2K9YA

Epha2 dimeric structure in the lipidic bicelle at ph 5.0
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
41
structure length
41
Chain Sequence
EFQTLSPEGSGNLAVIGGVAVGVVLLLVLAGVGFFIHRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 2
publication title Left-Handed Dimer of EphA2 Transmembrane Domain: Helix Packing Diversity among Receptor Tyrosine Kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 10
structure length 41
sequence length 41
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2k9yA00
2E76B 2ZT9B 2E74B 5L8RJ 1VF5B 4I7ZB 4IL6X 4PV1B 4H44B 4RKUJ 4H0LB 2QJPC 2O01J 2WPVB 1S5LX 3C8VA 5KLIC 2QSIA 2K9YA 4Y28J 2D2CB 4KT0J 3LW5J 1ZRTE 2QIWA 2FYNC 1Q90D 2QJKC 2QJYC 5KKZC 4H13B 4OGQB 2WSCJ 2WSEJ 2WSFJ 2YIUC 1JB0J 2E75B
chains in the Genus database with same CATH superfamily
1KTMA 1KYOD 1KZUB 1XTGB 2L91A 3AE9C 3KZIE 1R8EA 3MGNA 5B66E 3M9QA 2GM4A 2E75D 1BGYG 3CCSP 1MV8A 3GHGC 1FJKA 3CCUP 3HTKA 2XV5A 1BGYD 2WSEH 1KD1Q 1W5CE 3RBZA 2OARA 1KB9D 1BE3E 4PD4H 1PP9J 4PJ0H 5APYA 1OVVA 2OYHB 4KHXA 3RL0B 1IJDB 2FYUE 4OH8B 4TT3H 3E1IA 2Q1KA 2IZ0A 5KKZB 3RL0g 2QEXP 5H2FE 2M3BA 3WUUA 4WBAA 1IFPA 1S5LX 3S4RA 2ITAA 3NFQA 5KLIC 1BSNA 4H13C 2KK7A 2WT7B 4BXLA 1KN7A 2OYIC 1SS1A 5AW6B 5AVWB 1KV4A 3AEGC 2J59M 2V7QJ 1T8ZA 1S1CX 1L0NE 3H1HJ 2FYNC 1S9KE 3HUSB 1NTZJ 3Q3DA 1KILC 1WRGA 2E74B 3HE5B 1P84E 1TU3F 2Q6QA 1M8OB 1G1JA 2C9LY 2KYVA 1DIPA 2WPSA 3TGUE 2K1AA 2OQQA 1PGOA 3H1LG 1FJPA 5AW0B 3GHGB 1QEXA 3H1LD 3L73J 1HTLC 3KHUA 1U7JA 2WT7A 1J1EC 2HLOA 1FE6A 3EFFK 3RL0D 3IFMA 1AV1A 3ZDMA 3CCLP 4U3FJ 2FFDC 3JC22 1FAVA 1OMIA 3CCRP 5CJ0A 1M1JC 1X0TA 5KLIB 3KDPB 1RQUA 2K88A 3H1IG 4H13B 1NTZK 4NPDA 3RK3C 5B5EE 2Z5HA 1FZGA 3FGAD 3HE5A 3H1ID 1LNQA 3H25A 1N86A 3QH9A 1YTZT 3W67A 1FDOA 1RE4A 2KNCB 1Q2NA 1Y9BA 4JYCA 1SQPE 2FYNB 1USDA 1NGMB 1QVFO 2R32A 4H0LC 3FXDA 3RK2C 1KILB 4OVNF 2E74D 4D6TG 1VQ7P 1QL2A 1BDCA 4M3LA 3P8CD 3TNUB 1NTKE 4D6TD 3V2QA 2FXPA 2IZ1A 2N9YB 1EC5A 1ZV8A 3PJSK 1SQQJ 3IR9A 2OGUA 1S5LE 2Y0CA 3CX5H 1KYOH 1X9VA 3B5NA 1J1EB 2O1KA 4NPFX 1SQXG 3G3ZA 5APWA 2N1TB 1KMIZ 4O9BA 3BCCG 3SSUA 4L76A 1N7SC 5KLVE 1SQXD 3A2AA 2FFDB 2E5TA 2KNCA 3B71A 4QMAA 3BCCD 1NAYA 1M1JB 1KB9H 1OWAA 2IPPA 3CWBG 2Y0DA 1LT9C 3RK3B 1KILA 4H13D 2KSJA 3B5ND 3CWBD 3MP7B 3GG2A 1DD4A 1IFJA 3VMZA 3OAKA 3M0DA 1LTSC 3CMAP 3ITKA 1EQ7A 2AXTH 1LTJC 2W27A 2R3CA 3CCVP 1SQQK 1NU1E 4H0LB 3CCEP 1LP1B 3RK2B 2K37A 1WMKA 3VMXA 1LTIC 2H43A 1VQOP 1KILD 1ZRTE 3LW5H 1OW7A 4PD4D 3I5CA 3QWOC 1L0NJ 1NVOA 2IBZG 3GW6A 1MFTA 5KTBA 4LGDE 2KP8A 2N1TA 1NJIQ 2M3EA 4ASVA 1IK9A 2IBZD 1JCDA 2BCCG 4GT1A 1NTMG 2P2UA 4L73A 3A0HH 1ZMEC 2FFDA 3L74E 1M1JA 5GTIH 2BCCD 1NTMD 2WSFJ 3CXHE 2CPSA 1DD3A 1YJNP 3ABVC 2FYUK 3T97B 2XNXA 1QGKB 2Q3IA 1EZVI 4HKZH 2P58A 1U7MA 2N1TD 3L70J 1YTZI 1N7SB 5AVRB 1AVOA 3PH0A 1RE3C 3G6EP 2PFXA 1GMJA 2G8YA 2I1JA 3H1HE 1LT9B 3C1LA 2Q3EA 1WT6A 1BCCG 4IFDK 1N2DC 5AVZB 1L0NK 3H1KG 1BGYE 1BCCD 1JY3P 1JCCA 1LTJB 1OFCX 3H1KD 3PRJA 3CCMP 1VQKP 1X22A 2FKWB 4IFFA 3RK2D 2WWWA 1NAFA 3G71P 4XE5B 2A45I 3T97A 1SQPJ 4EIJA 1HBWA 1HJBA 2CPBA 1NHLA 2W8ZA 5TISE 1X79B 1N7SA 2HODA 4ZMDA 3L72G 3IF4A 