2KAAA

Solution structure of hirsutellin a from hirsutella thompsonii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
130
structure length
130
Chain Sequence
APIVTCRPKLDGREKPFKVDVATAQAQARKAGLTTGKSGDPHRYFAGDHIRWGVNNCDKADAILWEYPIYWVGKNAEWAKDVKTSQQKGGPTPIRVVYANSRGAVQYCGVMTHSKVDKNNQGKEFFEKCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of hirsutellin A--new insights into the active site and interacting interfaces of ribotoxins.
pubmed rcsb
molecule tags Toxin
molecule keywords Hirsutellin A
total genus 15
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kaaA00
1BRIA 2KF4A 6GSPA 1X1XA 1AQZA 1SARA 1RTUA 1RSNA 1T2HA 1X1UA 1BSCA 1UCLA 4J5GA 1BU4A 1RGLA 2HOHA 2F56A 5BU4A 1LOVA 1B2SA 1BSDA 2KF3A 2RBIA 1RDSA 1BOXA 1T2IA 2SARA 1RGCA 1RLSA 3A5EA 1BUJA 1BGSA 4HOHA 1GMRA 1B27A 3RNTA 2GSPA 2KAAA 3BIRA 1BSBA 1GMQA 4BU4A 1BNFA 1BRJA 1GOVA 1LRAA 1X1WA 1I3FA 1DETA 1JBSA 3AHWA 1BNGA 2BU4A 1BRKA 1FYSA 1I3IA 1UCIA 3D5GA 1RMSA 1YGWA 1GMPA 4BIRA 1MGRA 3AHSA 1BNEA 1BAOA 3HOHA 1I0XA 3URPA 1MGWA 2AAEA 1TTOA 3AGOA 1HYFA 2AADA 3AGNA 1RGHA 1TRPA 1B3SA 1GOUA 1G02A 1GOYA 1PY3A 1R4YA 1FUSA 4J5KA 1UCKA 7RNTA 1I2FA 1RGGA 1ZGXA 1RHLA 3WHOA 1LNIA 3D5IA 1FZUA 1CH0A 1Q9EA 1FW7A 1YNVX 8RNTA 1DE3A 2KF6A 1BNJA 2KF5A 4HAAA 5HOHA 1LOYA 3BU4A 3SYUA 1RNTA 1LOWA 1RGEA 1FUTA 2F5WA 2RNTA 1B2UA 1BRGA 7GSPA 3WR2A 1RN4A 3KCHA 1C54A 1B2MA 4RNTA 1TRQA 3GSPA 3D4AA 1GSPA 1I2GA 2F4YA 6RNTA 3DH2A 1BSAA 1BNRA 1RGAA 1JBTA 1PYLA 1X1YA 1RN1A 1BNIA 2BIRA 2C4BA 1BNSA 3Q3FA 1RNBA 4GHOA 1UCJA 1RGFA 1BANA 2ZA4A 9RNTA 1I70A 1IYYA 1BRNL 1BVIA 1AY7A 1HZ1A 5RNTA 1I8VA 4GSPA 1B2XA 2F5MA 1I2EA 1BIRA 1RCLA 5GSPA 1B20A 1JBRA 5BIRA 1BRSA 1B2ZA 1BSEA 1RGKA 1A2PA 1I0VA 1YVSA 1BRHA 1RCKA 1B21A 3DGYA
chains in the Genus database with same CATH superfamily
5KP4A 1BRIA 2IYJA 3PYJA 1U5OA 1AQZA 1UUVB 1QALA 3I553 2Z7AA 1RTUA 3PS8A 1Q814 1X1UA 1BSCA 2MF7A 3V92A 1EUIC 1IVVA 3PGBA 4HJLB 2HOHA 2F56A 3S28A 2YFJB 3KFQC 3DUKA 3FG1A 2LQVA 2RBIA 3X3ZA 1M1K4 1RDSA 1Y4KA 1RJOA 1T2IA 2CFKA 2K0MA 5ELUA 3S5CA 3T8NA 4HOHA 4AKZA 4EYCA 3GRDA 1WMNA 1J2BA 4OUQA 3DZLA 1UUWB 4O2HA 2E2UA 3F9SA 3LZAA 1DETA 3F14A 4R9KA 3G4S3 3CCS3 1N9JA 1DYUA 2BU4A 1BRKA 4EV2A 4EW5A 1VQ73 3D5GA 1W6CA 2CW9A 2ZL8A 4STDA 2C11A 1WTHA 3AMOA 2Q07A 1SPUA 5KP3A 1UI8A 2CWTA 3MHEA 1FGRA 1BAOA 3DGLA 1QMAA 2WOFA 1MGWA 2AAEA 3EN1B 1TTOA 1PFPA 3NM2A 3U1WA 1STDA 4O8SA 3HX8A 4RNYA 3AGNA 1B3SA 2OWPA 3DXOA 5EQLA 1DVDA 1FUSA 1O7HB 1UCKA 4NHFA 1LQGC 4XM4A 1QJGA 4HM1B 3WHOA 1RGGA 3SOAA 4FCJA 1YJN3 1FZUA 1VQ53 3HIGA 2GEXA 3EHCA 3JVCA 1Q9EA 1TIJA 1DMQA 4LZIA 1FW7A 1YNVX 1OHSA 3DY5A 4JRFA 5D83A 8RNTA 1DE3A 1Z1SA 1JB4A 3BNBA 3SYUA 4K1VA 1FUTA 5AIIA 1SQWA 4AKYA 2INXA 2RSXA 4O3VA 1B2MA 3NV0B 3CXC2 4RNTA 3X3YA 1DMNA 3LOYA 1KD14 4AEQA 3X41A 1YIT3 5CF1A 3BNEA 1GSPA 5AEWB 3S27A 2F4YA 