2KAAA

Solution structure of hirsutellin a from hirsutella thompsonii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
130
structure length
130
Chain Sequence
b'APIVTCRPKLDGREKPFKVDVATAQAQARKAGLTTGKSGDPHRYFAGDHIRWGVNNCDKADAILWEYPIYWVGKNAEWAKDVKTSQQKGGPTPIRVVYANSRGAVQYCGVMTHSKVDKNNQGKEFFEKCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hirsutellin A
publication title Solution structure of hirsutellin A--new insights into the active site and interacting interfaces of ribotoxins.
pubmed rcsb
molecule tags Toxin
total genus 15
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kaaA00
1HZ1A 3SYUA 1GOUA 1BIRA 4HAAA 1UCLA 2HOHA 1YVSA 1LNIA 1ZGXA 3AGOA 1BSAA 1GMQA 1RN1A 2SARA 1X1XA 1GMRA 1B20A 1FZUA 1LRAA 1RSNA 1X1UA 1B2XA 1LOVA 1RGEA 1C54A 1T2IA 3A5EA 1TTOA 1I2FA 4HOHA 1A2PA 1B2UA 1I0VA 1G02A 1BSEA 1RHLA 1TRQA 3DH2A 2KF3A 2KF4A 1FUSA 1I3IA 7RNTA 3AHSA 1AY7A 3WR2A 1Q9EA 1RGGA 1IYYA 1BRIA 1B2MA 2F5MA 1I3FA 9RNTA 2AADA 1B2ZA 3WHOA 1BUJA 1BGSA 4J5KA 1BRGA 1BSBA 1R4YA 3D4AA 1I2EA 1LOWA 2AAEA 1BSDA 1RMSA 1RGHA 4RNTA 1BAOA 1RN4A 1RTUA 1JBRA 2F5WA 1BNIA 2BIRA 4GSPA 5BU4A 1MGRA 3GSPA 3KCHA 1MGWA 1RGCA 1BNEA 2RNTA 1HYFA 1B21A 5GSPA 1AQZA 1YGWA 2RBIA 3AGNA 1CH0A 4BU4A 1B2SA 3DGYA 1BSCA 1I70A 1BRKA 1X1WA 1BRSA 2F4YA 1LOYA 3D5IA 2BU4A 1BNFA 1DE3A 3HOHA 5BIRA 1T2HA 1BOXA 1PYLA 1RNBA 3AHWA 1I8VA 1BRHA 1RDSA 1RNTA 5RNTA 1BRJA 8RNTA 1RCLA 1B3SA 1GOVA 1RGFA 1GOYA 4GHOA 1DETA 1I2GA 2F56A 6GSPA 1BNRA 2KF5A 1GSPA 2KAAA 1UCJA 1FUTA 2GSPA 1SARA 3URPA 1UCIA 6RNTA 2C4BA 1RCKA 1B27A 1RLSA 1BNGA 4BIRA 1FYSA 1TRPA 1RGAA 2KF6A 3D5GA 7GSPA 5HOHA 1FW7A 2ZA4A 1BU4A 1BRNL 1BANA 1I0XA 1RGKA 3BU4A 1GMPA 1X1YA 1BNSA 3RNTA 1BNJA 1BVIA 3BIRA 1JBTA 1UCKA 1JBSA 1RGLA 3Q3FA 1YNVX 1PY3A 4J5GA
chains in the Genus database with same CATH superfamily