1H0TB 3L72D 4GKGA 2JWDA 2KZJA 2O01H 1NKNA 1JO5A 5KAFH 4W80A 3A5TA 1URQA 3P7KA 4IFMA 4EOTA 1OXZA 5AW1B 1NOHA 3SFEC 2JJLA 2H89C 4K3AA 3AE2C 1N7SD 5AVTB 1S2EA 2KSEA 2O1JA 2QG4A 2B89A 3FX0A 2H88C 3TDKA 2N9BA 1K04A 2WPQA 2W90A 2G3AA 5KLVJ 3NMDA 1T2KC 2P1JA 4JF7A 3TYYA 5AVYB 1IFNA 1URQD 2IYPA 1SQPK 3MIWA 3H1LE 1GZLA 1AFOA 3KYQA 1EXJA 4UB6E 1AQ5A 1MUUA 4UB8H 1LTTC 2R44A 1VQ6P 2ZXEB 1H0TA 1NTKK 3L36A 3CD6P 1YQ4C 1YBKA 1RE4C 1M90Q 5E79E 3SWYA 1NU1J 4AUWA 1YIJP 5EFWB 3R2PA 3EWKA 1FZEA 2KXPB 1RE3A 3P32A 3CC7P 4IL6E 4NPEA 2E76D 1YI2P 3V4QA 1NYHA 2AEFA 5KLVK 3A0BH 4RJTA 1R5SA 3L74J 2B87B 2XKMA 1JNMA 1LT1A 2RN0A 4L74A 3L73G 5AW8B 4C46A 2QRXA 4HB1A 1Q90D 3H32A 1H88A 2FY8A 3B5NC 1W2BO 3AE6C 3L73D 5KAIE 4D6TE 2HFED 1YQ3C 2XZRA 3VTPC 1SQBG 2V4HA 3B4SA 1L4AC 3CMEP 1E79H 4U3FG 3TK1A 1NU1K 1SQBD 2WTYA 2KIKA 2QA4P 2NPSC 4W7YA 2M5AA 2YMKA 4U3FD 3JSVC 4R4LA 2A06E 4EI2A 1YITP 1BGYJ 3M0AA 4GIFA 3FWLA 3M0DC 2WITA 2P7JA 3Q5PA 1ZR2A 1FZAA 1N73C 3WU2E 2LXCB 2HYNA 2B87A 1GU4A 3AEAC 3D6ZA 5AW2B 3NXSA 3L70E 4N78E 3CWBE 3V6IA 3U59A 1JTHB 5AVQB 1J2JB 3L37A 2N1TC 3L71G 5AVUB 1EXIA 1SQVE 1G1IA 3CC2P 1SQQG 1P84I 2DW3A 3L71D 2GUSA 1FBMA 3S1KA 1KILE 1FZFA 3FWNA 4BRYB 4PD4E 1SQQD 4PJ0E 1GTWA 3LIEA 3B5NB 4I1LA 5AVVB 4AQRD 2YKOA 3BASA 2QM8A 2IBZE 1G2CA 1T2KD 2QSIA 2KLUA 4ASWA 1L4AB 2GA1A 3D71A 3M9BA 1BE3G 1ZN5A 2NPSB 3NTNA 4WB4A 1KQGB 1BE3D 4GDOA 2WPVB 2ZFCA 4Y99B 1OVUA 2FYUG 1PGPA 3G4SP 3H1LJ 2K3RA 4PV1D 4K35A 3VMAA 4DZOA 1BSHA 1JTHA 1EDLA 2FYUD 2J58A 1HF9A 2QE7H 1N73B 2YMYA 1ZW0A 3VN0A 2P10A 1JY2O 2IFNA 2E5YA 2RH0A 1GDTA 4LLHA 3USSA 1JY3O 3V2RA 3RK3E 2QIWA 4BRYA 5GTHH 2L5GB 1OIPA 1LTBC 2RKLA 1PPJE 5APQA 1LWUC 1N8RQ 3GMAA 5DJTB 2H7HA 3WMM0 2A45H 2JR8A 1M7LA 2KZIA 3Q1MA 3H1IJ 1L4AA 2OTKE 2V7QH 3BRTB 2NPSA 3AEFC 1KQLA 1RF0A 2WSCH 3TGUG 2KI7B 1IFDA 1HGZA 3MTUE 3L35A 5AW3B 4EYYQ 4JPZB 3H6PA 3TGUD 1URQC 2BEZF 4YXDC 2PP6A 1JY2N 3GF3A 2YIUC 1GL2C 4H44C 1N73A 1L4AD 1ZP0C 1RHZB 1MFZA 3L4FA 1JY3N 2YO3A 4D6TJ 1K9MQ 3V2NA 2NPSD 3MZWB 4IOIH 1FU1A 4I6MC 3CCQP 5APSA 3CC4P 2Y0EA 2ZT9C 2YKQA 1VQ4P 1X8YA 2JP3A 3AE7C 1K8AQ 2Z4EA 1D7MA 1SP4A 1VPCA 4RKUJ 4Z1MH 4U7JA 2LKMA 1YJ9P 2K9YA 1E5WA 1U57A 1L0LG 2Q5UA 2E76C 2CK3H 1GD2E 4LC1A 3BCCJ 2UWJE 1FOSF 3SWFA 1L0LD 2HR3A 3U1AA 2PRRA 1LWUB 3C8VA 2IDBA 1SQPG 1KQFB 1PZQA 4KT0J 4OGQC 3CWBJ 3VP9A 5KJ7C 3MUDA 1VQ5P 1T3JA 1RQVA 2KB7P 1SQPD 2HODB 1IK7A 3L75G 1PIXA 3CX5E 1KYOE 4IL6X 3A7OA 3L75D 1PL5A 1NTKG 2OTJP 2ZAEB 1SQVJ 3AE1C 2Q9IA 1JY2P 1URQB 3VMYA 1NTKD 2NRGA 2WSEJ 1JB0J 3CCJP 1VQLP 1DEEG 3GF7A 2YIUB 1GL2B 3CXHI 1EDIA 4H44B 2WSSH 3JCUH 3H1JG 4HYTB 1KB9E 2AEMA 4R4MA 2H8PD 4Y28J 4JBZA 4C7NA 3H1JD 2ZVOB 3KZIH 5B66H 5CCGC 4YXWH 3MHVA 5BU5A 2WZ7A 4ZNCA 4CPGA 2ZT9B 2BCCJ 1GW4A 4GOFA 2C9NY 1AJYA 2JWAA 1FZBA 3CX5I 1LWUA 2AXTE 2IFMA 1KYOI 3PLNA 2JO1A 3B8EB 2E76B 3PHLA 2YNYA 3HRNA 3CPWO 5H2FH 1SQBE 1SQVK 1EZVG 4MN4C 4OGQB 2MKVA 3OJAB 3A0HE 1H89A 1GL2A 1OVRA 1EZVD 2LXBA 5GTIE 3AE3C 2QJPC 5APXA 1A02F 1IFMA 1PP9G 3H1KJ 2QM7A 1DEBA 1PP9D 1KC8Q 2WQYC 3CLQA 1GL2D 4H44D 3AECC 1P84H 3H32B 3R4YA 4PV1C 1JUNA 4N6JA 3KPEA 5APTA 2WSFH 2MJZA 1FDIA 5AW7B 3SWKA 2Y9YA 