3OWUA 3CC43 1JKGB 3NM7A 6RNTA 3DH2A 1BSAA 4BL2A 1RGAA 1LNHA 1S723 3BNCA 3WOFB 4KFEA 2BIRA 1FGMA 1O7GB 3F40A 3CNMA 1JB2A 1WMOA 1CEWI 1ULJB 1D6YA 3N54B 4HM8B 3NHXA 4IT7A 2O3OA 1AY7A 2IUKA 1PU4A 2I9WA 2BMQB 3VSYA 1E3RA 2UX0A 1NB5I 4XDWA 1IVXA 2UGIA 2F99A 4ORLA 5STDA 4N6V0 1CYUA 4HM5B 1W2B2 3EBYA 1VQL3 1B20A 5CXOA 1IQYA 4FCMA 1IT7A 1JN5A 1N5PA 2OTL3 2R4IA 2ZHXB 3JUOA 4Q53A 1RKYA 4NPBA 3CCL3 3KIIA 5IEPA 1B2ZA 1JJ22 1A2PA 1Q40A 4G1MB 1YVSA 3FH1A 3CC23 3WA2X 3DGYA 1W01A 1MWTA 4WYKA 3G0KA 4MMXB 2KF4A 1QVF2 1CYVA 1X1XA 5CK6A 4EC6A 3F8HA 1E3VA 3LXUX 1FUWA 2W56B 1KC84 3U97A 5TGNA 1JZOA 1T2HA 2BHMA 1DVCA 1MWSA 1NO3A 3SOYA 2W9PA 1TP6A 1YGEA 2BO9B 2F86B 4MMYB 3MKIA 3ZFZA 1CQSA 1LOVA 4RZMA 5IENA 1W2ZA 5IG4A 3CCQ3 3E99A 2KF3A 3G713 1IK3A 2Z6BA 3J7Yd 3NUVA 2QEX3 1RLSA 2QIYA 4K1UA 2GU3A 3CNXA 3CCU3 3A76A 3DGNA 4LSOA 1VQO3 1YJW3 3BIRA 3NXJA 4WP5A 2STDA 4BTYA 1BSBA 1OHOA 1VQM3 1X1WA 1OH0A 4HVNA 4R4KA 3DGMA 1K9M4 2GU1A 3OXAA 2OQEA 1T3BA 3EN8A 5G1LA 3KKGA 1VQK3 3CD63 2JQ5A 1OHPA 2IY2A 3SXXA 1MGRA 1ULIB 4H3UA 2XH9A 3AHSA 2OTJ3 4LYLB 1U8CB 5IG0A 2P0XA 2XGNA 3RDEA 1I0XA 1M1XB 3KE7A 2L4VA 1RGHA 1GOUA 1R4YA 4J5KA 2B1XB 1EQKA 3H51A 1IU7A 4HZ9B 5CLKA 4CDLA 3PCRA 2W04A 1ZGXA 2HMMB 1RHLA 2FNQA 1LNIA 1LQMB 2P0MA 4LGQA 4X2HA 4N3VA 4MEIA 2XRXB 1W02A 3ZG0A 2UUGC 3I563 2R41A 3CCM3 5FW5A 2KF6A 2JDIH 4KFFA 2W6JH 3Q1CA 4I5QA 1L5GB 3DM8A 3BU4A 8CHOA 2W2CA 3EBTA 1AVKA 1LOWA 1RNTA 1ZX2A 3GZYB 3MPHA 1OACA 2CFLA 2F5WA 3SLUA 2RNTA 4L7KA 1B2UA 3UL6A 4CCVA 5JBSA 5DRVA 5G2GA 2Y74A 1FA3A 2XFTA 1D6ZA 1GY5A 2OOVA 4FCZA 3NBRA 2FXTA 1TFKA 4L8OA 2CIUA 1IT8A 3K7CA 1O7WB 5JPPA 1UDII 4R80A 3D4AA 1I2GA 3LT9A 5AIFA 6STDA 2LYXA 1EA2A 1Q40B 2P09A 2GBWB 3WOEB 1Q7Y4 3NBJA 4N6OB 4NREA 3LT8A 1JBTA 1JN5B 3X42A 4BL3A 1X1YA 1RNBA 4WWUC 1BNSA 3MWZA 1K41A 3JUNA 3PZWA 4J9AA 1UCJA 2XSHB 1NNVA 1MNLA 4R9LA 3KZTA 1I70A 1QAKA 2PNCA 3JUPA 2E2VA 4WYKB 3BLZA 1BRNL 4U13A 2OCTA 3GZRA 1IDPA 1BVIA 1HZ1A 3EJVA 5RNTA 1OGXA 1GS3A 1M904 1RRHA 1N8R4 3HIIA 1FGQA 1OGZA 5AYSC 1I2EA 3JUMA 1MWRA 2CG0A 1ZS7A 2XGLA 5BIRA 2B24B 4EXRA 1BRSA 4EBGA 4BTWA 4FMBA 4L8PA 3VF1A 3G8ZA 3WMDA 2XFSA 1BSEA 1YI23 3RGRA 4JF8A 3WDGB 2P38A 1RCKA 1A2VA 2RGQA 1O7NB 3GZXB 5AEUB 4DKIA 3CCV3 3X40A 1UUGB 1N9EA 1OPYA 4RBNA 3T8UA 1GD4A 1RSNA 3VGNA 3CC73 2ML5A 5LC6A 5M18A 1UCLA 2CHCA 3G16A 1BU4A 3FF2A 1V74A 4XBTA 1SIHA 4FR9A 2BMOB 2BT3A 5BU4A 1B2SA 2CC3A 2KCDA 3H3HA 4HYZA 1NJI4 2IMJA 2WGOA 1BSDA 4GB5A 2H0HA 3CMA3 5AIGA 1RGCA 1QAFA 1F8NA 1BGSA 1RRLA 1GMRA 3OWSA 3RNTA 3WODG 2GSPA 2KAAA 2HMKB 4BU4A 1LXEA 1NU3A 1BRJA 1E97A 1EEJA 1GOVA 1LRAA 3FSDA 3OV4A 1I3FA 4I4KA 2L1SA 3ER7A 2PZVA 1K28A 3SVAA 5AYRB 3B7CA 1RMSA 1JKGA 3N8BA 3B4OA 1VQ93 4IIAA 1VQ43 2HMJB 3ZG5A 1BNEA 1OF5A 5AI1A 1ROAA 4N6NB 3N9HA 3HOHA 3URPA 1HKXA 1V57A 2YFIB 3AGOA 5BXQA 3WA3A 3IJEB 5BVBA 2AADA 1R4CA 