2KAAA

Solution structure of hirsutellin a from hirsutella thompsonii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
130
structure length
130
Chain Sequence
APIVTCRPKLDGREKPFKVDVATAQAQARKAGLTTGKSGDPHRYFAGDHIRWGVNNCDKADAILWEYPIYWVGKNAEWAKDVKTSQQKGGPTPIRVVYANSRGAVQYCGVMTHSKVDKNNQGKEFFEKCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hirsutellin A
publication title Solution structure of hirsutellin A--new insights into the active site and interacting interfaces of ribotoxins.
pubmed rcsb
molecule tags Toxin
total genus 15
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kaaA00
1RN1A 1BRKA 1PYLA 3D5IA 1I0XA 1FUTA 3SYUA 1FZUA 3WHOA 1B21A 1RCKA 1RGFA 1BANA 5BU4A 1B2SA 1I3IA 1HZ1A 1I2FA 1GOUA 9RNTA 1BNEA 7GSPA 1RGCA 1BNGA 2F56A 2F5WA 1I8VA 1GMPA 1UCIA 1FYSA 1RGAA 2KF3A 1B3SA 1FW7A 4GHOA 1GOYA 2RBIA 1GSPA 1IYYA 1CH0A 1B2XA 1AQZA 4RNTA 2F4YA 2KF6A 1BUJA 2AAEA 6RNTA 1RNBA 2BU4A 2KF5A 3DH2A 1JBSA 1BSDA 2KAAA 2AADA 1X1UA 1MGWA 2C4BA 1BNIA 1C54A 1DE3A 2BIRA 1I2GA 1BU4A 3RNTA 5GSPA 4BU4A 1RTUA 1A2PA 1BSAA 1BSEA 1BSCA 3AHSA 3WR2A 2GSPA 1RGGA 3DGYA 5RNTA 1GMQA 1YVSA 4HOHA 1LNIA 1X1XA 6GSPA 1GOVA 1RHLA 1UCKA 1BAOA 1RN4A 1BOXA 3URPA 2ZA4A 1B2UA 2KF4A 4HAAA 1BNFA 1I70A 1HYFA 1I0VA 1BRGA 2F5MA 1B20A 1RNTA 1BGSA 1ZGXA 3AGNA 3BU4A 1UCLA 1RGKA 3D4AA 1YGWA 1RGHA 1BRHA 1AY7A 1RDSA 1RSNA 4J5GA 1GMRA 1LOYA 1DETA 5HOHA 1G02A 1RCLA 8RNTA 3HOHA 1BNSA 1BIRA 1B2ZA 1RGLA 1BRJA 1B2MA 1SARA 1RLSA 1LOVA 1BVIA 4J5KA 1TTOA 3AGOA 3AHWA 1UCJA 1TRPA 1YNVX 3KCHA 1PY3A 3BIRA 1I2EA 1RMSA 4BIRA 1BRNL 3GSPA 1FUSA 3D5GA 7RNTA 1T2HA 1RGEA 1LOWA 1MGRA 5BIRA 3A5EA 1X1YA 1BRIA 2SARA 1B27A 1X1WA 1BSBA 3Q3FA 1R4YA 1JBTA 4GSPA 1T2IA 1BRSA 1TRQA 2HOHA 1BNJA 2RNTA 1I3FA 1JBRA 1Q9EA 1BNRA 1LRAA
chains in the Genus database with same CATH superfamily
5G2GA 3PCRA 3VSYA 3D3LA 3X3ZA 4WYKA 1FUTA 3NBBA 2ZDJA 1M904 1W4NA 1E3VA 2Q07A 3WHOA 3WDGB 4CCVA 1YI23 2D1WA 3ER7A 1KC84 2A15A 1I3IA 3RDEA 1VQ73 4I5QA 1I2FA 2E2VA 3DGLA 1GOUA 2BHMA 1BNEA 1EEJA 2F5WA 2MF7A 4MJDA 5IEOA 5IW9A 2QA43 1GMPA 1W2B2 1FUWA 1UCIA 1R4CA 1DMQA 4ZM8A 1N9EA 1LXEA 4EV2A 2Z6BA 3LTDA 4JF8A 5BXQA 1Q7Y4 3KSED 3I0YA 3LTBA 1JV2B 2QEX3 1IYYA 2OQEC 3O8YA 1EUIC 4KFDA 4RNTA 3MSOA 3HI7A 1RRLA 2AAEA 2BU4A 2KF5A 4R1KA 1CYUA 4GB5A 2GU3A 4LMIA 3OW22 2KXGA 6STDA 1BSDA 5M18A 4XB5A 3J7Yd 1X1UA 1WMOA 1N8QA 3CPOA 1BNIA 3CCS3 1G96A 4XDVA 1BU4A 5D82A 1VQ43 3SXXA 3KE7A 3RGRA 1BSAA 5CK6A 3EJVA 1IT7A 3DGYA 1A2KA 3IPTA 3V99A 5AIIA 4EBGA 1VQO3 5AYSC 1JB2A 4HM7B 4MMYB 1RRHA 3AMOA 3BNDA 3CPW2 1SPUA 1JZDA 2J8XB 4XBTA 2GU1A 3Q1CA 2HMKB 1E97A 2KF4A 3K0ZA 4HAAA 4K61A 3F8HA 2W04A 1O7WB 2HMNB 2YFJB 4ILFA 4BTYA 1GY6A 1K41A 3CNXA 2R4IA 2XFTA 1V74A 4N6OB 2O9UX 1C7HA 4RNYA 1HU9A 3OV4A 1OPYA 1RGHA 1BRHA 1N5PA 2H0GA 4Q53A 4BTWA 2O3OA 4R9LA 1RSNA 3JUMA 2M7OA 2BO9B 