1UIXA 2R5BA 1MZ9A 2A45G 2XU6A 2ZT9D 3VYIA 3L71E 1IC2A 3L72J 2M5AB 1Z56A 3H1HG 3CI9A 2NZ2A 2VRSA 1VF5C 4C7RA 5KJ7A 3HE4B 2Q7CA 3U1CA 1NTZG 3AEEC 3A3YB 1MKMA 3H1IE 3H1HD 2XNDH 1DX7A 1QL1A 3V4WA 1NTZD 1IO4A 3M91A 1HGVA 1L2PA 3OA7A 2Y9ZA 5APVA 2D2CD 1K05A 2W6BA 4OGQD 5KJ7D 4DT0A 1ZXGA 5B5EH 1M57D 2QJPB 5CJ4A 3AEDC 1J1DC 3D6YA 1A02J 2OTLP 3C9IA 3P8CE 3O6QB 5CCGA 4TLFA 5KAFE 2PGDA 3G9RA 2KS1B 5CBOA 4JQ0D 2QVAA 5AW9B 1EDJA 2XDJA 3MD0A 3BRVB 2FXOA 3K5BA 2B9BA 1RF0C 4ZKPA 1HVVA 3HE4A 2FBWC 4N3YB 4Y99C 3PTZA 4PV1B 5CCHC 2YXQB 3CL3D 1JOCA 5CCGD 2ZXXA 1G2CB 1SQXE 3W68A 1GU5A 3BCCE 1USEA 1YHQP 2WSCJ 2RMZA 1M1KQ 1S5LH 4UB8E 4A7PA 1CI6B 1VF5B 5AW5B 1AVYA 3SFDC 2M8RA 2BASA 3O8ZA 2OYHA 2QJKC 4EDFA 1S72P 2JKVA 2QJYC 3WUVA 3O6QA 4RO0A 3P8MC 1GK4A 1VQ8P 2KS1A 2WMMA 5BVZA 3LW5J 1VL2A 1OX3A 2OYOA 1SQBJ 1Y47A 1J1DB 5TJHA 1FS0E 1HUCA 3A0BE 1JM0A 2ZJSE 3TF5A 3I55P 3BVHA 3KXDA 4GODA 3MUDC 3HUSA 3N7NA 3GLMA 4W7ZA 4XFJA 2BCCE 1NTME 1PFIA 2OYIB 3AE5C 1CI6A 1L0LE 2E43A 1M56D 2I8DA 4OWFA 3I56P 1Q81Q 2IYOA 3GHGA 1RY3A 4DJGA 1FOSE 4PD4I 5L8RJ 3L75E 3CXHH 1VF5D 2IBZI 2FXMA 3HD7C 3L71J 2QJKB 1SQBK 2R5DA 2QJYB 1LJ2A 1BCCE 1VDFA 1Q82Q 2JDIH 1L0NG 2ZYAA 1ZLLA 3H1KE 1VQNP 1L0ND 1S9KD 2HG5D 3H1JE 1NO4A 2A06G 2YO2A 1FC2C 2R3SA 3D70A 2OYIA 3LIDA 1P84D 2A06D 1H8AA 2K9JB 5CCHA 2B88A 1BE3J 2ZYDA 4XA4A 1OW8A 3L70G 1QLED 2FYUJ 4B86A 3L70D 1SVFA 4N78D 2O01J 2BEQD 1PV3A 1KFMA 3L72E 1LTGC 1YJWP 1SFCC 2O3JA 4WY4C 2M0BA 4ZKUA 3Q2YA 1LTAC 1VQPP 3AE8C 2ZVNB 3TNUA 2YKPA 1FZCC 3IN6A 5CCHD 1SQVG 1CW5A 2C0WA 5TISH 3RBXA 1EZVE 1S4XA 1SQVD 2KUBA 1CZQA 2AEJA 2WPRA 1ZR4A 4L75A 2YXRB 4C7NB 2E75C 1SQXJ 1OZHA 3N4XA 1HWTC 1Q86Q 3HD7B 1PP9E 2GUVA 4WVZA 4HH2A 4WWIA 2D2CC 2K9JA 1N7LA 1T3UA 4JYBA 2E42A 1RF1C 2P67A 1HH0A 1EDKA 3E7KA 3UIAA 2POHA 1UIIA 5APUA 1S3JA 5DJUB 1CSBA 3TGUJ 2W6JH 5C39A 1VQMP 1AQTA 3AEBC 3VP8A 2KLVA 4YPCA 5GTHE 1KFNA 2Z5IA 3Q5SA 2C0XA 1PGJA 3KQGA 4I7ZC 1GW3A 3F5HA 4UB6H 1BDDA 1HJ0A 3AE4C 1R5LA 1NWQA 2WVRA 1LP1A 2JEEA 3RGUA 3RK3D 1NTZE 1VQ9P 1PPJG 3EFGA 3FXEA 1QVGO 1IFIA 1SFCB 4WY4B 1SQXK 1PPJD 3HD7A 2FYZA 1FZCB 5KLVG 5E79H 2W83C 1SLQA 5CMZA 4DCKA 4RESB 1NTMJ 2LR2A 3F89A 5BU8B 5KLVD 2KOGA 1L0LJ 1IZNB 1ZOYC 4H0LD 4IL6H 3V5BA 3L73E 5CBNA 1XTCC 3E1RA 2E75B 1T6AA 1QX8A 2W6AA 1OW6A 1FDMA 3S9OA 3WUTA 2HPCB 5CHXA 2O01N 4KJMA 3HD7D 2D2CB 1LGHB 1KB9I 3L75J 1DH3A 1W2EA 2ZYGA 1RF1B 1NU1G 5M1BA 4U3FE 1NTKJ 1JEKA 1AA0A 1NU1D 1LT9A 1RH5B 5KAIH 1BCCJ 4GOEA 3Q5RA 2OYHC 3RL0C 1ZRTD 3OW2O 1NH4A 3BATA 1Q7YQ 1SFCA 4WY4A 5KKZC 2PAJA 3IAOA 3II6A 5K5GB 1Y8AA 3HTKB 1FZCA 3H1JJ 1LTJA 4HJGH 4I7ZB 3L74G 1NTMK 3EQ2A 1K73Q 4I2LC 1L0LK 1KQSO 1NKZB 5AVXB 3L74D 4YTPC 5AW4B 3VOPA 3CXHD 1GK6A 3PP5A 3V2PA 2IX7C 1YYCA 4BWNA 1SFCD 2AXCA 4WY4D 2SPZA 2HPCA 1JMBA 2I1KA 3WU2H 1JMMA 1KORA 3HUSC 3TSIA 4AYCA 3JCUE 4DOJA 1RF1A 1PGQA 2J5UA 2E74C 1SQQE 5AVSB 3M9HA 3M06A 3CX5D
chains in the Genus database with same CATH topology