1IVUA 2IUJA 1KQS2 1G02A 1GOYA 4FMDA 3NBBA 7RNTA 1BRHA 1I2FA 3EQQB 3D5IA 1G96A 3SEDA 4HM3B 4N6LA 3CME3 1CH0A 3HZPA 4CPKA 1KWIA 1WNHA 2Z77A 2Y73A 4HBRA 1G0TA 1BNJA 2KF5A 2QA43 1UW1A 4IPBA 1LOYA 4KVHA 3V98A 1W4NA 1V58A 3QK9A 3S29A 7GSPA 3WR2A 1RN4A 1IV9A 3F8XA 3KCHA 3EF8A 3KSED 3KSPA 1QVG2 1C54A 4MMZB 3TDGA 3BB9A 3K0ZA 3MG3A 1O7MB 2CK3H 3AMOB 3EC9A 2Z76A 3SX1A 1DMMA 2OQEC 2CX1A 3CPOA 3JUQA 1ZO2A 4KT3B 4KZ1A 4MJDA 3D3LA 1IQXA 3FG3A 1Q824 1BNRA 1PYLA 1FGOA 1N5HA 3I0YA 1BNIA 2C4BA 5IG3A 3Q3FA 1ASKA 1YIJ3 1UGIA 3CU3A 2H0IA 2KRTA 4FMCA 1YJ93 2ZA4A 9RNTA 3Q2PA 2QGUA 3IMAB 1VQQA 1VQN3 2CKFB 2W0QA 5HGRA 3OW22 2M7OA 2YX9A 4XB5A 4FMAA 1I8VA 2D42A 3QRDA 3FF0A 1GD3A 1W6YA 3EX9A 5GSPA 4XDVA 4BTXA 1TU5A 3CPW2 3RGAA 4HM6B 2BNGA 2W9QA 3LYGA 2D1WA 1RGKA 1I0VA 2GXFA 3NV0A 1YGWA 4RNZA 2XF3A 5M19A 3CCE3 3K9MC 2WGQA 3HK4A 1SIIA 3FKAA 4HM0B 3K63A 1O7PB 3K5TA 6GSPA 1SARA 2XR8B 5FGOA 1RN7A 1SJWA 1ROVA 2MC8A 1LVNA 1OF5B 1W5ZA 4WHAA 1S5AA 1OCVA 4HZBB 3LTCA 2RFRA 4J5GA 4HM2B 2WOHA 4TX4A 3UNLA 1RGLA 2FGTA 4HM4B 1EG9B 1OUNA 2GEYA 3IPTA 3ROBA 5LC7A 1K734 1VQ83 1AR0A 2CFDA 4K90B 3T0UA 1BOXA 3UL5A 2SARA 1VQP3 3A5EA 1KSIA 2GBXB 1BUJA 1IVWA 2E2TA 2ZDJA 4H61A 1JV2B 1B27A 7STDA 3NQZA 3NX0A 2CFGA 1A90A 3UJMA 1GMQA 1BNFA 3LH4A 2O9UX 5M1AA 2OOVC 1VZZA 3PXMA 2KXGA 5I97A 5D82A 1K8A4 1JBSA 1GY6A 3AHWA 5A0OB 3M8CA 1BNGA 2F98A 3HI7A 1FYSA 1I3IA 1UCIA 5IF6A 1JRQA 4XBYA 3CCJ3 1A2KA 5KP1A 1GMPA 4BIRA 3GZBA 5IW9A 2CFWA 3MG1A 3FG4A 4K61A 3ALAA 4HM7B 2BMRB 1HU9A 1JZDA 4O02B 1ISKA 3B8LA 4R1KA 4ZM8A 1WQLB 4LMIA 2K3DA 3DGOA 1C7HA 1UI7A 1HYFA 2YFLB 1TRPA 2CH9A 4N6UA 4OVMA 1PY3A 3OX9A 3S67A 1Q7HA 1US1A 1LOXA 2A15A 2CWVA 3UB1A 1D6UA 3X3XA 1GY7A 5CF2A 3GWRA 3B4PA 5IERA 4CJNA 5IEOA 3EB8A 2H0GA 3NQYA 4KFDA 3ECFA 3CCR3 3KN4A 5AIHA 1NB3I 2HMLB 1W7CA 1UGHI 1W6GA 2C10A 4HAAA 5ELJA 5HOHA 4EV5A 2V1LA 2CX0A 3FLJA 3Q90A 1STFI 2WO0A 1RGEA 2RCDA 1JNQA 2CWUA 1BRGA 2P05A 1Q42A 2XEPA 4XBXA 4HKVB 3F7SA 1NWWA 2HMNB 1TRQA 1A67A 2ML6A 1MOLA 1W00A 2W03A 3GSPA 1TJDA 1YVBI 2SBLA 3D79A 3F7XA 2J8XB 3D9RA 1BUQA 3LMLA 1GYBA 2IA7A 1YHQ3 3DMCA 4PEJA 4WFOA 1IQ8A 5G1KA 3MSOA 1AV4A 3EE1A 1RN1A 2XSOB 3LTAA 3LTBA 3BNDA 1N8QA 4GHOA 2CG1A 3MYTA 3O8YA 1RGFA 4GL6A 4LEHA 1BANA 1JB5A 5EVHA 3GAXA 1IYYA 3STDA 4N6MA 1IV7A 4J8TA 1TFOA 1VQ63 1WMPA 3LTDA 2K54A 4GSPA 4X2OA 3G6E3 1T5YA 1FGTA 5EEOA 5JPUA 1B2XA 4N6TA 2F5MA 3V99A 1M9GA 1BIRA 1RCLA 3MG2A 5DREA 1MWUA 1Q864 1JBRA 4OK0A 3PCSA 3OWYA 1NDOB 4ILFA 2W56A 5IG5A 3FGYA 2HMOB 1AVLA 3FZWA 5D81A 3L0RA 1TUHA 3FCSB 1B21A 4QWTA 1EKMA
chains in the Genus database with same CATH topology
