;  1RE3 A;  5BU5 A;  2AXT H;  2WSF J;  2HFE D;  2XZR A;  2N1T C;  3L71 E;  3KQG A;  3KZI H;  2NZ2 A;  1SQX E;  2N9B A;  2OTJ P;  1L0N K;  1RY3 A;  3P8M C;  4RO0 A;  2QA4 P;  5CJ4 A;  1GW3 A;  3RGU A;  4EI2 A;  1T8Z A;  1EZV I;  2M0B A;  2Q7C A;  1M56 D;  1VF5 C;  1YBK A;  3QH9 A;  1M1K Q;  2WSC J;  2M5A A;  1JY2 O;  2KI7 B;  2N9Y B;  1RF1 A;  2OQQ A;  2K9J A;  2WSC H;  3S1K A;  3HD7 A;  1HWT C;  2JKV A;  4GT1 A;  1KOR A;  1J1E C;  1YTZ T;  3RL0 C;  1LT9 C;  1PGP A;  3KZI E;  3CCJ P;  1BCC E;  1H89 A;  3CL3 D;  1H0T A;  3MIW A;  2W27 A;  1HVV A;  5AW7 B;  2XNX A;  1N2D C;  5M1B A;  1CI6 B;  4PJ0 H;  4R4M A;  4RKU J;  3CCV P;  1PPJ E;  3HUS A;  3L35 A;  4W7Y A;  1SQX K;  1NTK K;  1EZV D;  2FXM A;  2QVA A;  5AVR B;  1UII A;  3H6P A;  3PP5 A;  4BWN A;  4PD4 D;  1CW5 A;  3CXH D;  4IOI H;  3T97 B;  1KIL E;  4D6T G;  3V2Q A;  1NTM E;  1GU5 A;  1OW7 A;  1RQV A;  1M8O B;  3VTP C;  2A45 G;  1VQ4 P;  1M57 D;  1ZV8 A;  1GW4 A;  2E75 B;  2RH0 A;  3L72 D;  5AVW B;  1FZC C;  1G1J A;  1JY3 N;  1N7S B;  3R2P A;  3AEB C;  3RK2 D;  2JWD A;  2H89 C;  3TGU J;  1ZME C;  3EFF K;  2W6A A;  3VP8 A;  1FZG A;  4EDF A;  2BEQ D;  1VL2 A;  3VMY A;  2ZFC A;  2POH A;  3PTZ A;  3SSU A;  5BU8 B;  2BEZ F;  2IZ1 A;  1FZA A;  1NU1 K;  2KLU A;  3B4S A;  3Q1M A;  1Q86 Q;  2P10 A;  5C39 A;  2Q3I A;  1DEE G;  1EXJ A;  1PP9 G;  3A3Y B;  3CXH H;  2Y9Z A;  1X79 B;  3JCU H;  2ZXE B;  4H0L C;  4I7Z B;  3RBZ A;  2WQY C;  1SQB D;  3CWB D;  5EFW B;  2YO3 A;  4B86 A;  1JY2 N;  1NH4 A;  1NU1 E;  1Y8A A;  2PGD A;  2WSE H;  3H1H J;  1CI6 A;  3FWL A;  1BGY J;  3HUS B;  1VQK P;  1BE3 E;  4N78 E;  1KYO E;  3VMX A;  2NRG A;  4H13 B;  2KXP B;  2FXO A;  2IDB A;  1JY3 P;  3EQ2 A;  1X0T A;  2FY8 A;  3H1L G;  3S4R A;  3SWF A;  3Q3D A;  3R4Y A;  3IFM A;  2KUB A;  3A0B H;  1NKN A;  2Q1K A;  1SQV J;  4OGQ C;  3FXE A;  3IR9 A;  2M5A B;  1LTJ A;  1GK6 A;  1LTT C;  3H1L E;  5TIS E;  1Z56 A;  1NTM K;  3GW6 A;  5AW4 B;  4DJG A;  3L70 G;  5CCH C;  1PFI A;  1USD A;  1PP9 E;  1VQ9 P;  3NFQ A;  2ZT9 B;  1KMI Z;  3AEC C;  3MD0 A;  4HJG H;  3D6Z A;  1FZC A;  1J1E B;  1FZB A;  3RL0 B;  3E7K A;  1QL2 A;  2D2C B;  3OW2 O;  1URQ D;  1H8A A;  1KD1 Q;  5E79 H;  1S9K E;  2BCC E;  3E1R A;  2FXP A;  3JSV C;  3N4X A;  3Q5S A;  3G3Z A;  4BRY B;  2B88 A;  4GIF A;  3CCS P;  3WMM 0;  3M0D C;  3V2R A;  1M90 Q;  3M06 A;  1VDF A;  3MHV A;  1FZE