1PIXA 1KTMA 2E74B 4IL6X 3AE9C 4OGQD 1OW6A 1R8EA 3S9OA 1TU3F 4H0LB 3AE3C 2QJPC 2D2CC 1EXJA 1PL5A 2E75D 1WMKA 2QSIA 1DIPA 2E74D 2BEZF 2D2CB 4YXDC 3LW5J 1ZRTE 3AEDC 3AE1C 3D6YA 2OQQA 1VL2A 1OW7A 3D71A 3GF3A 2WSEJ 2YIUC 2YMKA 1JB0J 4H44C 5M1BA 3D70A 1ZP0C 2FXPA 3AEBC 3GF7A 4R4LA 1KQGB 3G9RA 4H44B 4GDOA 2WPVB 1YQ4C 2WQYC 3Q5RA 4R4MA 3Q5SA 4PV1D 4Y28J 1ZMEC 4H44D 3Q5PA 3AECC 3GLMA 1OW8A 4XFJA 3IAOA 5KKZC 2ZT9C 1HF9A 2WSFJ 4TT3H 3R4YA 4I7ZC 3EWKA 4PV1C 1DD3A 3AE7C 2JP3A 3RL0g 2ZT9B 2FBWC 3AE5C 1HJ0A 3AE4C 3ABVC 3AEAC 3D6ZA 2P10A 3T97B 4I7ZB 4PV1B 1FDIA 1KMIZ 4RKUJ 1AJYA 1UIXA 2O01J 4Z1MH 1S5LX 2BEQD 1PV3A 4U7JA 2E76D 5KLIC 1OMIA 2ZT9D 2K9YA 4H13C 3RK3E 2QIWA 1NYHA 1U57A 3B71A 4YTPC 3Q2YA 3AE8C 1RQUA 4H13B 2E76C 3IN6A 2WSCJ 2NZ2A 1VF5C 3SFEC 2JO1A 2H89C 3AE2C 2E76B 3FGAD 1GMJA 2G8YA 5L8RJ 1VF5B 3AEEC 3GMAA 4H13D 3SFDC 1MKMA 3H25A 1EXIA 3C8VA 2H88C 2IDBA 3AEGC 1KORA 2V7QJ 1DD4A 3Q1MA 1KQFB 1FDOA 1S1CX 1K04A 1VF5D 4KT0J 4OGQC 1KILE 1ZOYC 2FYNC 4H0LD 1Q90D 2QJKC 2G3AA 2QJYC 2E75C 1RQVA 1Y9BA 3AE6C 4OGQB 2J5UA 2E74C 2D2CD 3O6QA 1K05A 3AEFC 2MKVA 3Q3DA 1NGMB 1IK7A 1YQ3C 2E75B 4H0LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E76 B;  2ZT9 B;  2E74 B;  5L8R J;  1VF5 B;  4I7Z B;  4IL6 X;  4PV1 B;  4H44 B;  4RKU J;  4H0L B;  2QJP C;  2O01 J;  2WPV B;  1S5L X;  3C8V A;  5KLI C;  2QSI A;  2K9Y A;  4Y28 J;  2D2C B;  4KT0 J;  3LW5 J;  1ZRT E;  2QIW A;  2FYN C;  1Q90 D;  2QJK C;  2QJY C;  5KKZ C;  4H13 B;  4OGQ B;  2WSC J;  2WSE J;  2WSF J;  2YIU C;  1JB0 J;  2E75 B; 
#chains in the Genus database with same CATH topology
 1KTM A;  1KYO D;  1KZU B;  1XTG B;  2L91 A;  3AE9 C;  3KZI E;  1R8E A;  3MGN A;  5B66 E;  3M9Q A;  2GM4 A;  2E75 D;  1BGY G;  3CCS P;  1MV8 A;  3GHG C;  1FJK A;  3CCU P;  3HTK A;  2XV5 A;  1BGY D;  2WSE H;  1KD1 Q;  1W5C E;  3RBZ A;  2OAR A;  1KB9 D;  1BE3 E;  4PD4 H;  1PP9 J;  4PJ0 H;  5APY A;  1OVV A;  2OYH B;  4KHX A;  3RL0 B;  1IJD B;  2FYU E;  4OH8 B;  4TT3 H;  3E1I A;  2Q1K A;  2IZ0 A;  5KKZ B;  3RL0 g;  2QEX P;  5H2F E;  2M3B A;  3WUU A;  4WBA A;  1IFP A;  1S5L X;  3S4R A;  2ITA A;  3NFQ A;  5KLI C;  1BSN A;  4H13 C;  2KK7 A;  2WT7 B;  4BXL A;  1KN7 A;  2OYI C;  1SS1 A;  5AW6 B;  5AVW B;  1KV4 A;  3AEG C;  2J59 M;  2V7Q J;  1T8Z A;  1S1C X;  1L0N E;  3H1H J;  2FYN C;  1S9K E;  3HUS B;  1NTZ J;  3Q3D A;  1KIL C;  1WRG A;  2E74 B;  3HE5 B;  1P84 E;  1TU3 F;  2Q6Q A;  1M8O B;  1G1J A;  2C9L Y;  2KYV A;  1DIP A;  2WPS A;  3TGU E;  2K1A A;  2OQQ A;  1PGO A;  3H1L G;  1FJP A;  5AW0 B;  3GHG B;  1QEX A;  3H1L D;  3L73 J;  1HTL C;  3KHU A;  1U7J A;  2WT7 A;  1J1E C;  2HLO A;  1FE6 A;  3EFF K;  3RL0 D;  3IFM A;  1AV1 A;  3ZDM A;  3CCL P;  4U3F J;  2FFD C;  3JC2 2;  1FAV A;  1OMI A;  3CCR P;  5CJ0 A;  1M1J C;  1X0T A;  5KLI B;  3KDP B;  1RQU A;  2K88 A;  3H1I G;  4H13 B;  1NTZ K;  4NPD A;  3RK3 C;  5B5E E;  2Z5H A;  1FZG A;  3FGA D;  3HE5 A;  3H1I D;  1LNQ A;  3H25 A;  1N86 A;  3QH9 A;  1YTZ T;  3W67 A;  1FDO A;  1RE4 A;  2KNC B;  1Q2N A;  1Y9B A;  4JYC A;  1SQP E;  2FYN B;  1USD A;  1NGM B;  1QVF O;  2R32 A;  4H0L C;  3FXD A;  3RK2 C;  1KIL B;  4OVN F;  2E74 D;  4D6T G;  1VQ7 P;  1QL2 A;  1BDC A;  4M3L A;  3P8C D;  3TNU B;  1NTK E;  4D6T D;  3V2Q A;  2FXP A;  2IZ1 A;  2N9Y B;  1EC5 A;  1ZV8 A;  3PJS K;  1SQQ J;  