1BRIA 2KF4A 6GSPA 1X1XA 1AQZA 1SARA 1RTUA 1RSNA 1T2HA 1X1UA 1BSCA 1UCLA 4J5GA 1BU4A 1RGLA 2HOHA 2F56A 5BU4A 1LOVA 1B2SA 1BSDA 2KF3A 2RBIA 1RDSA 1BOXA 1T2IA 2SARA 1RGCA 1RLSA 3A5EA 1BUJA 1BGSA 4HOHA 1GMRA 1B27A 3RNTA 2GSPA 2KAAA 3BIRA 1BSBA 1GMQA 4BU4A 1BNFA 1BRJA 1GOVA 1LRAA 1X1WA 1I3FA 1DETA 1JBSA 3AHWA 1BNGA 2BU4A 1BRKA 1FYSA 1I3IA 1UCIA 3D5GA 1RMSA 1YGWA 1GMPA 4BIRA 1MGRA 3AHSA 1BNEA 1BAOA 3HOHA 1I0XA 3URPA 1MGWA 2AAEA 1TTOA 3AGOA 1HYFA 2AADA 3AGNA 1RGHA 1TRPA 1B3SA 1GOUA 1G02A 1GOYA 1PY3A 1R4YA 1FUSA 4J5KA 1UCKA 7RNTA 1I2FA 1RGGA 1ZGXA 1RHLA 3WHOA 1LNIA 3D5IA 1FZUA 1CH0A 1Q9EA 1FW7A 1YNVX 8RNTA 1DE3A 2KF6A 1BNJA 2KF5A 4HAAA 5HOHA 1LOYA 3BU4A 3SYUA 1RNTA 1LOWA 1RGEA 1FUTA 2F5WA 2RNTA 1B2UA 1BRGA 7GSPA 3WR2A 1RN4A 3KCHA 1C54A 1B2MA 4RNTA 1TRQA 3GSPA 3D4AA 1GSPA 1I2GA 2F4YA 6RNTA 3DH2A 1BSAA 1BNRA 1RGAA 1JBTA 1PYLA 1X1YA 1RN1A 1BNIA 2BIRA 2C4BA 1BNSA 3Q3FA 1RNBA 4GHOA 1UCJA 1RGFA 1BANA 2ZA4A 9RNTA 1I70A 1IYYA 1BRNL 1BVIA 1AY7A 1HZ1A 5RNTA 1I8VA 4GSPA 1B2XA 2F5MA 1I2EA 1BIRA 1RCLA 5GSPA 1B20A 1JBRA 5BIRA 1BRSA 1B2ZA 1BSEA 1RGKA 1A2PA 1I0VA 1YVSA 1BRHA 1RCKA 1B21A 3DGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRI A;  2KF4 A;  6GSP A;  1X1X A;  1AQZ A;  1SAR A;  1RTU A;  1RSN A;  1T2H A;  1X1U A;  1BSC A;  1UCL A;  4J5G A;  1BU4 A;  1RGL A;  2HOH A;  2F56 A;  5BU4 A;  1LOV A;  1B2S A;  1BSD A;  2KF3 A;  2RBI A;  1RDS A;  1BOX A;  1T2I A;  2SAR A;  1RGC A;  1RLS A;  3A5E A;  1BUJ A;  1BGS A;  4HOH A;  1GMR A;  1B27 A;  3RNT A;  2GSP A;  2KAA A;  3BIR A;  1BSB A;  1GMQ A;  4BU4 A;  1BNF A;  1BRJ A;  1GOV A;  1LRA A;  1X1W A;  1I3F A;  1DET A;  1JBS A;  3AHW A;  1BNG A;  2BU4 A;  1BRK A;  1FYS A;  1I3I A;  1UCI A;  3D5G A;  1RMS A;  1YGW A;  1GMP A;  4BIR A;  1MGR A;  3AHS A;  1BNE A;  1BAO A;  3HOH A;  1I0X A;  3URP A;  1MGW A;  2AAE A;  1TTO A;  3AGO A;  1HYF A;  2AAD A;  3AGN A;  1RGH A;  1TRP A;  1B3S A;  1GOU A;  1G02 A;  1GOY A;  1PY3 A;  1R4Y A;  1FUS A;  4J5K A;  1UCK A;  7RNT A;  1I2F A;  1RGG A;  1ZGX A;  1RHL A;  3WHO A;  1LNI A;  3D5I A;  1FZU A;  1CH0 A;  1Q9E A;  1FW7 A;  1YNV X;  8RNT A;  1DE3 A;  2KF6 A;  1BNJ A;  2KF5 A;  4HAA A;  5HOH A;  1LOY A;  3BU4 A;  3SYU A;  1RNT A;  1LOW A;  1RGE A;  1FUT A;  2F5W A;  2RNT A;  1B2U A;  1BRG A;  7GSP A;  3WR2 A;  1RN4 A;  3KCH A;  1C54 A;  1B2M A;  4RNT A;  1TRQ A;  3GSP A;  3D4A A;  1GSP A;  1I2G A;  2F4Y A;  6RNT A;  3DH2 A;  1BSA A;  1BNR A;  1RGA A;  1JBT A;  1PYL A;  1X1Y A;  1RN1 A;  1BNI A;  2BIR A;  2C4B A;  1BNS A;  3Q3F A;  1RNB A;  4GHO A;  1UCJ A;  1RGF A;  1BAN A;  2ZA4 A;  9RNT A;  1I70 A;  1IYY A;  1BRN L;  1BVI A;  1AY7 A;  1HZ1 A;  5RNT A;  1I8V A;  4GSP A;  1B2X A;  2F5M A;  1I2E A;  1BIR A;  1RCL A;  5GSP A;  1B20 A;  1JBR A;  5BIR A;  1BRS A;  1B2Z A;  1BSE A;  1RGK A;  1A2P A;  1I0V A;  1YVS A;  1BRH A;  1RCK A;  1B21 A;  3DGY A; 
#chains in the Genus database with same CATH topology