A;  1SFC D;  2WPV B;  4YTP C;  2RKL A;  2YXQ B;  4WVZ A;  2E5T A;  2R5D A;  2WTY A;  5AW9 B;  1YIT P;  2E74 B;  1T3J A;  3VOP A;  1BDC A;  1P84 H;  4HKZ H;  5B66 E;  3L71 J;  4D6T E;  3A0B E;  4U3F D;  1LP1 A;  1NOH A;  5AW6 B;  3TNU B;  3I55 P;  1PL5 A;  2QJK B;  2IYO A;  1N73 C;  1KIL B;  3QWO C;  1KB9 H;  1DX7 A;  5CCG A;  3CLQ A;  1KYO H;  1HH0 A;  1P84 D;  1QX8 A;  4LGD E;  2JR8 A;  3HTK B;  3KDP B;  2Q3E A;  2AEJ A;  1HUC A;  2W8Z A;  3L71 D;  4KT0 J;  4UB6 H;  2QE7 H;  2H43 A;  2HG5 D;  3V4Q A;  2YKO A;  2JWA A;  3A0H H;  3WU2 H;  1T6A A;  3W67 A;  1ZRT D;  3MZW B;  4Y99 C;  1W2E A;  1ZRT E;  3H1I E;  3M9Q A;  4IL6 X;  1K9M Q;  3A7O A;  4C7N B;  1GD2 E;  1QEX A;  3AEF C;  5AVS B;  2G8Y A;  1L0N J;  4H0L D;  5CMZ A;  3U1A A;  2FYU E;  3K5B A;  2QM7 A;  2RN0 A;  5B5E H;  2O01 N;  2KLV A;  1KYO D;  3VN0 A;  3AE1 C;  1KB9 D;  1NTK G;  1T3U A;  2O1K A;  3BCC D;  3IF4 A;  3M91 A;  1EZV G;  3O8Z A;  4U3F J;  3CCR P;  3H1I D;  3AE5 C;  2KZI A;  4PJ0 E;  4WY4 C;  3LW5 J;  5AVY B;  3CX5 D;  1A02 F;  1N86 A;  3CPW O;  2A06 E;  4U3F E;  4HYT B;  1SQP K;  2Z5H A;  1JEK A;  5AVZ B;  3HD7 D;  3TK1 A;  3F5H A;  3FGA D;  3AE2 C;  3G6E P;  4RJT A;  3HE4 A;  5CCG D;  1W2B O;  1NTZ K;  2ZYD A;  1QVF O;  3RK2 B;  5KJ7 A;  1SQB E;  3CWB E;  2H7H A;  2MJZ A;  3BRT B;  3C1L A;  1BGY D;  1GL2 B;  1HGZ A;  2ZYA A;  3CI9 A;  2FYN C;  3CX5 E;  3H1H D;  3CCE P;  1AFO A;  1SQB J;  3CWB J;  1SQV G;  3B8E B;  3HD7 C;  1FBM A;  2QG4 A;  2KS1 B;  2CPS A;  2K88 A;  3P8C D;  4GDO A;  4GOD A;  3WUV A;  2M3B A;  2M8R A;  2B87 B;  1WT6 A;  5DJT B;  3L70 D;  1M1J B;  3LW5 H;  1VPC A;  3S9O A;  1SQV D;  1JY3 O;  2R3C A;  1FAV A;  2YKQ A;  3G9R A;  3L75 E;  4L74 A;  1JB0 J;  2LXC B;  3AE7 C;  4CPG A;  1VQ5 P;  4LLH A;  5CCG C;  3H1J D;  4WY4 A;  1PPJ D;  1Q81 Q;  1HJB A;  3H1J E;  3CC2 P;  1R8E A;  3AE6 C;  3RBX A;  2R32 A;  1YJN P;  1NTK D;  4NPF X;  2HOD A;  3L74 G;  1P84 I;  1S1C X;  2KSE A;  3AE8 C;  3VMZ A;  4YXW H;  2WT7 B;  1BE3 D;  1R5S A;  4N78 D;  4L76 A;  1L0L D;  3D70 A;  3G71 P;  1FE6 A;  3TYY A;  2K1A A;  4Y99 B;  4WBA A;  2IBZ G;  1YQ3 C;  5KJ7 C;  2XND H;  1OX3 A;  4OH8 B;  2QEX P;  3TGU G;  1FOS E;  2IZ0 A;  3AEG C;  1HBW A;  1W5C E;  1T2K C;  1HF9 A;  3TSI A;  3B71 A;  4GOE A;  1OW8 A;  2OAR A;  2HOD B;  3NTN A;  2WT7 A;  2HPC A;  3RK3 B;  4Y28 J;  2ZT9 D;  3L37 A;  