3IR9 A;  2OGU A;  1S5L E;  2Y0C A;  3CX5 H;  1KYO H;  1X9V A;  3B5N A;  1J1E B;  2O1K A;  4NPF X;  1SQX G;  3G3Z A;  5APW A;  2N1T B;  1KMI Z;  4O9B A;  3BCC G;  3SSU A;  4L76 A;  1N7S C;  5KLV E;  1SQX D;  3A2A A;  2FFD B;  2E5T A;  2KNC A;  3B71 A;  4QMA A;  3BCC D;  1NAY A;  1M1J B;  1KB9 H;  1OWA A;  2IPP A;  3CWB G;  2Y0D A;  1LT9 C;  3RK3 B;  1KIL A;  4H13 D;  2KSJ A;  3B5N D;  3CWB D;  3MP7 B;  3GG2 A;  1DD4 A;  1IFJ A;  3VMZ A;  3OAK A;  3M0D A;  1LTS C;  3CMA P;  3ITK A;  1EQ7 A;  2AXT H;  1LTJ C;  2W27 A;  2R3C A;  3CCV P;  1SQQ K;  1NU1 E;  4H0L B;  3CCE P;  1LP1 B;  3RK2 B;  2K37 A;  1WMK A;  3VMX A;  1LTI C;  2H43 A;  1VQO P;  1KIL D;  1ZRT E;  3LW5 H;  1OW7 A;  4PD4 D;  3I5C A;  3QWO C;  1L0N J;  1NVO A;  2IBZ G;  3GW6 A;  1MFT A;  5KTB A;  4LGD E;  2KP8 A;  2N1T A;  1NJI Q;  2M3E A;  4ASV A;  1IK9 A;  2IBZ D;  1JCD A;  2BCC G;  4GT1 A;  1NTM G;  2P2U A;  4L73 A;  3A0H H;  1ZME C;  2FFD A;  3L74 E;  1M1J A;  5GTI H;  2BCC D;  1NTM D;  2WSF J;  3CXH E;  2CPS A;  1DD3 A;  1YJN P;  3ABV C;  2FYU K;  3T97 B;  2XNX A;  1QGK B;  2Q3I A;  1EZV I;  4HKZ H;  2P58 A;  1U7M A;  2N1T D;  3L70 J;  1YTZ I;  1N7S B;  5AVR B;  1AVO A;  3PH0 A;  1RE3 C;  3G6E P;  2PFX A;  1GMJ A;  2G8Y A;  2I1J A;  3H1H E;  1LT9 B;  3C1L A;  2Q3E A;  1WT6 A;  1BCC G;  4IFD K;  1N2D C;  5AVZ B;  1L0N K;  3H1K G;  1BGY E;  1BCC D;  1JY3 P;  1JCC A;  1LTJ B;  1OFC X;  3H1K D;  3PRJ A;  3CCM P;  1VQK P;  1X22 A;  2FKW B;  4IFF A;  3RK2 D;  2WWW A;  1NAF A;  3G71 P;  4XE5 B;  2A45 I;  3T97 A;  1SQP J;  4EIJ A;  1HBW A;  1HJB A;  2CPB A;  1NHL A;  2W8Z A;  5TIS E;  1X79 B;  1N7S A;  2HOD A;  4ZMD A;  3L72 G;  3IF4 A;  1H0T B;  3L72 D;  4GKG A;  2JWD A;  2KZJ A;  2O01 H;  1NKN A;  1JO5 A;  5KAF H;  4W80 A;  3A5T A;  1URQ A;  3P7K A;  4IFM A;  4EOT A;  1OXZ A;  5AW1 B;  1NOH A;  3SFE C;  2JJL A;  2H89 C;  4K3A A;  3AE2 C;  1N7S D;  5AVT B;  1S2E A;  2KSE A;  2O1J A;  2QG4 A;  2B89 A;  3FX0 A;  2H88 C;  3TDK A;  2N9B A;  1K04 A;  2WPQ A;  2W90 A;  2G3A A;  5KLV J;  3NMD A;  1T2K C;  2P1J A;  4JF7 A;  3TYY A;  5AVY B;  1IFN A;  1URQ D;  2IYP A;  1SQP K;  3MIW A;  3H1L E;  1GZL A;  1AFO A;  3KYQ A;  1EXJ A;  4UB6 E;  1AQ5 A;  1MUU A;  4UB8 H;  1LTT C;  2R44 A;  1VQ6 P;  2ZXE B;  1H0T A;  1NTK K;  3L36 A;  3CD6 P;  1YQ4 C;  1YBK A;  1RE4 C;  1M90 Q;  5E79 E;  3SWY A;  1NU1 J;  4AUW A;  1YIJ P;  5EFW B;  3R2P A;  3EWK A;  1FZE A;  2KXP B;  1RE3 A;  3P32 A;  3CC7 P;  4IL6 E;  4NPE A;  2E76 D;  1YI2 P;  3V4Q A;  1NYH A;  2AEF A;  5KLV K;  3A0B H;  4RJT A;  1R5S A;  3L74 J;  2B87 B;  2XKM A;  1JNM A;  1LT1 A;  2RN0 A;  4L74 A;  3L73 G;  5AW8 B;  4C46 A;  2QRX A;  4HB1 A;  1Q90 D;  3H32 A;  1H88 A;  2FY8 A;  3B5N C;  1W2B O;  3AE6 C;  3L73 D;  5KAI E;  4D6T E;  2HFE D;  1YQ3 C;  2XZR A;  3VTP C;  1SQB G;  2V4H A;  3B4S A;  1L4A C;  3CME P;  1E79 H;  4U3F G;  3TK1 A;  1NU1 K;  1SQB D;  2WTY A;  2KIK A;  2QA4 P;  2NPS C;  4W7Y A;  2M5A A;  2YMK A;  4U3F D;  3JSV C;  4R4L A;  2A06 E;  4EI2 A;  1YIT P;  1BGY J;  3M0A A;  4GIF A;  3FWL A;  3M0D C;  2WIT A;  2P7J A;  