1LOYA 1DETA 1G02A 1EKMA 1RCLA 8RNTA 1W5ZA 1BNSA 1BRJA 4KVHA 4EW5A 4N6MA 1UGIA 1SARA 1ULIB 2LQVA 3S29A 3S5CA 1EG9B 4GL6A 5CLKA 3Q90A 3MYTA 2CFGA 1M9GA 3AGOA 3AHWA 4K1UA 1TRPA 1YNVX 3F40A 1A90A 1PY3A 1TJDA 2BMRB 2OOVC 4HBRA 1BRNL 1K734 1DVCA 3CD63 4CDLA 2CH9A 2C11A 3KIIA 4ORLA 1JB5A 4FCJA 4WP5A 3DGOA 1LOWA 4HKVB 2OTL3 2ML6A 3I553 2SARA 4CJNA 3NQZA 2F86B 5A0OB 3FG3A 5CF1A 3WA2X 1FGQA 4TX4A 3ZG5A 3F9SA 1KD14 3F14A 3T0UA 1VQN3 1A67A 2RNTA 1BNJA 4N6UA 1I3FA 3NBJA 3OXAA 2BT3A 3OWSA 3NXJA 1JKGA 2IUJA 4HM8B 3D79A 1IQ8A 1PYLA 3D5IA 3CME3 4HJLB 1YIT3 3NUVA 1OF5B 2UGIA 1FGOA 1FZUA 5AIGA 3SYUA 1RCKA 2HMJB 4HM5B 1B2SA 1F8NA 1HZ1A 5G1LA 1YJW3 3PS8A 3Q2PA 2F56A 1W6YA 1I8VA 1OF5A 5M19A 3B7CA 3FGYA 1RGAA 2KF3A 4O3VA 1VZZA 3GRDA 5JBSA 1DMNA 1JN5A 1GOYA 3NQYA 4IIAA 1QVF2 3PZWA 5HGRA 2Z7AA 4H61A 4WHAA 1V57A 1FA3A 3K9MC 1MOLA 3N54B 1AQZA 1BUJA 5G1KA 2WGOA 4HM3B 2STDA 3NBRA 2CWUA 1N8R4 1D6YA 2FGTA 3DH2A 3X41A 1AV4A 1AVLA 3G6E3 1JBSA 4OVMA 5CF2A 1NU3A 7STDA 1LVNA 1Z1SA 4HZ9B 3UJMA 3S67A 1C54A 1DE3A 2BIRA 4KT3B 1YJ93 3U1WA 2OWPA 2UX0A 3FLJA 1W6GA 5KP4A 1OHOA 3H3HA 3WMDA 1YGEA 1S723 1NWWA 3NX0A 4O02B 4BU4A 1A2PA 3OWUA 1O7PB 1CEWI 3WR2A 4XBYA 2CWTA 2GSPA 3ZFZA 1FGMA 1K9M4 1GMQA 1YVSA 3CU3A 1PFPA 1J2BA 1LOXA 4HOHA 3X3XA 5IEPA 3FKAA 1X1XA 1GOVA 2P0MA 1BAOA 3FG1A 5AYRB 3FF2A 3URPA 1AVKA 1B2UA 4NPBA 3X3YA 3RGAA 1O7MB 1WMPA 3ECFA 2CHCA 1HYFA 1QVG2 4FMCA 2F5MA 4K90B 4I4KA 1WTHA 4PEJA 3EQQB 1W7CA 1BGSA 1ZGXA 3D4AA 1TU5A 4L7KA 1ROAA 3EHCA 2RGQA 1AY7A 1IVWA 1RDSA 5TGNA 1TIJA 5D81A 2FXTA 1UUWB 4J5GA 1CYVA 1GMRA 4L8PA 3STDA 1UUVB 2IUKA 1BIRA 1B2ZA 1RGLA 3FZWA 1STFI 1B2MA 1ISKA 3D9RA 2XGLA 3CMA3 1O7GB 1BVIA 1QALA 4LZIA 2HMOB 3SLUA 3FG4A 3KZTA 4BL2A 1AR0A 2JDIH 2XRXB 2XFSA 1IV9A 1ZS7A 2W9PA 1HKXA 1NNVA 1UCJA 3EE1A 2GEXA 2FNQA 2HMLB 4FCZA 5CXOA 1TFKA 1VQP3 1SIIA 1I2EA 3JUOA 1N5HA 1OACA 3GSPA 3L0RA 4BIRA 2RSXA 1CQSA 2W2CA 5KP1A 4HVNA 3SOAA 4AEQA 3NM7A 3MKIA 1RGEA 4HM2B 2W56B 3GZBA 3JUNA 3LTCA 2Y73A 4KZ1A 4AKZA 3N9HA 2GEYA 1BRIA 1O7NB 2KRTA 1VQQA 1IT8A 2OQEA 2P05A 3FH1A 5KP3A 1BSBA 1UUGB 3SVAA 2BMOB 4CPKA 3LMLA 3NV0B 2BMQB 2ML5A 1ZO2A 5LC7A 1DYUA 1RN1A 2RFRA 2Y74A 4AKYA 5AI1A 3CCV3 1JJ22 1I0XA 2UUGC 1IQXA 1OCVA 2WGQA 1LQMB 3KN4A 3CCQ3 1JB4A 5BU4A 1NB3I 5IG4A 2K54A 3JUPA 5D83A 1SJWA 2QGUA 1RGCA 1BNGA 2D42A 2CFWA 5M1AA 3F8XA 3BLZA 3CC23 2E2TA 3GAXA 1B3SA 3EB8A 3N8BA 1T3BA 1QAKA 4GHOA 4O2HA 2XEPA 5LC6A 1Q7HA 3V98A 4R9KA 1ZX2A 4LYLB 1RJOA 3JVCA 3FCSB 1VQ53 1OGXA 1OGZA 2XH9A 1KWIA 2INXA 2E2UA 4FMDA 1YIJ3 3T8UA 3UNLA 6RNTA 1MWRA 1QJGA 2YFLB 5JPPA 3UL6A 2QIYA 3WA3A 2KAAA 4MMZB 3CCE3 1K28A 1UI8A 2H0HA 3MG3A 3B4PA 1LQGC 1VQ93 2L1SA 3CCL3 3GZXB 2PNCA 1QMAA 2V1LA 3TDGA 3CCM3 1GD4A 2L4VA 1BSEA 1BSCA 1GS3A 3AHSA 4HYZA 1RGGA 5RNTA 3PXMA 1YJN3 4N6V0 1Q864 2WOFA 2PZVA 4RBNA 3V92A 1OHSA 1UDII 4QWTA 4STDA 