1IT7A 1R4CA 3HIGA 3SX1A 2OQEA 1J2BA 3KIIA 1A2VA 3JVCA 1UCLA 1YVSA 3OXAA 1YHQ3 3EX9A 1LXEA 3K63A 3G713 3SOAA 1ZX2A 2Z7AA 1NB3I 1UUWB 3NQYA 3PS8A 1W5ZA 1RN1A 1E3RA 1ULIB 2JQ5A 3BNEA 1B2XA 1LOVA 1QJGA 1RJOA 1N9JA 1KC84 1FGRA 1K28A 1T2IA 3PCRA 2BNGA 1IT8A 1O7MB 1QMAA 2MC8A 4HZ9B 1RHLA 4PEJA 3DH2A 1F8NA 3KSPA 5IEOA 4CDLA 1T3BA 5IG3A 1ISKA 2QGUA 3AHSA 1A2KA 1JV2B 1YJ93 1LOXA 4ZM8A 1Q864 1Q9EA 4EV5A 1IYYA 1BRIA 1W01A 5EQLA 2D42A 5IF6A 2XEPA 3CC73 5D82A 1OF5A 2E2VA 3B7CA 3SEDA 5CXOA 4R80A 3LYGA 2L1SA 3NBJA 1W2ZA 4XBYA 5BVBA 4X2OA 1B2ZA 1GD3A 4HZBB 3I553 1W6CA 1NU3A 1BUQA 1Q7HA 1BSBA 1S723 1I2EA 2IUKA 1YJW3 2C11A 4GB5A 3UB1A 3G0KA 1RN4A 3G8ZA 1RTUA 3FGYA 4LEHA 4RNTA 4BL2A 1YJN3 3CCJ3 1QAFA 2ML5A 3CNXA 4NHFA 3F14A 5KP3A 4N6OB 4FCMA 1RGCA 2W2CA 3GZBA 2RNTA 3M8CA 2R4IA 5ELJA 3GZYB 3V98A 3S28A 5AIIA 1VQ83 4G1MB 2RBIA 3EF8A 2B24B 3CCL3 1B2SA 1IQYA 1YI23 3V92A 1NNVA 5JPUA 1DMMA 3PCSA 1O7GB 3VSYA 3OW22 1PFPA 4L8OA 3EBTA 2BMOB 3F8HA 1Q824 1BOXA 1JNQA 4OK0A 1RNBA 2OTJ3 1LNHA 2J8XB 1SPUA 1BRHA 3DUKA 2GXFA 2YFJB 3LH4A 3LT9A 3PXMA 5FW5A 1RNTA 2HMMB 3BB9A 2WOFA 1RCLA 1RGFA 1Q40A 1RKYA 1AVLA 1G96A 2BHMA 3FCSB 2F56A 1V57A 2D1WA 4HBRA 1K9M4 2GU3A 3FZWA 3K7CA 3X3XA 2W56A 4LYLB 4Q53A 3K0ZA 4R9KA 4N3VA 4HM5B 2Z76A 4LGQA 2SBLA 2WO0A 2RFRA 3LT8A 5IERA 2K0MA 5LC7A 4WYKB 1KWIA 1UCIA 3WOFB 1RCKA 2CHCA 1RLSA 1BNGA 4BIRA 4N6NB 1DVDA 1TRPA 3HK4A 3CME3 1YGEA 3SLUA 4N6MA 5HOHA 5I97A 1EQKA 2XSHB 1S5AA 1VQ43 1FW7A 1AVKA 2GEXA 4ILFA 1WMPA 3OV4A 2W6JH 1AV4A 2CK3H 2CFDA 4EW5A 4MMZB 3JUPA 3AMOB 4HYZA 5AIFA 1M1K4 1DVCA 1BNSA 1ROAA 3FKAA 1JBSA 1OHPA 2OTL3 5AIGA 1PY3A 3FF2A 4EXRA 3CC23 2BMQB 3EB8A 3BNDA 1VQP3 1BIRA 2CFKA 2HOHA 4FCJA 1LNIA 3CCU3 1FGOA 4AEQA 3L0RA 3MG1A 1NO3A 1T5YA 3V99A 2O9UX 1MWRA 2RCDA 4HM6B 1NWWA 2SARA 1GY5A 1FZUA 3NX0A 3OX9A 3G6E3 1X1UA 1FUWA 4JF8A 4L8PA 4FMAA 4LSOA 3A5EA 5AI1A 1C54A 2IUJA 1TTOA 1VQM3 3NBBA 2E2TA 1V74A 3CU3A 1G02A 2OQEC 6STDA 2KF4A 3EN8A 2QEX3 7RNTA 3NUVA 1AY7A 1RGGA 3MSOA 2XFTA 2F5MA 1NB5I 1I3FA 1OGZA 4RBNA 1M9GA 1N8QA 4ORLA 5G1KA 4H61A 3K9MC 5M19A 1ZS7A 2GBXB 1BUJA 1L5GB 4KFFA 2LYXA 1IU7A 4J5KA 2CWTA 3NM2A 3MG2A 