 5KP4 A;  1BRI A;  2IYJ A;  3PYJ A;  1U5O A;  1AQZ A;  1UUV B;  1QAL A;  3I55 3;  2Z7A A;  1RTU A;  3PS8 A;  1Q81 4;  1X1U A;  1BSC A;  2MF7 A;  3V92 A;  1EUI C;  1IVV A;  3PGB A;  4HJL B;  2HOH A;  2F56 A;  3S28 A;  2YFJ B;  3KFQ C;  3DUK A;  3FG1 A;  2LQV A;  2RBI A;  3X3Z A;  1M1K 4;  1RDS A;  1Y4K A;  1RJO A;  1T2I A;  2CFK A;  2K0M A;  5ELU A;  3S5C A;  3T8N A;  4HOH A;  4AKZ A;  4EYC A;  3GRD A;  1WMN A;  1J2B A;  4OUQ A;  3DZL A;  1UUW B;  4O2H A;  2E2U A;  3F9S A;  3LZA A;  1DET A;  3F14 A;  4R9K A;  3G4S 3;  3CCS 3;  1N9J A;  1DYU A;  2BU4 A;  1BRK A;  4EV2 A;  4EW5 A;  1VQ7 3;  3D5G A;  1W6C A;  2CW9 A;  2ZL8 A;  4STD A;  2C11 A;  1WTH A;  3AMO A;  2Q07 A;  1SPU A;  5KP3 A;  1UI8 A;  2CWT A;  3MHE A;  1FGR A;  1BAO A;  3DGL A;  1QMA A;  2WOF A;  1MGW A;  2AAE A;  3EN1 B;  1TTO A;  1PFP A;  3NM2 A;  3U1W A;  1STD A;  4O8S A;  3HX8 A;  4RNY A;  3AGN A;  1B3S A;  2OWP A;  3DXO A;  5EQL A;  1DVD A;  1FUS A;  1O7H B;  1UCK A;  4NHF A;  1LQG C;  4XM4 A;  1QJG A;  4HM1 B;  3WHO A;  1RGG A;  3SOA A;  4FCJ A;  1YJN 3;  1FZU A;  1VQ5 3;  3HIG A;  2GEX A;  3EHC A;  3JVC A;  1Q9E A;  1TIJ A;  1DMQ A;  4LZI A;  1FW7 A;  1YNV X;  1OHS A;  3DY5 A;  4JRF A;  5D83 A;  8RNT A;  1DE3 A;  1Z1S A;  1JB4 A;  3BNB A;  3SYU A;  4K1V A;  1FUT A;  5AII A;  1SQW A;  4AKY A;  2INX A;  2RSX A;  4O3V A;  1B2M A;  3NV0 B;  3CXC 2;  4RNT A;  3X3Y A;  1DMN A;  3LOY A;  1KD1 4;  4AEQ A;  3X41 A;  1YIT 3;  5CF1 A;  3BNE A;  1GSP A;  5AEW B;  3S27 A;  2F4Y A;  3OWU A;  3CC4 3;  1JKG B;  3NM7 A;  6RNT A;  3DH2 A;  1BSA A;  4BL2 A;  1RGA A;  1LNH A;  1S72 3;  3BNC A;  3WOF B;  4KFE A;  2BIR A;  1FGM A;  1O7G B;  3F40 A;  3CNM A;  1JB2 A;  1WMO A;  1CEW I;  1ULJ B;  1D6Y A;  3N54 B;  4HM8 B;  3NHX A;  4IT7 A;  2O3O A;  1AY7 A;  2IUK A;  1PU4 A;  2I9W A;  2BMQ B;  3VSY A;  1E3R A;  2UX0 A;  1NB5 I;  4XDW A;  1IVX A;  2UGI A;  2F99 A;  4ORL A;  5STD A;  4N6V 0;  1CYU A;  4HM5 B;  1W2B 2;  3EBY A;  1VQL 3;  1B20 A;  5CXO A;  1IQY A;  4FCM A;  1IT7 A;  1JN5 A;  1N5P A;  2OTL 3;  2R4I A;  2ZHX B;  3JUO A;  4Q53 A;  1RKY A;  4NPB A;  3CCL 3;  3KII A;  5IEP A;  1B2Z A;  1JJ2 2;  1A2P A;  1Q40 A;  4G1M B;  1YVS A;  3FH1 A;  3CC2 3;  3WA2 X;  3DGY A;  1W01 A;  1MWT A;  4WYK A;  3G0K A;  4MMX B;  2KF4 A;  1QVF 2;  1CYV A;  1X1X A;  5CK6 A;  4EC6 A;  3F8H A;  1E3V A;  3LXU X;  1FUW A;  2W56 B;  1KC8 4;  3U97 A;  5TGN A;  1JZO A;  1T2H A;  2BHM A;  1DVC A;  1MWS A;  1NO3 A;  3SOY A;  2W9P A;  1TP6 A;  1YGE A;  2BO9 B;  2F86 B;  4MMY B;  3MKI A;  3ZFZ A;  1CQS A;  1LOV A;  4RZM A;  5IEN A;  1W2Z A;  5IG4 A;  3CCQ 3;  3E99 A;  2KF3 A;  3G71 3;  1IK3 A;  2Z6B A;  3J7Y d;  3NUV A;  2QEX 3;  1RLS A;  2QIY A;  4K1U A;  2GU3 A;  3CNX A;  3CCU 3;  3A76 A;  3DGN A;  4LSO A;  1VQO 3;  1YJW 3;  3BIR A;  3NXJ A;  4WP5 A;  2STD A;  4BTY A;  1BSB A;  1OHO A;  1VQM 3;  1X1W A;  1OH0 A;  