3G0KA 4FMBA 1OHPA 5IG5A 4KFEA 3EN1B 2CC3A 2OOVA 2Z77A 2YX9A 4IT7A 2MC8A 3DZLA 3CCR3 1I70A 3S28A 1YHQ3 2JQ5A 1BRGA 2IA7A 3BNCA 1B20A 1STDA 1GY5A 1RNTA 3EBYA 2IY2A 1GY7A 4H3UA 4HM0B 1UCLA 3G8ZA 1Q40B 3CCU3 1W02A 4R4KA 2LYXA 3LYGA 2BNGA 4K1VA 3WOEB 4EC6A 1PU4A 3G4S3 2CW9A 4J8TA 3HX8A 1LNHA 2K0MA 4R80A 5HOHA 1Q824 2W9QA 1D6UA 3JUQA 1FGTA 1Q40A 1W01A 3OX9A 4LGQA 3CC43 1G0TA 1RLSA 4N6LA 1U5OA 4WYKB 1LOVA 1KSIA 4DKIA 4J5KA 5EEOA 2F98A 5IERA 3ALAA 1ULJB 1E3RA 3MWZA 1Q814 1SQWA 3GZRA 2OTJ3 3K7CA 2CK3H 3G16A 3KCHA 1W2ZA 2Z76A 3EN8A 3PYJA 2B1XB 1JZOA 1NO3A 2F99A 2CFDA 3K5TA 3MG1A 3LTAA 3HZPA 1IVXA 3D5GA 2GBXB 5FGOA 3VF1A 1IK3A 3SEDA 1U8CB 5BIRA 1MGRA 2R41A 1Y4KA 3A5EA 3DGNA 1X1YA 5IENA 3DUKA 4IPBA 1UI7A 2XGNA 3PCSA 1X1WA 4RZMA 1VQM3 2C10A 5AIFA 2XF3A 3MG2A 2K3DA 1RKYA 1JBTA 2W6JH 3EX9A 1BRSA 1JBRA 1Q9EA 1VQ63 1BNRA 4X2OA 3DXOA 3GZYB 1LRAA 1QAFA 3HIIA 1TUHA 3DM8A 1BRKA 3LXUX 4LSOA 3UB1A 2IYJA 5AEWB 4OUQA 5DREA 3LOYA 1FGRA 1WMNA 4FCMA 1B21A 1K8A4 4X2HA 1RGFA 1BANA 1OUNA 3IJEB 4JRFA 1VQK3 4G1MB 9RNTA 3G713 7GSPA 3SOYA 3AMOB 1FYSA 1ROVA 3LT8A 3A76A 5DRVA 3CC73 2GXFA 1FW7A 4KFFA 1WQLB 1MWTA 3X42A 5IF6A 4LEHA 1Q42A 8CHOA 1T5YA 2RBIA 4XM4A 1GSPA 5BVBA 1CH0A 4HZBB 1B2XA 1JRQA 1IVUA 1IV7A 2F4YA 2KF6A 2W56A 4EV5A 3EC9A 1NJI4 1DVDA 4J9AA 1RNBA 3LH4A 2YFIB 3HK4A 3SX1A 5AEUB 3I563 4N3VA 3DY5A 1MNLA 1A2VA 1OH0A 1BUQA 3BNEA 1V58A 1W6CA 4NREA 2AADA 4O8SA 3X40A 3ZG0A 3CXC2 1MGWA 2C4BA 2CFLA 2WOHA 3BB9A 3F7XA 3NV0A 4RNZA 5I97A 2WO0A 2P0XA 3LT9A 1I2GA 3ROBA 3RNTA 5GSPA 2P09A 2CX0A 1RTUA 1W00A 3NHXA 4WFOA 1UW1A 2XSHB 3NM2A 5FW5A 1O7HB 1YVBI 4NHFA 3B4OA 4EYCA 2CIUA 3F7SA 2I9WA 4XDWA 2CG0A 2CX1A 3CNMA 1LNIA 4WWUC 6GSPA 3WOFB 3FSDA 3H51A 1MWUA 1RHLA 1UCKA 1RN4A 1M1XB 1KQS2 1BOXA 4MMXB 2ZA4A 3E99A 2ZHXB 3B8LA 2B24B 3DMCA 4FR9A 2CKFB 3WODG 4BL3A 1BNFA 2ZL8A 3KFQC 1I0VA 1D6ZA 1TFOA 1UGHI 2P38A 2SBLA 3IMAB 3QRDA 4U13A 1VQL3 2RCDA 1N9JA 3BU4A 3AGNA 5EVHA 3T8NA 4EXRA 1RGKA 4OK0A 1US1A 1YGWA 1DMMA 1L5GB 3UL5A 3LZAA 3OWYA 3FF0A 3VGNA 3BNBA 2KCDA 3CCJ3 1NB5I 2W03A 3M8CA 5JPUA 3GWRA 3HOHA 3K63A 3EBTA 1EA2A 1JKGB 2GBWB 1GD3A 3MHEA 5ELJA 5ELUA 1IVVA 3S27A 1TTOA 5STDA 2XR8B 2H0IA 2IMJA 1EQKA 4HM4B 4N6TA 1NDOB 1M1K4 3BIRA 5IG0A 2W0QA 2HMMB 3EF8A 4HM1B 4XBXA 1RMSA 1TP6A 1IU7A 1RN7A 5AIHA 1WNHA 1FUSA 1JN5B 4BTXA 4HM6B 1IDPA 1MWSA 2CWVA 3MPHA 1T2HA 1ASKA 7RNTA 1GYBA 1S5AA 2CFKA 3HIGA 3PGBA 5EQLA 1VQ83 1IQYA 1B27A 3DGMA 4FMAA 3Q3FA 5IG3A 1R4YA 1SIHA 4N6NB 3KSPA 4GSPA 1JNQA 2CG1A 3U97A 1T2IA 1TRQA 4L8OA 2HOHA 2OCTA 2XSOB 3QK9A 3KKGA 4MEIA
chains in the Genus database with same CATH topology