3Q5P A;  1ZR2 A;  1FZA A;  1N73 C;  3WU2 E;  2LXC B;  2HYN A;  2B87 A;  1GU4 A;  3AEA C;  3D6Z A;  5AW2 B;  3NXS A;  3L70 E;  4N78 E;  3CWB E;  3V6I A;  3U59 A;  1JTH B;  5AVQ B;  1J2J B;  3L37 A;  2N1T C;  3L71 G;  5AVU B;  1EXI A;  1SQV E;  1G1I A;  3CC2 P;  1SQQ G;  1P84 I;  2DW3 A;  3L71 D;  2GUS A;  1FBM A;  3S1K A;  1KIL E;  1FZF A;  3FWN A;  4BRY B;  4PD4 E;  1SQQ D;  4PJ0 E;  1GTW A;  3LIE A;  3B5N B;  4I1L A;  5AVV B;  4AQR D;  2YKO A;  3BAS A;  2QM8 A;  2IBZ E;  1G2C A;  1T2K D;  2QSI A;  2KLU A;  4ASW A;  1L4A B;  2GA1 A;  3D71 A;  3M9B A;  1BE3 G;  1ZN5 A;  2NPS B;  3NTN A;  4WB4 A;  1KQG B;  1BE3 D;  4GDO A;  2WPV B;  2ZFC A;  4Y99 B;  1OVU A;  2FYU G;  1PGP A;  3G4S P;  3H1L J;  2K3R A;  4PV1 D;  4K35 A;  3VMA A;  4DZO A;  1BSH A;  1JTH A;  1EDL A;  2FYU D;  2J58 A;  1HF9 A;  2QE7 H;  1N73 B;  2YMY A;  1ZW0 A;  3VN0 A;  2P10 A;  1JY2 O;  2IFN A;  2E5Y A;  2RH0 A;  1GDT A;  4LLH A;  3USS A;  1JY3 O;  3V2R A;  3RK3 E;  2QIW A;  4BRY A;  5GTH H;  2L5G B;  1OIP A;  1LTB C;  2RKL A;  1PPJ E;  5APQ A;  1LWU C;  1N8R Q;  3GMA A;  5DJT B;  2H7H A;  3WMM 0;  2A45 H;  2JR8 A;  1M7L A;  2KZI A;  3Q1M A;  3H1I J;  1L4A A;  2OTK E;  2V7Q H;  3BRT B;  2NPS A;  3AEF C;  1KQL A;  1RF0 A;  2WSC H;  3TGU G;  2KI7 B;  1IFD A;  1HGZ A;  3MTU E;  3L35 A;  5AW3 B;  4EYY Q;  4JPZ B;  3H6P A;  3TGU D;  1URQ C;  2BEZ F;  4YXD C;  2PP6 A;  1JY2 N;  3GF3 A;  2YIU C;  1GL2 C;  4H44 C;  1N73 A;  1L4A D;  1ZP0 C;  1RHZ B;  1MFZ A;  3L4F A;  1JY3 N;  2YO3 A;  4D6T J;  1K9M Q;  3V2N A;  2NPS D;  3MZW B;  4IOI H;  1FU1 A;  4I6M C;  3CCQ P;  5APS A;  3CC4 P;  2Y0E A;  2ZT9 C;  2YKQ A;  1VQ4 P;  1X8Y A;  2JP3 A;  3AE7 C;  1K8A Q;  2Z4E A;  1D7M A;  1SP4 A;  1VPC A;  4RKU J;  4Z1M H;  4U7J A;  2LKM A;  1YJ9 P;  2K9Y A;  1E5W A;  1U57 A;  1L0L G;  2Q5U A;  2E76 C;  2CK3 H;  1GD2 E;  4LC1 A;  3BCC J;  2UWJ E;  1FOS F;  3SWF A;  1L0L D;  2HR3 A;  3U1A A;  2PRR A;  1LWU B;  3C8V A;  2IDB A;  1SQP G;  1KQF B;  1PZQ A;  4KT0 J;  4OGQ C;  3CWB J;  3VP9 A;  5KJ7 C;  3MUD A;  1VQ5 P;  1T3J A;  1RQV A;  2KB7 P;  1SQP D;  2HOD B;  1IK7 A;  3L75 G;  1PIX A;  3CX5 E;  1KYO E;  4IL6 X;  3A7O A;  3L75 D;  1PL5 A;  1NTK G;  2OTJ P;  2ZAE B;  1SQV J;  3AE1 C;  2Q9I A;  1JY2 P;  1URQ B;  3VMY A;  1NTK D;  2NRG A;  2WSE J;  1JB0 J;  3CCJ P;  1VQL P;  1DEE G;  3GF7 A;  2YIU B;  1GL2 B;  3CXH I;  1EDI A;  4H44 B;  2WSS H;  3JCU H;  3H1J G;  4HYT B;  1KB9 E;  2AEM A;  4R4M A;  2H8P D;  4Y28 J;  4JBZ A;  4C7N A;  3H1J D;  2ZVO B;  3KZI H;  5B66 H;  5CCG C;  4YXW H;  3MHV A;  5BU5 A;  2WZ7 A;  4ZNC A;  4CPG A;  2ZT9 B;  2BCC J;  1GW4 A;  4GOF A;  2C9N Y;  1AJY A;  2JWA A;  1FZB A;  3CX5 I;  1LWU A;  2AXT E;  2IFM A;  1KYO I;  3PLN A;  2JO1 A;  3B8E B;  2E76 B;  3PHL A;  2YNY A;  3HRN A;  3CPW O;  5H2F H;  1SQB E;  1SQV K;  1EZV G;  4MN4 C;  4OGQ B;  2MKV A;  3OJA B;  3A0H E;  1H89 A;  1GL2 A;  1OVR A;  1EZV D;  2LXB A;  5GTI E;  3AE3 C;  2QJP C;  5APX A;  1A02 F;  1IFM A;  1PP9 G;  3H1K J;  2QM7 A;  1DEB A;  1PP9 D;  1KC8 Q;  2WQY C;  3CLQ A;  1GL2 D;  4H44 D;  3AEC C;  