4HVN A;  4R4K A;  3DGM A;  1K9M 4;  2GU1 A;  3OXA A;  2OQE A;  1T3B A;  3EN8 A;  5G1L A;  3KKG A;  1VQK 3;  3CD6 3;  2JQ5 A;  1OHP A;  2IY2 A;  3SXX A;  1MGR A;  1ULI B;  4H3U A;  2XH9 A;  3AHS A;  2OTJ 3;  4LYL B;  1U8C B;  5IG0 A;  2P0X A;  2XGN A;  3RDE A;  1I0X A;  1M1X B;  3KE7 A;  2L4V A;  1RGH A;  1GOU A;  1R4Y A;  4J5K A;  2B1X B;  1EQK A;  3H51 A;  1IU7 A;  4HZ9 B;  5CLK A;  4CDL A;  3PCR A;  2W04 A;  1ZGX A;  2HMM B;  1RHL A;  2FNQ A;  1LNI A;  1LQM B;  2P0M A;  4LGQ A;  4X2H A;  4N3V A;  4MEI A;  2XRX B;  1W02 A;  3ZG0 A;  2UUG C;  3I56 3;  2R41 A;  3CCM 3;  5FW5 A;  2KF6 A;  2JDI H;  4KFF A;  2W6J H;  3Q1C A;  4I5Q A;  1L5G B;  3DM8 A;  3BU4 A;  8CHO A;  2W2C A;  3EBT A;  1AVK A;  1LOW A;  1RNT A;  1ZX2 A;  3GZY B;  3MPH A;  1OAC A;  2CFL A;  2F5W A;  3SLU A;  2RNT A;  4L7K A;  1B2U A;  3UL6 A;  4CCV A;  5JBS A;  5DRV A;  5G2G A;  2Y74 A;  1FA3 A;  2XFT A;  1D6Z A;  1GY5 A;  2OOV A;  4FCZ A;  3NBR A;  2FXT A;  1TFK A;  4L8O A;  2CIU A;  1IT8 A;  3K7C A;  1O7W B;  5JPP A;  1UDI I;  4R80 A;  3D4A A;  1I2G A;  3LT9 A;  5AIF A;  6STD A;  2LYX A;  1EA2 A;  1Q40 B;  2P09 A;  2GBW B;  3WOE B;  1Q7Y 4;  3NBJ A;  4N6O B;  4NRE A;  3LT8 A;  1JBT A;  1JN5 B;  3X42 A;  4BL3 A;  1X1Y A;  1RNB A;  4WWU C;  1BNS A;  3MWZ A;  1K41 A;  3JUN A;  3PZW A;  4J9A A;  1UCJ A;  2XSH B;  1NNV A;  1MNL A;  4R9L A;  3KZT A;  1I70 A;  1QAK A;  2PNC A;  3JUP A;  2E2V A;  4WYK B;  3BLZ A;  1BRN L;  4U13 A;  2OCT A;  3GZR A;  1IDP A;  1BVI A;  1HZ1 A;  3EJV A;  5RNT A;  1OGX A;  1GS3 A;  1M90 4;  1RRH A;  1N8R 4;  3HII A;  1FGQ A;  1OGZ A;  5AYS C;  1I2E A;  3JUM A;  1MWR A;  2CG0 A;  1ZS7 A;  2XGL A;  5BIR A;  2B24 B;  4EXR A;  1BRS A;  4EBG A;  4BTW A;  4FMB A;  4L8P A;  3VF1 A;  3G8Z A;  3WMD A;  2XFS A;  1BSE A;  1YI2 3;  3RGR A;  4JF8 A;  3WDG B;  2P38 A;  1RCK A;  1A2V A;  2RGQ A;  1O7N B;  3GZX B;  5AEU B;  4DKI A;  3CCV 3;  3X40 A;  1UUG B;  1N9E A;  1OPY A;  4RBN A;  3T8U A;  1GD4 A;  1RSN A;  3VGN A;  3CC7 3;  2ML5 A;  5LC6 A;  5M18 A;  1UCL A;  2CHC A;  3G16 A;  1BU4 A;  3FF2 A;  1V74 A;  4XBT A;  1SIH A;  4FR9 A;  2BMO B;  2BT3 A;  5BU4 A;  1B2S A;  2CC3 A;  2KCD A;  3H3H A;  4HYZ A;  1NJI 4;  2IMJ A;  2WGO A;  1BSD A;  4GB5 A;  2H0H A;  3CMA 3;  5AIG A;  1RGC A;  1QAF A;  1F8N A;  1BGS A;  1RRL A;  1GMR A;  3OWS A;  3RNT A;  3WOD G;  2GSP A;  2KAA A;  2HMK B;  4BU4 A;  1LXE A;  1NU3 A;  1BRJ A;  1E97 A;  1EEJ A;  1GOV A;  1LRA A;  3FSD A;  3OV4 A;  1I3F A;  4I4K A;  2L1S A;  3ER7 A;  2PZV A;  1K28 A;  3SVA A;  5AYR B;  3B7C A;  1RMS A;  1JKG A;  3N8B A;  3B4O A;  1VQ9 3;  4IIA A;  1VQ4 3;  2HMJ B;  3ZG5 A;  1BNE A;  1OF5 A;  5AI1 A;  1ROA A;  4N6N B;  3N9H A;  3HOH A;  3URP A;  1HKX A;  1V57 A;  2YFI B;  3AGO A;  5BXQ A;  3WA3 A;  3IJE B;  5BVB A;  