1RN1A 1BRKA 1PYLA 3D5IA 1I0XA 1FUTA 3SYUA 1FZUA 3WHOA 1B21A 1RCKA 1RGFA 1BANA 5BU4A 1B2SA 1I3IA 1HZ1A 1I2FA 1GOUA 9RNTA 1BNEA 7GSPA 1RGCA 1BNGA 2F56A 2F5WA 1I8VA 1GMPA 1UCIA 1FYSA 1RGAA 2KF3A 1B3SA 1FW7A 4GHOA 1GOYA 2RBIA 1GSPA 1IYYA 1CH0A 1B2XA 1AQZA 4RNTA 2F4YA 2KF6A 1BUJA 2AAEA 6RNTA 1RNBA 2BU4A 2KF5A 3DH2A 1JBSA 1BSDA 2KAAA 2AADA 1X1UA 1MGWA 2C4BA 1BNIA 1C54A 1DE3A 2BIRA 1I2GA 1BU4A 3RNTA 5GSPA 4BU4A 1RTUA 1A2PA 1BSAA 1BSEA 1BSCA 3AHSA 3WR2A 2GSPA 1RGGA 3DGYA 5RNTA 1GMQA 1YVSA 4HOHA 1LNIA 1X1XA 6GSPA 1GOVA 1RHLA 1UCKA 1BAOA 1RN4A 1BOXA 3URPA 2ZA4A 1B2UA 2KF4A 4HAAA 1BNFA 1I70A 1HYFA 1I0VA 1BRGA 2F5MA 1B20A 1RNTA 1BGSA 1ZGXA 3AGNA 3BU4A 1UCLA 1RGKA 3D4AA 1YGWA 1RGHA 1BRHA 1AY7A 1RDSA 1RSNA 4J5GA 1GMRA 1LOYA 1DETA 5HOHA 1G02A 1RCLA 8RNTA 3HOHA 1BNSA 1BIRA 1B2ZA 1RGLA 1BRJA 1B2MA 1SARA 1RLSA 1LOVA 1BVIA 4J5KA 1TTOA 3AGOA 3AHWA 1UCJA 1TRPA 1YNVX 3KCHA 1PY3A 3BIRA 1I2EA 1RMSA 4BIRA 1BRNL 3GSPA 1FUSA 3D5GA 7RNTA 1T2HA 1RGEA 1LOWA 1MGRA 5BIRA 3A5EA 1X1YA 1BRIA 2SARA 1B27A 1X1WA 1BSBA 3Q3FA 1R4YA 1JBTA 4GSPA 1T2IA 1BRSA 1TRQA 2HOHA 1BNJA 2RNTA 1I3FA 1JBRA 1Q9EA 1BNRA 1LRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RN1 A;  1BRK A;  1PYL A;  3D5I A;  1I0X A;  1FUT A;  3SYU A;  1FZU A;  3WHO A;  1B21 A;  1RCK A;  1RGF A;  1BAN A;  5BU4 A;  1B2S A;  1I3I A;  1HZ1 A;  1I2F A;  1GOU A;  9RNT A;  1BNE A;  7GSP A;  1RGC A;  1BNG A;  2F56 A;  2F5W A;  1I8V A;  1GMP A;  1UCI A;  1FYS A;  1RGA A;  2KF3 A;  1B3S A;  1FW7 A;  4GHO A;  1GOY A;  2RBI A;  1GSP A;  1IYY A;  1CH0 A;  1B2X A;  1AQZ A;  4RNT A;  2F4Y A;  2KF6 A;  1BUJ A;  2AAE A;  6RNT A;  1RNB A;  2BU4 A;  2KF5 A;  3DH2 A;  1JBS A;  1BSD A;  2KAA A;  2AAD A;  1X1U A;  1MGW A;  2C4B A;  1BNI A;  1C54 A;  1DE3 A;  2BIR A;  1I2G A;  1BU4 A;  3RNT A;  5GSP A;  4BU4 A;  1RTU A;  1A2P A;  1BSA A;  1BSE A;  1BSC A;  3AHS A;  3WR2 A;  2GSP A;  1RGG A;  3DGY A;  5RNT A;  1GMQ A;  1YVS A;  4HOH A;  1LNI A;  1X1X A;  6GSP A;  1GOV A;  1RHL A;  1UCK A;  1BAO A;  1RN4 A;  1BOX A;  3URP A;  2ZA4 A;  1B2U A;  2KF4 A;  4HAA A;  1BNF A;  1I70 A;  1HYF A;  1I0V A;  1BRG A;  2F5M A;  1B20 A;  1RNT A;  1BGS A;  1ZGX A;  3AGN A;  3BU4 A;  1UCL A;  1RGK A;  3D4A A;  1YGW A;  1RGH A;  1BRH A;  1AY7 A;  1RDS A;  1RSN A;  4J5G A;  1GMR A;  1LOY A;  1DET A;  5HOH A;  1G02 A;  1RCL A;  8RNT A;  3HOH A;  1BNS A;  1BIR A;  1B2Z A;  1RGL A;  1BRJ A;  1B2M A;  1SAR A;  1RLS A;  1LOV A;  1BVI A;  4J5K A;  1TTO A;  3AGO A;  3AHW A;  1UCJ A;  1TRP A;  1YNV X;  3KCH A;  1PY3 A;  3BIR A;  1I2E A;  1RMS A;  4BIR A;  1BRN L;  3GSP A;  1FUS A;  3D5G A;  7RNT A;  1T2H A;  1RGE A;  1LOW A;  1MGR A;  5BIR A;  3A5E A;  1X1Y A;  1BRI A;  2SAR A;  1B27 A;  1X1W A;  1BSB A;  3Q3F A;  1R4Y A;  1JBT A;  4GSP A;  1T2I A;  1BRS A;  1TRQ A;  2HOH A;  1BNJ A;  2RNT A;  1I3F A;  1JBR A;  1Q9E A;  1BNR A;  1LRA A; 
#chains in the Genus database with same CATH topology
