2KA5A

Nmr structure of the protein tm1081
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
MGSDKIHHHHHHMFPYKIVDDVVILMPNKELNIENAHLFKKWVFDEFLNKGYNKIFLVLSDVESIDSFSLGVIVNILKSISSSGGFFALVSPNEKVERVLSLTNLDRIVKIYDTISEAMEEVRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative anti-sigma factor antagonist TM_1081
publication title Comparison of NMR and crystal structures highlights conformational isomerism in protein active sites.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 26
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 2ka5A01
3T6OA 1H4YA 3AGEA 3LKLA 1TH8B 4DGHA 3NY7A 3LLOA 3ZTBA 5EUXA 1TIDB 2VY9A 3IHAA 5EUZA 3IHBA 1BUZA 5EZBA 1TILB 1VC1A 4HYLA 5EUWA 3MGLA 2KLNA 1THNB 1H4ZA 3IH9A 1AUZA 1SBOA 3OIZA 5EUUA 3ZXNA 3IH8A 4DGFA 3IF5A 2KA5A 3OIRA 1T6RA 3F43A 4QTPA 5EUSA 1H4XA 4XS5A 3AGDA
chains in the Genus database with same CATH superfamily
3T6OA 3DJAA 2DXLA 1N6FA 3LKLA 3GVJA 4JC0A 2ZO9B 3IHBA 3K50A 4L8KA 1H4ZA 3OIZA 4AEJA 4AE2A 1BPLA 2CWWA 3IF5A 2KA5A 3OIRA 1T6RA 1H4XA 4XS5A 3D03A 3JU4A 3AGDA 3VSEA 1H4YA 3LDFA 1FCFA 1WXWA 2AS0A 1N6DA 1N6EA 1J7XA 2OASA 3NY7A 3LLOA 1V0FA 5EUZA 5EZBA 1TILB 1V0EA 3V97A 3V8VA 1FC9A 4GHNA 1K32A 3GK7A 2B78A 3QDQA 3AGEA 3C0KA 4DGHA 3DUPA 1WXXA 3ZTBA 1TIDB 3EH7A 1BUZA 2RRLA 3MGLA 2KLNA 1THNB 1HF2A 3IH9A 1AUZA 4L1CA 3IH8A 3D3UA 4DMGA 4QTPA 1FC7A 3GVKA 1TH8B 1FC6A 5EUXA 2VY9A 3IHAA 3GHFA 1VC1A 3GVLA 4HYLA 5EUWA 2ZOAA 1SBOA 5EUUA 3ZXNA 4DGFA 3F43A 3MOGA 5EUSA 2DXNA 4HIZA 3GMFA 3DORA
chains in the Genus database with same CATH topology
3T6OA 1H4YA 3AGEA 3LKLA 1TH8B 4DGHA 3NY7A 3LLOA 3ZTBA 5EUXA 1TIDB 2VY9A 3IHAA 5EUZA 3IHBA 1BUZA 5EZBA 1TILB 1VC1A 4HYLA 5EUWA 3MGLA 2KLNA 1THNB 1H4ZA 3IH9A 1AUZA 1SBOA 3OIZA 5EUUA 3ZXNA 3IH8A 4DGFA 3IF5A 2KA5A 3OIRA 1T6RA 3F43A 4QTPA 5EUSA 1H4XA 4XS5A 3AGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6O A;  1H4Y A;  3AGE A;  3LKL A;  1TH8 B;  4DGH A;  3NY7 A;  3LLO A;  3ZTB A;  5EUX A;  1TID B;  2VY9 A;  3IHA A;  5EUZ A;  3IHB A;  1BUZ A;  5EZB A;  1TIL B;  1VC1 A;  4HYL A;  5EUW A;  3MGL A;  2KLN A;  1THN B;  1H4Z A;  3IH9 A;  1AUZ A;  1SBO A;  3OIZ A;  5EUU A;  3ZXN A;  3IH8 A;  4DGF A;  3IF5 A;  2KA5 A;  3OIR A;  1T6R A;  3F43 A;  4QTP A;  5EUS A;  1H4X A;  4XS5 A;  3AGD A; 
#chains in the Genus database with same CATH topology
 3T6O A;  3DJA A;  2DXL A;  1N6F A;  3LKL A;  3GVJ A;  4JC0 A;  2ZO9 B;  3IHB A;  3K50 A;  4L8K A;  1H4Z A;  3OIZ A;  4AEJ A;  4AE2 A;  1BPL A;  2CWW A;  3IF5 A;  2KA5 A;  3OIR A;  1T6R A;  1H4X A;  4XS5 A;  3D03 A;  3JU4 A;  3AGD A;  3VSE A;  1H4Y A;  3LDF A;  1FCF A;  1WXW A;  2AS0 A;  1N6D A;  1N6E A;  1J7X A;  2OAS A;  3NY7 A;  3LLO A;  1V0F A;  5EUZ A;  5EZB A;  1TIL B;  1V0E A;  3V97 A;  3V8V A;  1FC9 A;  4GHN A;  1K32 A;  3GK7 A;  2B78 A;  3QDQ A;  3AGE A;  3C0K A;  4DGH A;  3DUP A;  1WXX A;  3ZTB A;  1TID B;  3EH7 A;  1BUZ A;  2RRL A;  3MGL A;  2KLN A;  1THN B;  1HF2 A;  3IH9 A;  1AUZ A;  4L1C A;  3IH8 A;  3D3U A;  4DMG A;  4QTP A;  1FC7 A;  3GVK A;  1TH8 B;  1FC6 A;  5EUX A;  2VY9 A;  3IHA A;  3GHF A;  1VC1 A;  3GVL A;  4HYL A;  5EUW A;  2ZOA A;  1SBO A;  5EUU A;  3ZXN A;  4DGF A;  3F43 A;  3MOG A;  5EUS A;  2DXN A;  4HIZ A;  3GMF A;  3DOR A; 
#chains in the Genus database with same CATH homology
 3T6O A;  1H4Y A;  3AGE A;  3LKL A;  1TH8 B;  4DGH A;  3NY7 A;  3LLO A;  3ZTB A;  5EUX A;  1TID B;  2VY9 A;  3IHA A;  5EUZ A;  3IHB A;  1BUZ A;  5EZB A;  1TIL B;  1VC1 A;  4HYL A;  5EUW A;  3MGL A;  2KLN A;  1THN B;  1H4Z A;  3IH9 A;  1AUZ A;  1SBO A;  3OIZ A;  5EUU A;  3ZXN A;  3IH8 A;  4DGF A;  3IF5 A;  2KA5 A;  3OIR A;  1T6R A;  3F43 A;  4QTP A;  5EUS A;  1H4X A;  4XS5 A;  3AGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...