2AAD A;  1R4C A;  1IVU A;  2IUJ A;  1KQS 2;  1G02 A;  1GOY A;  4FMD A;  3NBB A;  7RNT A;  1BRH A;  1I2F A;  3EQQ B;  3D5I A;  1G96 A;  3SED A;  4HM3 B;  4N6L A;  3CME 3;  1CH0 A;  3HZP A;  4CPK A;  1KWI A;  1WNH A;  2Z77 A;  2Y73 A;  4HBR A;  1G0T A;  1BNJ A;  2KF5 A;  2QA4 3;  1UW1 A;  4IPB A;  1LOY A;  4KVH A;  3V98 A;  1W4N A;  1V58 A;  3QK9 A;  3S29 A;  7GSP A;  3WR2 A;  1RN4 A;  1IV9 A;  3F8X A;  3KCH A;  3EF8 A;  3KSE D;  3KSP A;  1QVG 2;  1C54 A;  4MMZ B;  3TDG A;  3BB9 A;  3K0Z A;  3MG3 A;  1O7M B;  2CK3 H;  3AMO B;  3EC9 A;  2Z76 A;  3SX1 A;  1DMM A;  2OQE C;  2CX1 A;  3CPO A;  3JUQ A;  1ZO2 A;  4KT3 B;  4KZ1 A;  4MJD A;  3D3L A;  1IQX A;  3FG3 A;  1Q82 4;  1BNR A;  1PYL A;  1FGO A;  1N5H A;  3I0Y A;  1BNI A;  2C4B A;  5IG3 A;  3Q3F A;  1ASK A;  1YIJ 3;  1UGI A;  3CU3 A;  2H0I A;  2KRT A;  4FMC A;  1YJ9 3;  2ZA4 A;  9RNT A;  3Q2P A;  2QGU A;  3IMA B;  1VQQ A;  1VQN 3;  2CKF B;  2W0Q A;  5HGR A;  3OW2 2;  2M7O A;  2YX9 A;  4XB5 A;  4FMA A;  1I8V A;  2D42 A;  3QRD A;  3FF0 A;  1GD3 A;  1W6Y A;  3EX9 A;  5GSP A;  4XDV A;  4BTX A;  1TU5 A;  3CPW 2;  3RGA A;  4HM6 B;  2BNG A;  2W9Q A;  3LYG A;  2D1W A;  1RGK A;  1I0V A;  2GXF A;  3NV0 A;  1YGW A;  4RNZ A;  2XF3 A;  5M19 A;  3CCE 3;  3K9M C;  2WGQ A;  3HK4 A;  1SII A;  3FKA A;  4HM0 B;  3K63 A;  1O7P B;  3K5T A;  6GSP A;  1SAR A;  2XR8 B;  5FGO A;  1RN7 A;  1SJW A;  1ROV A;  2MC8 A;  1LVN A;  1OF5 B;  1W5Z A;  4WHA A;  1S5A A;  1OCV A;  4HZB B;  3LTC A;  2RFR A;  4J5G A;  4HM2 B;  2WOH A;  4TX4 A;  3UNL A;  1RGL A;  2FGT A;  4HM4 B;  1EG9 B;  1OUN A;  2GEY A;  3IPT A;  3ROB A;  5LC7 A;  1K73 4;  1VQ8 3;  1AR0 A;  2CFD A;  4K90 B;  3T0U A;  1BOX A;  3UL5 A;  2SAR A;  1VQP 3;  3A5E A;  1KSI A;  2GBX B;  1BUJ A;  1IVW A;  2E2T A;  2ZDJ A;  4H61 A;  1JV2 B;  1B27 A;  7STD A;  3NQZ A;  3NX0 A;  2CFG A;  1A90 A;  3UJM A;  1GMQ A;  1BNF A;  3LH4 A;  2O9U X;  5M1A A;  2OOV C;  1VZZ A;  3PXM A;  2KXG A;  5I97 A;  5D82 A;  1K8A 4;  1JBS A;  1GY6 A;  3AHW A;  5A0O B;  3M8C A;  1BNG A;  2F98 A;  3HI7 A;  1FYS A;  1I3I A;  1UCI A;  5IF6 A;  1JRQ A;  4XBY A;  3CCJ 3;  1A2K A;  5KP1 A;  1GMP A;  4BIR A;  3GZB A;  5IW9 A;  2CFW A;  3MG1 A;  3FG4 A;  4K61 A;  3ALA A;  4HM7 B;  2BMR B;  1HU9 A;  1JZD A;  4O02 B;  1ISK A;  3B8L A;  4R1K A;  4ZM8 A;  1WQL B;  4LMI A;  2K3D A;  3DGO A;  1C7H A;  1UI7 A;  1HYF A;  2YFL B;  1TRP A;  2CH9 A;  4N6U A;  4OVM A;  1PY3 A;  3OX9 A;  3S67 A;  1Q7H A;  1US1 A;  1LOX A;  2A15 A;  2CWV A;  3UB1 A;  1D6U A;  3X3X A;  1GY7 A;  5CF2 A;  3GWR A;  3B4P A;  5IER A;  4CJN A;  5IEO A;  3EB8 A;  2H0G A;  3NQY A;  4KFD A;  3ECF A;  3CCR 3;  3KN4 A;  5AIH A;  1NB3 I;  2HML B;  1W7C A;  1UGH I;  1W6G A;  2C10 A;  4HAA A;  5ELJ A;  5HOH A;  4EV5 A;  2V1L A;  2CX0 A;  3FLJ A;  3Q90 