 5G2G A;  3PCR A;  3VSY A;  3D3L A;  3X3Z A;  4WYK A;  1FUT A;  3NBB A;  2ZDJ A;  1M90 4;  1W4N A;  1E3V A;  2Q07 A;  3WHO A;  3WDG B;  4CCV A;  1YI2 3;  2D1W A;  3ER7 A;  1KC8 4;  2A15 A;  1I3I A;  3RDE A;  1VQ7 3;  4I5Q A;  1I2F A;  2E2V A;  3DGL A;  1GOU A;  2BHM A;  1BNE A;  1EEJ A;  2F5W A;  2MF7 A;  4MJD A;  5IEO A;  5IW9 A;  2QA4 3;  1GMP A;  1W2B 2;  1FUW A;  1UCI A;  1R4C A;  1DMQ A;  4ZM8 A;  1N9E A;  1LXE A;  4EV2 A;  2Z6B A;  3LTD A;  4JF8 A;  5BXQ A;  1Q7Y 4;  3KSE D;  3I0Y A;  3LTB A;  1JV2 B;  2QEX 3;  1IYY A;  2OQE C;  3O8Y A;  1EUI C;  4KFD A;  4RNT A;  3MSO A;  3HI7 A;  1RRL A;  2AAE A;  2BU4 A;  2KF5 A;  4R1K A;  1CYU A;  4GB5 A;  2GU3 A;  4LMI A;  3OW2 2;  2KXG A;  6STD A;  1BSD A;  5M18 A;  4XB5 A;  3J7Y d;  1X1U A;  1WMO A;  1N8Q A;  3CPO A;  1BNI A;  3CCS 3;  1G96 A;  4XDV A;  1BU4 A;  5D82 A;  1VQ4 3;  3SXX A;  3KE7 A;  3RGR A;  1BSA A;  5CK6 A;  3EJV A;  1IT7 A;  3DGY A;  1A2K A;  3IPT A;  3V99 A;  5AII A;  4EBG A;  1VQO 3;  5AYS C;  1JB2 A;  4HM7 B;  4MMY B;  1RRH A;  3AMO A;  3BND A;  3CPW 2;  1SPU A;  1JZD A;  2J8X B;  4XBT A;  2GU1 A;  3Q1C A;  2HMK B;  1E97 A;  2KF4 A;  3K0Z A;  4HAA A;  4K61 A;  3F8H A;  2W04 A;  1O7W B;  2HMN B;  2YFJ B;  4ILF A;  4BTY A;  1GY6 A;  1K41 A;  3CNX A;  2R4I A;  2XFT A;  1V74 A;  4N6O B;  2O9U X;  1C7H A;  4RNY A;  1HU9 A;  3OV4 A;  1OPY A;  1RGH A;  1BRH A;  1N5P A;  2H0G A;  4Q53 A;  4BTW A;  2O3O A;  4R9L A;  1RSN A;  3JUM A;  2M7O A;  2BO9 B;  1LOY A;  1DET A;  1G02 A;  1EKM A;  1RCL A;  8RNT A;  1W5Z A;  1BNS A;  1BRJ A;  4KVH A;  4EW5 A;  4N6M A;  1UGI A;  1SAR A;  1ULI B;  2LQV A;  3S29 A;  3S5C A;  1EG9 B;  4GL6 A;  5CLK A;  3Q90 A;  3MYT A;  2CFG A;  1M9G A;  3AGO A;  3AHW A;  4K1U A;  1TRP A;  1YNV X;  3F40 A;  1A90 A;  1PY3 A;  1TJD A;  2BMR B;  2OOV C;  4HBR A;  1BRN L;  1K73 4;  1DVC A;  3CD6 3;  4CDL A;  2CH9 A;  2C11 A;  3KII A;  4ORL A;  1JB5 A;  4FCJ A;  4WP5 A;  3DGO A;  1LOW A;  4HKV B;  2OTL 3;  2ML6 A;  3I55 3;  2SAR A;  4CJN A;  3NQZ A;  2F86 B;  5A0O B;  3FG3 A;  5CF1 A;  3WA2 X;  1FGQ A;  4TX4 A;  3ZG5 A;  3F9S A;  1KD1 4;  3F14 A;  3T0U A;  1VQN 3;  1A67 A;  2RNT A;  1BNJ A;  4N6U A;  1I3F A;  3NBJ A;  3OXA A;  2BT3 A;  3OWS A;  3NXJ A;  1JKG A;  2IUJ A;  4HM8 B;  3D79 A;  1IQ8 A;  1PYL A;  3D5I A;  3CME 3;  4HJL B;  1YIT 3;  3NUV A;  1OF5 B;  2UGI A;  1FGO A;  1FZU A;  5AIG A;  3SYU A;  1RCK A;  2HMJ B;  4HM5 B;  1B2S A;  1F8N A;  1HZ1 A;  5G1L A;  1YJW 3;  3PS8 A;  3Q2P A;  2F56 A;  1W6Y A;  1I8V A;  1OF5 A;  5M19 A;  3B7C A;  3FGY A;  1RGA A;  2KF3 A;  4O3V A;  1VZZ A;  3GRD A;  5JBS A;  1DMN A;  1JN5 A;  1GOY A;  3NQY A;  4IIA A;  1QVF 2;  3PZW A;  5HGR A;  2Z7A A;  4H61 A;  4WHA A;  1V57 A;  1FA3 A;  3K9M C;  1MOL A;  3N54 B;  1AQZ A;  1BUJ A;  5G1K A;  2WGO A;  4HM3 B;  2STD A;  3NBR A;  2CWU A;  1N8R 4;  1D6Y A;  2FGT A;  3DH2 A;  