3NMD A;  3ABV C;  4UB8 H;  5AW5 B;  5KLV K;  2HR3 A;  4WY4 B;  1N73 A;  5TIS H;  2C9L Y;  2FKW B;  3L72 J;  2IFN A;  2BCC D;  4IL6 H;  4HH2 A;  4OWF A;  5APS A;  1JCC A;  4PV1 D;  1PGQ A;  2OGU A;  1FDM A;  1L2P A;  2YXR B;  1SFC B;  3H32 B;  3L74 E;  4ASV A;  2I1K A;  2QSI A;  5CBO A;  1OVV A;  3KXD A;  2E5Y A;  5APT A;  1GU4 A;  1QLE D;  2QJP C;  2FYU K;  2RMZ A;  3AED C;  3C9I A;  1LTG C;  3V2N A;  3Q5R A;  1S2E A;  2OYI B;  2JJL A;  4L73 A;  1OWA A;  5AVQ B;  3HE4 B;  5KLV G;  1H88 A;  3CCQ P;  1EXI A;  2WZ7 A;  1SQP D;  3L72 G;  2HLO A;  1MFT A;  1NTM D;  2KP8 A;  3CD6 P;  1SQQ G;  1OXZ A;  2KB7 P;  2V7Q H;  1DIP A;  2JO1 A;  1SQV E;  3I5C A;  2WVR A;  4ZMD A;  2FBW C;  2Q9I A;  4JBZ A;  3PJS K;  3H1L J;  5AW2 B;  2NPS A;  1LGH B;  1IFD A;  3HE5 A;  4K3A A;  1L0L K;  4IFF A;  2AXC A;  2OTK E;  1YTZ I;  1QGK B;  1E5W A;  3WU2 E;  3L75 G;  3PRJ A;  2H88 C;  5KJ7 D;  4EIJ A;  1IK9 A;  4C7N A;  4U7J A;  2H8P D;  2O3J A;  2E75 D;  2KZJ A;  5KAI E;  1T2K D;  2A06 G;  2UWJ E;  1XTG B;  5AW1 B;  4I7Z C;  2WWW A;  4DT0 A;  1VQP P;  4JYB A;  3IAO A;  1GZL A;  4PV1 C;  1ZR4 A;  3L74 J;  4N6J A;  1JCD A;  1JNM A;  1PZQ A;  3B5N D;  2QJY C;  4C7R A;  3U1C A;  1S9K D;  3CME P;  2DW3 A;  3CC7 P;  2A06 D;  2QIW A;  3PHL A;  4ASW A;  3CCU P;  1NWQ A;  2LKM A;  1IJD B;  3L72 E;  1ZXG A;  2Z4E A;  1KFM A;  3C8V A;  1KIL A;  2Q6Q A;  1MZ9 A;  3PH0 A;  1KQF B;  2JEE A;  1YIJ P;  1ZN5 A;  2OYH B;  1E79 H;  1PIX A;  2BAS A;  1DD4 A;  2C0W A;  2IX7 C;  4I6M C;  1RH5 B;  3ZDM A;  2YNY A;  1EQ7 A;  4H13 C;  2XKM A;  5H2F E;  5APV A;  1BCC G;  1IK7 A;  2N1T D;  2HYN A;  1GTW A;  1NTZ J;  1A02 J;  1KV4 A;  4K35 A;  4OGQ D;  1RHZ B;  2FFD A;  1X8Y A;  1SQQ E;  3JC2 2;  4XA4 A;  1NTZ E;  1VQN P;  3F89 A;  3E1I A;  1OZH A;  2I8D A;  2GA1 A;  1SFC C;  1YQ4 C;  1FU1 A;  1HJ0 A;  2L5G B;  1EDI A;  1JMB A;  3CX5 I;  2ZVO B;  3M0D A;  4PD4 I;  4WB4 A;  1FZC B;  3D6Y A;  3BVH A;  3BAT A;  3ITK A;  3OJA B;  3FX0 A;  5B5E E;  1SP4 A;  1L0N G;  1LTI C;  2KNC B;  4H44 B;  1AVO A;  1GMJ A;  2WSE J;  3H25 A;  1SLQ A;  5BVZ A;  2BCC J;  1LTJ B;  4NPD A;  1FZF A;  1NYH A;  1M1J C;  2NPS C;  1NTK J;  5APX A;  3H1K D;  1MV8 A;  1N7S C;  2J59 M;  3LIE A;  4JPZ B;  4N3Y B;  5AW8 B;  3SFE C;  1N8R Q;  1YJW P;  3H1K G;  1JMM A;  4KJM A;  3II6 A;  1AQT A;  2E74 C;  2W83 C;  3LID A;  2Y0C A;  1BSH A;  