A;  1STF I;  2WO0 A;  1RGE A;  2RCD A;  1JNQ A;  2CWU A;  1BRG A;  2P05 A;  1Q42 A;  2XEP A;  4XBX A;  4HKV B;  3F7S A;  1NWW A;  2HMN B;  1TRQ A;  1A67 A;  2ML6 A;  1MOL A;  1W00 A;  2W03 A;  3GSP A;  1TJD A;  1YVB I;  2SBL A;  3D79 A;  3F7X A;  2J8X B;  3D9R A;  1BUQ A;  3LML A;  1GYB A;  2IA7 A;  1YHQ 3;  3DMC A;  4PEJ A;  4WFO A;  1IQ8 A;  5G1K A;  3MSO A;  1AV4 A;  3EE1 A;  1RN1 A;  2XSO B;  3LTA A;  3LTB A;  3BND A;  1N8Q A;  4GHO A;  2CG1 A;  3MYT A;  3O8Y A;  1RGF A;  4GL6 A;  4LEH A;  1BAN A;  1JB5 A;  5EVH A;  3GAX A;  1IYY A;  3STD A;  4N6M A;  1IV7 A;  4J8T A;  1TFO A;  1VQ6 3;  1WMP A;  3LTD A;  2K54 A;  4GSP A;  4X2O A;  3G6E 3;  1T5Y A;  1FGT A;  5EEO A;  5JPU A;  1B2X A;  4N6T A;  2F5M A;  3V99 A;  1M9G A;  1BIR A;  1RCL A;  3MG2 A;  5DRE A;  1MWU A;  1Q86 4;  1JBR A;  4OK0 A;  3PCS A;  3OWY A;  1NDO B;  4ILF A;  2W56 A;  5IG5 A;  3FGY A;  2HMO B;  1AVL A;  3FZW A;  5D81 A;  3L0R A;  1TUH A;  3FCS B;  1B21 A;  4QWT A;  1EKM A; 
#chains in the Genus database with same CATH homology
 1BRI A;  2KF4 A;  6GSP A;  1X1X A;  1AQZ A;  1SAR A;  1RTU A;  1RSN A;  1T2H A;  1X1U A;  1BSC A;  1UCL A;  4J5G A;  1BU4 A;  1RGL A;  2HOH A;  2F56 A;  5BU4 A;  1LOV A;  1B2S A;  1BSD A;  2KF3 A;  2RBI A;  1RDS A;  1BOX A;  1T2I A;  2SAR A;  1RGC A;  1RLS A;  3A5E A;  1BUJ A;  1BGS A;  4HOH A;  1GMR A;  1B27 A;  3RNT A;  2GSP A;  2KAA A;  3BIR A;  1BSB A;  1GMQ A;  4BU4 A;  1BNF A;  1BRJ A;  1GOV A;  1LRA A;  1X1W A;  1I3F A;  1DET A;  1JBS A;  3AHW A;  1BNG A;  2BU4 A;  1BRK A;  1FYS A;  1I3I A;  1UCI A;  3D5G A;  1RMS A;  1YGW A;  1GMP A;  4BIR A;  1MGR A;  3AHS A;  1BNE A;  1BAO A;  3HOH A;  1I0X A;  3URP A;  1MGW A;  2AAE A;  1TTO A;  3AGO A;  1HYF A;  2AAD A;  3AGN A;  1RGH A;  1TRP A;  1B3S A;  1GOU A;  1G02 A;  1GOY A;  1PY3 A;  1R4Y A;  1FUS A;  4J5K A;  1UCK A;  7RNT A;  1I2F A;  1RGG A;  1ZGX A;  1RHL A;  3WHO A;  1LNI A;  3D5I A;  1FZU A;  1CH0 A;  1Q9E A;  1FW7 A;  1YNV X;  8RNT A;  1DE3 A;  2KF6 A;  1BNJ A;  2KF5 A;  4HAA A;  5HOH A;  1LOY A;  3BU4 A;  3SYU A;  1RNT A;  1LOW A;  1RGE A;  1FUT A;  2F5W A;  2RNT A;  1B2U A;  1BRG A;  7GSP A;  3WR2 A;  1RN4 A;  3KCH A;  1C54 A;  1B2M A;  4RNT A;  1TRQ A;  3GSP A;  3D4A A;  1GSP A;  1I2G A;  2F4Y A;  6RNT A;  3DH2 A;  1BSA A;  1BNR A;  1RGA A;  1JBT A;  1PYL A;  1X1Y A;  1RN1 A;  1BNI A;  2BIR A;  2C4B A;  1BNS A;  3Q3F A;  1RNB A;  4GHO A;  1UCJ A;  1RGF A;  1BAN A;  2ZA4 A;  9RNT A;  1I70 A;  1IYY A;  1BRN L;  1BVI A;  1AY7 A;  1HZ1 A;  5RNT A;  1I8V A;  4GSP A;  1B2X A;  2F5M A;  1I2E A;  1BIR A;  1RCL A;  5GSP A;  1B20 A;  1JBR A;  5BIR A;  1BRS A;  1B2Z A;  1BSE A;  1RGK A;  1A2P A;  1I0V A;  1YVS A;  1BRH A;  1RCK A;  1B21 A;  3DGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...