3X41 A;  1AV4 A;  1AVL A;  3G6E 3;  1JBS A;  4OVM A;  5CF2 A;  1NU3 A;  7STD A;  1LVN A;  1Z1S A;  4HZ9 B;  3UJM A;  3S67 A;  1C54 A;  1DE3 A;  2BIR A;  4KT3 B;  1YJ9 3;  3U1W A;  2OWP A;  2UX0 A;  3FLJ A;  1W6G A;  5KP4 A;  1OHO A;  3H3H A;  3WMD A;  1YGE A;  1S72 3;  1NWW A;  3NX0 A;  4O02 B;  4BU4 A;  1A2P A;  3OWU A;  1O7P B;  1CEW I;  3WR2 A;  4XBY A;  2CWT A;  2GSP A;  3ZFZ A;  1FGM A;  1K9M 4;  1GMQ A;  1YVS A;  3CU3 A;  1PFP A;  1J2B A;  1LOX A;  4HOH A;  3X3X A;  5IEP A;  3FKA A;  1X1X A;  1GOV A;  2P0M A;  1BAO A;  3FG1 A;  5AYR B;  3FF2 A;  3URP A;  1AVK A;  1B2U A;  4NPB A;  3X3Y A;  3RGA A;  1O7M B;  1WMP A;  3ECF A;  2CHC A;  1HYF A;  1QVG 2;  4FMC A;  2F5M A;  4K90 B;  4I4K A;  1WTH A;  4PEJ A;  3EQQ B;  1W7C A;  1BGS A;  1ZGX A;  3D4A A;  1TU5 A;  4L7K A;  1ROA A;  3EHC A;  2RGQ A;  1AY7 A;  1IVW A;  1RDS A;  5TGN A;  1TIJ A;  5D81 A;  2FXT A;  1UUW B;  4J5G A;  1CYV A;  1GMR A;  4L8P A;  3STD A;  1UUV B;  2IUK A;  1BIR A;  1B2Z A;  1RGL A;  3FZW A;  1STF I;  1B2M A;  1ISK A;  3D9R A;  2XGL A;  3CMA 3;  1O7G B;  1BVI A;  1QAL A;  4LZI A;  2HMO B;  3SLU A;  3FG4 A;  3KZT A;  4BL2 A;  1AR0 A;  2JDI H;  2XRX B;  2XFS A;  1IV9 A;  1ZS7 A;  2W9P A;  1HKX A;  1NNV A;  1UCJ A;  3EE1 A;  2GEX A;  2FNQ A;  2HML B;  4FCZ A;  5CXO A;  1TFK A;  1VQP 3;  1SII A;  1I2E A;  3JUO A;  1N5H A;  1OAC A;  3GSP A;  3L0R A;  4BIR A;  2RSX A;  1CQS A;  2W2C A;  5KP1 A;  4HVN A;  3SOA A;  4AEQ A;  3NM7 A;  3MKI A;  1RGE A;  4HM2 B;  2W56 B;  3GZB A;  3JUN A;  3LTC A;  2Y73 A;  4KZ1 A;  4AKZ A;  3N9H A;  2GEY A;  1BRI A;  1O7N B;  2KRT A;  1VQQ A;  1IT8 A;  2OQE A;  2P05 A;  3FH1 A;  5KP3 A;  1BSB A;  1UUG B;  3SVA A;  2BMO B;  4CPK A;  3LML A;  3NV0 B;  2BMQ B;  2ML5 A;  1ZO2 A;  5LC7 A;  1DYU A;  1RN1 A;  2RFR A;  2Y74 A;  4AKY A;  5AI1 A;  3CCV 3;  1JJ2 2;  1I0X A;  2UUG C;  1IQX A;  1OCV A;  2WGQ A;  1LQM B;  3KN4 A;  3CCQ 3;  1JB4 A;  5BU4 A;  1NB3 I;  5IG4 A;  2K54 A;  3JUP A;  5D83 A;  1SJW A;  2QGU A;  1RGC A;  1BNG A;  2D42 A;  2CFW A;  5M1A A;  3F8X A;  3BLZ A;  3CC2 3;  2E2T A;  3GAX A;  1B3S A;  3EB8 A;  3N8B A;  1T3B A;  1QAK A;  4GHO A;  4O2H A;  2XEP A;  5LC6 A;  1Q7H A;  3V98 A;  4R9K A;  1ZX2 A;  4LYL B;  1RJO A;  3JVC A;  3FCS B;  1VQ5 3;  1OGX A;  1OGZ A;  2XH9 A;  1KWI A;  2INX A;  2E2U A;  4FMD A;  1YIJ 3;  3T8U A;  3UNL A;  6RNT A;  1MWR A;  1QJG A;  2YFL B;  5JPP A;  3UL6 A;  2QIY A;  3WA3 A;  2KAA A;  4MMZ B;  3CCE 3;  1K28 A;  1UI8 A;  2H0H A;  3MG3 A;  3B4P A;  1LQG C;  1VQ9 3;  2L1S A;  3CCL 3;  3GZX B;  2PNC A;  1QMA A;  2V1L A;  3TDG A;  3CCM 3;  1GD4 A;  2L4V A;  1BSE A;  1BSC A;  1GS3 A;  3AHS A;  4HYZ A;  1RGG A;  5RNT A;  3PXM A;  1YJN 3;  4N6V 0;  1Q86 4;  2WOF A;  2PZV A;  4RBN A;  3V92 A;  1OHS A;  1UDI I;  4QWT A;  4STD