3A0H E;  1YI2 P;  2Y0D A;  2P58 A;  1GDT A;  1NJI Q;  1L4A D;  2YIU B;  2K9Y A;  2QJK C;  2XV5 A;  1Q82 Q;  5GTH H;  1KB9 I;  3L71 G;  1KB9 E;  1L0L E;  2KNC A;  2M3E A;  1KYO I;  4R4L A;  1VQ7 P;  2ZAE B;  1GK4 A;  1IZN B;  1EDJ A;  1SQX J;  3KHU A;  2KK7 A;  2QJY B;  1OIP A;  2PRR A;  1L0L J;  1FJK A;  3HRN A;  4D6T J;  1BE3 J;  4IFD K;  1P84 E;  4PV1 B;  5B66 H;  1S3J A;  1OVR A;  2XDJ A;  2IBZ I;  1VQO P;  4UB6 E;  3EWK A;  5APU A;  4EOT A;  2GM4 A;  1NU1 J;  3RK3 E;  5TJH A;  1JY2 P;  3L73 E;  1KTM A;  2OYO A;  2OTL P;  3H1J J;  5AVV B;  2QRX A; 
#chains in the Genus database with same CATH homology
 2E76 D;  4OGQ C;  3GF3 A;  4PV1 D;  1VF5 D;  2QSI A;  2ZT9 B;  1KMI Z;  3AEC C;  4H13 D;  3D6Z A;  1S5L X;  2D2C B;  2E76 B;  2G3A A;  2QJP C;  3AEA C;  4Z1M H;  2D2C C;  2FXP A;  1AJY A;  3AED C;  2E75 C;  2ZT9 C;  1K05 A;  3Q5R A;  3Q5S A;  1Q90 D;  1OW6 A;  1OMI A;  2WPV B;  4YTP C;  1EXI A;  1DIP A;  1WMK A;  2E74 B;  3GF7 A;  2JO1 A;  1PV3 A;  4H44 C;  2FBW C;  2V7Q J;  2O01 J;  3Q2Y A;  1RQU A;  1TU3 F;  3RL0 g;  1PL5 A;  2YMK A;  1FDO A;  4XFJ A;  2H88 C;  4H44 D;  4KT0 J;  1U57 A;  4U7J A;  1KQG B;  2E75 D;  1UIX A;  3O6Q A;  4TT3 H;  3IN6 A;  4I7Z C;  3D71 A;  2JP3 A;  5KKZ C;  3IAO A;  4YXD C;  2J5U A;  4PV1 C;  1ZRT E;  3AE9 C;  4IL6 X;  2QJY C;  3Q5P A;  3AEF C;  2QIW A;  2G8Y A;  2WSF J;  4H0L D;  1FDI A;  3AE4 C;  4OGQ B;  1ZP0 C;  2NZ2 A;  3C8V A;  1KQF B;  3AE1 C;  2D2C D;  3GLM A;  1PIX A;  3AE5 C;  1DD4 A;  1K04 A;  3GMA A;  3LW5 J;  1VF5 C;  4H13 C;  2WSC J;  3AEE C;  1IK7 A;  2E76 C;  2OQQ A;  2MKV A;  4OGQ D;  1DD3 A;  3FGA D;  3AE2 C;  1KOR A;  2E74 D;  1MKM A;  5M1B A;  4R4M A;  1YQ4 C;  2FYN C;  4RKU J;  1HJ0 A;  3Q3D A;  4GDO A;  1Y9B A;  3T97 B;  1KIL E;  4H44 B;  1OW7 A;  1RQV A;  3H25 A;  1GMJ A;  2WSE J;  2E75 B;  3S9O A;  1NYH A;  3AEB C;  3G9R A;  2H89 C;  1ZME C;  1JB0 J;  1NGM B;  3AE7 C;  3SFE C;  1ZOY C;  2BEQ D;  1VL2 A;  3AE3 C;  3SFD C;  5L8R J;  1R8E A;  2E74 C;  3AE6 C;  2BEZ F;  2YIU C;  4H0L B;  3Q1M A;  1S1C X;  2P10 A;  3AE8 C;  3D6Y A;  2K9Y A;  2QJK C;  3D70 A;  5KLI C;  1EXJ A;  4R4L A;  1YQ3 C;  4H0L C;  4I7Z B;  2WQY C;  3AEG C;  1HF9 A;  4PV1 B;  3B71 A;  1OW8 A;  3EWK A;  4Y28 J;  1VF5 B;  2ZT9 D;  3RK3 E;  4H13 B;  2IDB A;  3ABV C;  1KTM A;  3R4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...