1P84 H;  3H32 B;  3R4Y A;  4PV1 C;  1JUN A;  4N6J A;  3KPE A;  5APT A;  2WSF H;  2MJZ A;  1FDI A;  5AW7 B;  3SWK A;  2Y9Y A;  1UIX A;  2R5B A;  1MZ9 A;  2A45 G;  2XU6 A;  2ZT9 D;  3VYI A;  3L71 E;  1IC2 A;  3L72 J;  2M5A B;  1Z56 A;  3H1H G;  3CI9 A;  2NZ2 A;  2VRS A;  1VF5 C;  4C7R A;  5KJ7 A;  3HE4 B;  2Q7C A;  3U1C A;  1NTZ G;  3AEE C;  3A3Y B;  1MKM A;  3H1I E;  3H1H D;  2XND H;  1DX7 A;  1QL1 A;  3V4W A;  1NTZ D;  1IO4 A;  3M91 A;  1HGV A;  1L2P A;  3OA7 A;  2Y9Z A;  5APV A;  2D2C D;  1K05 A;  2W6B A;  4OGQ D;  5KJ7 D;  4DT0 A;  1ZXG A;  5B5E H;  1M57 D;  2QJP B;  5CJ4 A;  3AED C;  1J1D C;  3D6Y A;  1A02 J;  2OTL P;  3C9I A;  3P8C E;  3O6Q B;  5CCG A;  4TLF A;  5KAF E;  2PGD A;  3G9R A;  2KS1 B;  5CBO A;  4JQ0 D;  2QVA A;  5AW9 B;  1EDJ A;  2XDJ A;  3MD0 A;  3BRV B;  2FXO A;  3K5B A;  2B9B A;  1RF0 C;  4ZKP A;  1HVV A;  3HE4 A;  2FBW C;  4N3Y B;  4Y99 C;  3PTZ A;  4PV1 B;  5CCH C;  2YXQ B;  3CL3 D;  1JOC A;  5CCG D;  2ZXX A;  1G2C B;  1SQX E;  3W68 A;  1GU5 A;  3BCC E;  1USE A;  1YHQ P;  2WSC J;  2RMZ A;  1M1K Q;  1S5L H;  4UB8 E;  4A7P A;  1CI6 B;  1VF5 B;  5AW5 B;  1AVY A;  3SFD C;  2M8R A;  2BAS A;  3O8Z A;  2OYH A;  2QJK C;  4EDF A;  1S72 P;  2JKV A;  2QJY C;  3WUV A;  3O6Q A;  4RO0 A;  3P8M C;  1GK4 A;  1VQ8 P;  2KS1 A;  2WMM A;  5BVZ A;  3LW5 J;  1VL2 A;  1OX3 A;  2OYO A;  1SQB J;  1Y47 A;  1J1D B;  5TJH A;  1FS0 E;  1HUC A;  3A0B E;  1JM0 A;  2ZJS E;  3TF5 A;  3I55 P;  3BVH A;  3KXD A;  4GOD A;  3MUD C;  3HUS A;  3N7N A;  3GLM A;  4W7Z A;  4XFJ A;  2BCC E;  1NTM E;  1PFI A;  2OYI B;  3AE5 C;  1CI6 A;  1L0L E;  2E43 A;  1M56 D;  2I8D A;  4OWF A;  3I56 P;  1Q81 Q;  2IYO A;  3GHG A;  1RY3 A;  4DJG A;  1FOS E;  4PD4 I;  5L8R J;  3L75 E;  3CXH H;  1VF5 D;  2IBZ I;  2FXM A;  3HD7 C;  3L71 J;  2QJK B;  1SQB K;  2R5D A;  2QJY B;  1LJ2 A;  1BCC E;  1VDF A;  1Q82 Q;  2JDI H;  1L0N G;  2ZYA A;  1ZLL A;  3H1K E;  1VQN P;  1L0N D;  1S9K D;  2HG5 D;  3H1J E;  1NO4 A;  2A06 G;  2YO2 A;  1FC2 C;  2R3S A;  3D70 A;  2OYI A;  3LID A;  1P84 D;  2A06 D;  1H8A A;  2K9J B;  5CCH A;  2B88 A;  1BE3 J;  2ZYD A;  4XA4 A;  1OW8 A;  3L70 G;  1QLE D;  2FYU J;  4B86 A;  3L70 D;  1SVF A;  4N78 D;  2O01 J;  2BEQ D;  1PV3 A;  1KFM A;  3L72 E;  1LTG C;  1YJW P;  1SFC C;  2O3J A;  4WY4 C;  2M0B A;  4ZKU A;  3Q2Y A;  1LTA C;  1VQP P;  3AE8 C;  2ZVN B;  3TNU A;  2YKP A;  1FZC C;  3IN6 A;  5CCH D;  1SQV G;  1CW5 A;  2C0W A;  5TIS H;  3RBX A;  1EZV E;  1S4X A;  1SQV D;  2KUB A;  1CZQ A;  2AEJ A;  2WPR A;  1ZR4 A;  4L75 A;  2YXR B;  4C7N B;  2E75 C;  1SQX J;  1OZH A;  3N4X A;  1HWT C;  1Q86 Q;  3HD7 B;  1PP9 E;  2GUV A;  4WVZ A;  4HH2 A;  4WWI A;  2D2C C;  2K9J A;  1N7L A;  1T3U A;  4JYB A;  2E42 A;  1RF1 C;  2P67 A;  1HH0 A;  1EDK A;  3E7K A;  3UIA A;  2POH A;  1UII A;  5APU A;  1S3J A;  5DJU B;  1CSB A;  3TGU J;  2W6J H;  5C39 A;  1VQM P;  1AQT A;  3AEB C;  3VP8 A;  2KLV A;  4YPC A;  5GTH E;  1KFN A;  2Z5I A;  3Q5S A;  2C0X A;  1PGJ A;  3KQG A;  4I7Z C;  1GW3 A;  3F5H A;  4UB6 H;  1BDD A;  1HJ0 A;  3AE4 C;  1R5L A;  1NWQ A;  2WVR A;  1LP1 A;  2JEE A;  