2KA5A

Nmr structure of the protein tm1081
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
b'MGSDKIHHHHHHMFPYKIVDDVVILMPNKELNIENAHLFKKWVFDEFLNKGYNKIFLVLSDVESIDSFSLGVIVNILKSISSSGGFFALVSPNEKVERVLSLTNLDRIVKIYDTISEAMEEVRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative anti-sigma factor antagonist TM_1081
publication title Comparison of NMR and crystal structures highlights conformational isomerism in protein active sites.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 26
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 2ka5A01
3F43A 4QTPA 4XS5A 3T6OA 3ZTBA 2KA5A 3AGDA 1T6RA 5EUWA 3IF5A 1H4ZA 3OIZA 4DGFA 5EUXA 4DGHA 1THNB 2VY9A 5EUZA 3IH9A 1AUZA 2KLNA 3OIRA 3LKLA 4HYLA 1TILB 3IH8A 1BUZA 1H4YA 3ZXNA 3MGLA 5EZBA 3LLOA 3IHBA 1SBOA 3AGEA 1TH8B 1VC1A 5EUSA 3IHAA 3NY7A 1H4XA 5EUUA 1TIDB
chains in the Genus database with same CATH superfamily
3LDFA 3GVKA 5EUWA 1N6DA 3OIZA 2DXNA 1J7XA 3GVLA 3V8VA 3DORA 4L8KA 1V0FA 3AGEA 1VC1A 3GHFA 1H4XA 2KA5A 2OASA 4JC0A 3K50A 1K32A 2AS0A 5EUXA 1THNB 2VY9A 3DUPA 3OIRA 3GVJA 1TILB 1BUZA 3ZXNA 3GMFA 3IHBA 1TH8B 3DJAA 3NY7A 3GK7A 2RRLA 3VSEA 3F43A 3D3UA 4QTPA 4XS5A 3ZTBA 1WXXA 1H4ZA 4DGFA 2ZOAA 3IH9A 3LKLA 4HYLA 1FC6A 3V97A 3IH8A 1V0EA 4AE2A 3MGLA 2ZO9B 5EZBA 3LLOA 1SBOA 1N6EA 1BPLA 1FC7A 3QDQA 4HIZA 3T6OA 3MOGA 3C0KA 2B78A 4DMGA 3AGDA 1T6RA 3D03A 4L1CA 3IF5A 3EH7A 1FCFA 4DGHA 2DXLA 5EUZA 1AUZA 2KLNA 3JU4A 2CWWA 1H4YA 1N6FA 4AEJA 1HF2A 5EUSA 1WXWA 3IHAA 5EUUA 1FC9A 4GHNA 1TIDB
chains in the Genus database with same CATH topology
3F43A 4QTPA 4XS5A 3T6OA 3ZTBA 2KA5A 3AGDA 1T6RA 5EUWA 3IF5A 1H4ZA 3OIZA 4DGFA 5EUXA 4DGHA 1THNB 2VY9A 5EUZA 3IH9A 1AUZA 2KLNA 3OIRA 3LKLA 4HYLA 1TILB 3IH8A 1BUZA 1H4YA 3ZXNA 3MGLA 5EZBA 3LLOA 3IHBA 1SBOA 3AGEA 1TH8B 1VC1A 5EUSA 3IHAA 3NY7A 1H4XA 5EUUA 1TIDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F43 A;  4QTP A;  4XS5 A;  3T6O A;  3ZTB A;  2KA5 A;  3AGD A;  1T6R A;  5EUW A;  3IF5 A;  1H4Z A;  3OIZ A;  4DGF A;  5EUX A;  4DGH A;  1THN B;  2VY9 A;  5EUZ A;  3IH9 A;  1AUZ A;  2KLN A;  3OIR A;  3LKL A;  4HYL A;  1TIL B;  3IH8 A;  1BUZ A;  1H4Y A;  3ZXN A;  3MGL A;  5EZB A;  3LLO A;  3IHB A;  1SBO A;  3AGE A;  1TH8 B;  1VC1 A;  5EUS A;  3IHA A;  3NY7 A;  1H4X A;  5EUU A;  1TID B; 
#chains in the Genus database with same CATH topology
 3LDF A;  3GVK A;  5EUW A;  1N6D A;  3OIZ A;  2DXN A;  1J7X A;  3GVL A;  3V8V A;  3DOR A;  4L8K A;  1V0F A;  3AGE A;  1VC1 A;  3GHF A;  1H4X A;  2KA5 A;  2OAS A;  4JC0 A;  3K50 A;  1K32 A;  2AS0 A;  5EUX A;  1THN B;  2VY9 A;  3DUP A;  3OIR A;  3GVJ A;  1TIL B;  1BUZ A;  3ZXN A;  3GMF A;  3IHB A;  1TH8 B;  3DJA A;  3NY7 A;  3GK7 A;  2RRL A;  3VSE A;  3F43 A;  3D3U A;  4QTP A;  4XS5 A;  3ZTB A;  1WXX A;  1H4Z A;  4DGF A;  2ZOA A;  3IH9 A;  3LKL A;  4HYL A;  1FC6 A;  3V97 A;  3IH8 A;  1V0E A;  4AE2 A;  3MGL A;  2ZO9 B;  5EZB A;  3LLO A;  1SBO A;  1N6E A;  1BPL A;  1FC7 A;  3QDQ A;  4HIZ A;  3T6O A;  3MOG A;  3C0K A;  2B78 A;  4DMG A;  3AGD A;  1T6R A;  3D03 A;  4L1C A;  3IF5 A;  3EH7 A;  1FCF A;  4DGH A;  2DXL A;  5EUZ A;  1AUZ A;  2KLN A;  3JU4 A;  2CWW A;  1H4Y A;  1N6F A;  4AEJ A;  1HF2 A;  5EUS A;  1WXW A;  3IHA A;  5EUU A;  1FC9 A;  4GHN A;  1TID B; 
#chains in the Genus database with same CATH homology
 3F43 A;  4QTP A;  4XS5 A;  3T6O A;  3ZTB A;  2KA5 A;  3AGD A;  1T6R A;  5EUW A;  3IF5 A;  1H4Z A;  3OIZ A;  4DGF A;  5EUX A;  4DGH A;  1THN B;  2VY9 A;  5EUZ A;  3IH9 A;  1AUZ A;  2KLN A;  3OIR A;  3LKL A;  4HYL A;  1TIL B;  3IH8 A;  1BUZ A;  1H4Y A;  3ZXN A;  3MGL A;  5EZB A;  3LLO A;  3IHB A;  1SBO A;  3AGE A;  1TH8 B;  1VC1 A;  5EUS A;  3IHA A;  3NY7 A;  1H4X A;  5EUU A;  1TID B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...