A;  3G0K A;  4FMB A;  1OHP A;  5IG5 A;  4KFE A;  3EN1 B;  2CC3 A;  2OOV A;  2Z77 A;  2YX9 A;  4IT7 A;  2MC8 A;  3DZL A;  3CCR 3;  1I70 A;  3S28 A;  1YHQ 3;  2JQ5 A;  1BRG A;  2IA7 A;  3BNC A;  1B20 A;  1STD A;  1GY5 A;  1RNT A;  3EBY A;  2IY2 A;  1GY7 A;  4H3U A;  4HM0 B;  1UCL A;  3G8Z A;  1Q40 B;  3CCU 3;  1W02 A;  4R4K A;  2LYX A;  3LYG A;  2BNG A;  4K1V A;  3WOE B;  4EC6 A;  1PU4 A;  3G4S 3;  2CW9 A;  4J8T A;  3HX8 A;  1LNH A;  2K0M A;  4R80 A;  5HOH A;  1Q82 4;  2W9Q A;  1D6U A;  3JUQ A;  1FGT A;  1Q40 A;  1W01 A;  3OX9 A;  4LGQ A;  3CC4 3;  1G0T A;  1RLS A;  4N6L A;  1U5O A;  4WYK B;  1LOV A;  1KSI A;  4DKI A;  4J5K A;  5EEO A;  2F98 A;  5IER A;  3ALA A;  1ULJ B;  1E3R A;  3MWZ A;  1Q81 4;  1SQW A;  3GZR A;  2OTJ 3;  3K7C A;  2CK3 H;  3G16 A;  3KCH A;  1W2Z A;  2Z76 A;  3EN8 A;  3PYJ A;  2B1X B;  1JZO A;  1NO3 A;  2F99 A;  2CFD A;  3K5T A;  3MG1 A;  3LTA A;  3HZP A;  1IVX A;  3D5G A;  2GBX B;  5FGO A;  3VF1 A;  1IK3 A;  3SED A;  1U8C B;  5BIR A;  1MGR A;  2R41 A;  1Y4K A;  3A5E A;  3DGN A;  1X1Y A;  5IEN A;  3DUK A;  4IPB A;  1UI7 A;  2XGN A;  3PCS A;  1X1W A;  4RZM A;  1VQM 3;  2C10 A;  5AIF A;  2XF3 A;  3MG2 A;  2K3D A;  1RKY A;  1JBT A;  2W6J H;  3EX9 A;  1BRS A;  1JBR A;  1Q9E A;  1VQ6 3;  1BNR A;  4X2O A;  3DXO A;  3GZY B;  1LRA A;  1QAF A;  3HII A;  1TUH A;  3DM8 A;  1BRK A;  3LXU X;  4LSO A;  3UB1 A;  2IYJ A;  5AEW B;  4OUQ A;  5DRE A;  3LOY A;  1FGR A;  1WMN A;  4FCM A;  1B21 A;  1K8A 4;  4X2H A;  1RGF A;  1BAN A;  1OUN A;  3IJE B;  4JRF A;  1VQK 3;  4G1M B;  9RNT A;  3G71 3;  7GSP A;  3SOY A;  3AMO B;  1FYS A;  1ROV A;  3LT8 A;  3A76 A;  5DRV A;  3CC7 3;  2GXF A;  1FW7 A;  4KFF A;  1WQL B;  1MWT A;  3X42 A;  5IF6 A;  4LEH A;  1Q42 A;  8CHO A;  1T5Y A;  2RBI A;  4XM4 A;  1GSP A;  5BVB A;  1CH0 A;  4HZB B;  1B2X A;  1JRQ A;  1IVU A;  1IV7 A;  2F4Y A;  2KF6 A;  2W56 A;  4EV5 A;  3EC9 A;  1NJI 4;  1DVD A;  4J9A A;  1RNB A;  3LH4 A;  2YFI B;  3HK4 A;  3SX1 A;  5AEU B;  3I56 3;  4N3V A;  3DY5 A;  1MNL A;  1A2V A;  1OH0 A;  1BUQ A;  3BNE A;  1V58 A;  1W6C A;  4NRE A;  2AAD A;  4O8S A;  3X40 A;  3ZG0 A;  3CXC 2;  1MGW A;  2C4B A;  2CFL A;  2WOH A;  3BB9 A;  3F7X A;  3NV0 A;  4RNZ A;  5I97 A;  2WO0 A;  2P0X A;  3LT9 A;  1I2G A;  3ROB A;  3RNT A;  5GSP A;  2P09 A;  2CX0 A;  1RTU A;  1W00 A;  3NHX A;  4WFO A;  1UW1 A;  2XSH B;  3NM2 A;  5FW5 A;  1O7H B;  1YVB I;  4NHF A;  3B4O A;  4EYC A;  2CIU A;  3F7S A;  2I9W A;  4XDW A;  2CG0 A;  2CX1 A;  3CNM A;  1LNI A;  4WWU C;  6GSP A;  3WOF B;  3FSD A;  3H51 A;  1MWU A;  1RHL A;  1UCK A;  1RN4 A;  1M1X B;  1KQS 2;  1BOX A;  4MMX B;  2ZA4 A;  3E99 A;  2ZHX B;  3B8L A;  2B24 B;  3DMC A;  4FR9 A;  2CKF B;  3WOD G;  4BL3 A;  1BNF A;  2ZL8 A;  3KFQ C;  1I0V A;  1D6Z A;  1TFO A;  1UGH I;  2P38 A;  2SBL