3RGU A;  3RK3 D;  1NTZ E;  1VQ9 P;  1PPJ G;  3EFG A;  3FXE A;  1QVG O;  1IFI A;  1SFC B;  4WY4 B;  1SQX K;  1PPJ D;  3HD7 A;  2FYZ A;  1FZC B;  5KLV G;  5E79 H;  2W83 C;  1SLQ A;  5CMZ A;  4DCK A;  4RES B;  1NTM J;  2LR2 A;  3F89 A;  5BU8 B;  5KLV D;  2KOG A;  1L0L J;  1IZN B;  1ZOY C;  4H0L D;  4IL6 H;  3V5B A;  3L73 E;  5CBN A;  1XTC C;  3E1R A;  2E75 B;  1T6A A;  1QX8 A;  2W6A A;  1OW6 A;  1FDM A;  3S9O A;  3WUT A;  2HPC B;  5CHX A;  2O01 N;  4KJM A;  3HD7 D;  2D2C B;  1LGH B;  1KB9 I;  3L75 J;  1DH3 A;  1W2E A;  2ZYG A;  1RF1 B;  1NU1 G;  5M1B A;  4U3F E;  1NTK J;  1JEK A;  1AA0 A;  1NU1 D;  1LT9 A;  1RH5 B;  5KAI H;  1BCC J;  4GOE A;  3Q5R A;  2OYH C;  3RL0 C;  1ZRT D;  3OW2 O;  1NH4 A;  3BAT A;  1Q7Y Q;  1SFC A;  4WY4 A;  5KKZ C;  2PAJ A;  3IAO A;  3II6 A;  5K5G B;  1Y8A A;  3HTK B;  1FZC A;  3H1J J;  1LTJ A;  4HJG H;  4I7Z B;  3L74 G;  1NTM K;  3EQ2 A;  1K73 Q;  4I2L C;  1L0L K;  1KQS O;  1NKZ B;  5AVX B;  3L74 D;  4YTP C;  5AW4 B;  3VOP A;  3CXH D;  1GK6 A;  3PP5 A;  3V2P A;  2IX7 C;  1YYC A;  4BWN A;  1SFC D;  2AXC A;  4WY4 D;  2SPZ A;  2HPC A;  1JMB A;  2I1K A;  3WU2 H;  1JMM A;  1KOR A;  3HUS C;  3TSI A;  4AYC A;  3JCU E;  4DOJ A;  1RF1 A;  1PGQ A;  2J5U A;  2E74 C;  1SQQ E;  5AVS B;  3M9H A;  3M06 A;  3CX5 D; 
#chains in the Genus database with same CATH homology
 1PIX A;  1KTM A;  2E74 B;  4IL6 X;  3AE9 C;  4OGQ D;  1OW6 A;  1R8E A;  3S9O A;  1TU3 F;  4H0L B;  3AE3 C;  2QJP C;  2D2C C;  1EXJ A;  1PL5 A;  2E75 D;  1WMK A;  2QSI A;  1DIP A;  2E74 D;  2BEZ F;  2D2C B;  4YXD C;  3LW5 J;  1ZRT E;  3AED C;  3AE1 C;  3D6Y A;  2OQQ A;  1VL2 A;  1OW7 A;  3D71 A;  3GF3 A;  2WSE J;  2YIU C;  2YMK A;  1JB0 J;  4H44 C;  5M1B A;  3D70 A;  1ZP0 C;  2FXP A;  3AEB C;  3GF7 A;  4R4L A;  1KQG B;  3G9R A;  4H44 B;  4GDO A;  2WPV B;  1YQ4 C;  2WQY C;  3Q5R A;  4R4M A;  3Q5S A;  4PV1 D;  4Y28 J;  1ZME C;  4H44 D;  3Q5P A;  3AEC C;  3GLM A;  1OW8 A;  4XFJ A;  3IAO A;  5KKZ C;  2ZT9 C;  1HF9 A;  2WSF J;  4TT3 H;  3R4Y A;  4I7Z C;  3EWK A;  4PV1 C;  1DD3 A;  3AE7 C;  2JP3 A;  3RL0 g;  2ZT9 B;  2FBW C;  3AE5 C;  1HJ0 A;  3AE4 C;  3ABV C;  3AEA C;  3D6Z A;  2P10 A;  3T97 B;  4I7Z B;  4PV1 B;  1FDI A;  1KMI Z;  4RKU J;  1AJY A;  1UIX A;  2O01 J;  4Z1M H;  1S5L X;  2BEQ D;  1PV3 A;  4U7J A;  2E76 D;  5KLI C;  1OMI A;  2ZT9 D;  2K9Y A;  4H13 C;  3RK3 E;  2QIW A;  1NYH A;  1U57 A;  3B71 A;  4YTP C;  3Q2Y A;  3AE8 C;  1RQU A;  4H13 B;  2E76 C;  3IN6 A;  2WSC J;  2NZ2 A;  1VF5 C;  3SFE C;  2JO1 A;  2H89 C;  3AE2 C;  2E76 B;  3FGA D;  1GMJ A;  2G8Y A;  5L8R J;  1VF5 B;  3AEE C;  3GMA A;  4H13 D;  3SFD C;  1MKM A;  3H25 A;  1EXI A;  3C8V A;  2H88 C;  2IDB A;  3AEG C;  1KOR A;  2V7Q J;  1DD4 A;  3Q1M A;  1KQF B;  1FDO A;  1S1C X;  1K04 A;  1VF5 D;  4KT0 J;  4OGQ C;  1KIL E;  1ZOY C;  2FYN C;  4H0L D;  1Q90 D;  2QJK C;  2G3A A;  2QJY C;  2E75 C;  1RQV A;  1Y9B A;  3AE6 C;  4OGQ B;  2J5U A;  2E74 C;  2D2C D;  3O6Q A;  1K05 A;  3AEF C;  2MKV A;  3Q3D A;  1NGM B;  1IK7 A;  1YQ3 C;  2E75 B;  4H0L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...