A;  3IMA B;  3QRD A;  4U13 A;  1VQL 3;  2RCD A;  1N9J A;  3BU4 A;  3AGN A;  5EVH A;  3T8N A;  4EXR A;  1RGK A;  4OK0 A;  1US1 A;  1YGW A;  1DMM A;  1L5G B;  3UL5 A;  3LZA A;  3OWY A;  3FF0 A;  3VGN A;  3BNB A;  2KCD A;  3CCJ 3;  1NB5 I;  2W03 A;  3M8C A;  5JPU A;  3GWR A;  3HOH A;  3K63 A;  3EBT A;  1EA2 A;  1JKG B;  2GBW B;  1GD3 A;  3MHE A;  5ELJ A;  5ELU A;  1IVV A;  3S27 A;  1TTO A;  5STD A;  2XR8 B;  2H0I A;  2IMJ A;  1EQK A;  4HM4 B;  4N6T A;  1NDO B;  1M1K 4;  3BIR A;  5IG0 A;  2W0Q A;  2HMM B;  3EF8 A;  4HM1 B;  4XBX A;  1RMS A;  1TP6 A;  1IU7 A;  1RN7 A;  5AIH A;  1WNH A;  1FUS A;  1JN5 B;  4BTX A;  4HM6 B;  1IDP A;  1MWS A;  2CWV A;  3MPH A;  1T2H A;  1ASK A;  7RNT A;  1GYB A;  1S5A A;  2CFK A;  3HIG A;  3PGB A;  5EQL A;  1VQ8 3;  1IQY A;  1B27 A;  3DGM A;  4FMA A;  3Q3F A;  5IG3 A;  1R4Y A;  1SIH A;  4N6N B;  3KSP A;  4GSP A;  1JNQ A;  2CG1 A;  3U97 A;  1T2I A;  1TRQ A;  4L8O A;  2HOH A;  2OCT A;  2XSO B;  3QK9 A;  3KKG A;  4MEI A; 
#chains in the Genus database with same CATH homology
 1RN1 A;  1BRK A;  1PYL A;  3D5I A;  1I0X A;  1FUT A;  3SYU A;  1FZU A;  3WHO A;  1B21 A;  1RCK A;  1RGF A;  1BAN A;  5BU4 A;  1B2S A;  1I3I A;  1HZ1 A;  1I2F A;  1GOU A;  9RNT A;  1BNE A;  7GSP A;  1RGC A;  1BNG A;  2F56 A;  2F5W A;  1I8V A;  1GMP A;  1UCI A;  1FYS A;  1RGA A;  2KF3 A;  1B3S A;  1FW7 A;  4GHO A;  1GOY A;  2RBI A;  1GSP A;  1IYY A;  1CH0 A;  1B2X A;  1AQZ A;  4RNT A;  2F4Y A;  2KF6 A;  1BUJ A;  2AAE A;  6RNT A;  1RNB A;  2BU4 A;  2KF5 A;  3DH2 A;  1JBS A;  1BSD A;  2KAA A;  2AAD A;  1X1U A;  1MGW A;  2C4B A;  1BNI A;  1C54 A;  1DE3 A;  2BIR A;  1I2G A;  1BU4 A;  3RNT A;  5GSP A;  4BU4 A;  1RTU A;  1A2P A;  1BSA A;  1BSE A;  1BSC A;  3AHS A;  3WR2 A;  2GSP A;  1RGG A;  3DGY A;  5RNT A;  1GMQ A;  1YVS A;  4HOH A;  1LNI A;  1X1X A;  6GSP A;  1GOV A;  1RHL A;  1UCK A;  1BAO A;  1RN4 A;  1BOX A;  3URP A;  2ZA4 A;  1B2U A;  2KF4 A;  4HAA A;  1BNF A;  1I70 A;  1HYF A;  1I0V A;  1BRG A;  2F5M A;  1B20 A;  1RNT A;  1BGS A;  1ZGX A;  3AGN A;  3BU4 A;  1UCL A;  1RGK A;  3D4A A;  1YGW A;  1RGH A;  1BRH A;  1AY7 A;  1RDS A;  1RSN A;  4J5G A;  1GMR A;  1LOY A;  1DET A;  5HOH A;  1G02 A;  1RCL A;  8RNT A;  3HOH A;  1BNS A;  1BIR A;  1B2Z A;  1RGL A;  1BRJ A;  1B2M A;  1SAR A;  1RLS A;  1LOV A;  1BVI A;  4J5K A;  1TTO A;  3AGO A;  3AHW A;  1UCJ A;  1TRP A;  1YNV X;  3KCH A;  1PY3 A;  3BIR A;  1I2E A;  1RMS A;  4BIR A;  1BRN L;  3GSP A;  1FUS A;  3D5G A;  7RNT A;  1T2H A;  1RGE A;  1LOW A;  1MGR A;  5BIR A;  3A5E A;  1X1Y A;  1BRI A;  2SAR A;  1B27 A;  1X1W A;  1BSB A;  3Q3F A;  1R4Y A;  1JBT A;  4GSP A;  1T2I A;  1BRS A;  1TRQ A;  2HOH A;  1BNJ A;  2RNT A;  1I3F A;  1JBR A;  1Q9E A;  1BNR A;  1LRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...