3CMA3 1E3VA 1LOWA 4BTXA 1K8A4 5FGOA 1BSDA 1RGHA 1TFKA 1BAOA 1VZZA 4HM7B 1IV7A 2H0IA 1TJDA 3ZG5A 1DYUA 2CKFB 4GSPA 5BU4A 1MGRA 3GSPA 3PYJA 3A76A 4XBTA 3PGBA 2HMKB 4HVNA 2ZHXB 4XDVA 1IVWA 3IMAB 4K90B 3DMCA 4O8SA 5GSPA 1TU5A 1AQZA 3I563 3LTBA 5IEPA 1CH0A 1OHSA 3DGYA 3F40A 4LMIA 1WQLB 1OGXA 4I4KA 3EJVA 5STDA 3CCS3 1G0TA 1UGIA 1BRKA 2K3DA 3B4PA 2F4YA 3ZFZA 1O7NB 3D5IA 4KFEA 4HM0B 1BNFA 3B4OA 1CEWI 3B8LA 1IVVA 3HIIA 3IPTA 3LMLA 1DMNA 1JN5B 1VQQA 5EVHA 1TIJA 2JDIH 2L4VA 1VQK3 1UUGB 1US1A 1BRJA 1JKGB 5IG5A 3F8XA 1GOYA 5KP4A 1DETA 3T8NA 5M1AA 2XF3A 3EN1B 3LZAA 2I9WA 1BNRA 3WOEB 1UUVB 1GSPA 2MF7A 3CCR3 1UCJA 4XBXA 3N8BA 1W6YA 3EC9A 1YIT3 3G16A 1VQL3 3O8YA 1SARA 4FMDA 1EA2A 4DKIA 3MKIA 4WWUC 4X2HA 8CHOA 5ELUA 1Z1SA 4RNZA 1B27A 4BTWA 1RGAA 2OCTA 4N6LA 4WP5A 5DRVA 3SOYA 3D5GA 1JB2A 1WMNA 2ZA4A 5HGRA 1BU4A 1Q42A 5CF1A 5D81A 3FG4A 1VQ73 1A67A 2H0HA 3MYTA 1I0XA 3F7SA 4HM8B 1GMPA 3G4S3 1LQGC 2YX9A 1IVXA 1IDPA 3BIRA 3KKGA 1JBTA 4FMBA 1JJ22 1A90A 3NBRA 1OPYA 3TDGA 3NM7A 1LVNA 4HJLB 4WYKA 5CK6A 1Y4KA 2IA7A 3EHCA 1W6GA 3SYUA 4AKYA 4CPKA 1GOUA 1IQXA 3BLZA 3GAXA 4HAAA 2C10A 4XM4A 3MHEA 4HM2B 3LOYA 1JZDA 5AIHA 4HM1B 3AGOA 2UX0A 3S29A 1N8R4 3JUQA 2F86B 3X3ZA 1PU4A 2E2UA 3HX8A 1V58A 1GMQA 1ULJB 4MEIA 5AEUB 3Q1CA 1HU9A 3NV0B 1RSNA 1B20A 3AMOA 3CCM3 1ROVA 4MMYB 3U1WA 3CCQ3 4NREA 2STDA 3QK9A 4HOHA 2OWPA 1B2UA 1I0VA 1BSEA 3BNCA 2KF3A 3EE1A 4AKZA 1FUSA 1I3IA 1AR0A 3SXXA 3WR2A 1RRLA 2IY2A 3PZWA 1JZOA 1C7HA 3CC43 3LTDA 1UGHI 3DGNA 3WA2X 2RGQA 2PNCA 1N5HA 1YVBI 1STDA 4K1VA 2BO9B 3N9HA 3JUNA 2KXGA 2AADA 2F99A 4MMXB 3WHOA 1QVF2 4KZ1A 3FH1A 1R4YA 4NPBA 1E97A 2AAEA 2CFWA 2CWUA 3KE7A 1EG9B 4O02B 4XB5A 2OOVC 1EKMA 2UGIA 1JBRA 3S67A 1NJI4 2F5WA 1BNIA 2W9PA 2BIRA 3SVAA 5AYSC 3STDA 1SJWA 1K734 3KSED 1TP6A 1N9EA 2CFLA 3FG1A 4H3UA 4R1KA 3FLJA 2UUGC 5JBSA 1W2B2 1B21A 3VF1A 3AGNA 1CYVA 1OH0A 3ALAA 2CX0A 2CX1A 4HM4B 1SIHA 3KFQC 2IMJA 3GRDA 1X1WA 4JRFA 3X41A 1LOYA 1EEJA 2YFLB 3NXJA 3CCV3 1LQMB 1DE3A 3HOHA 2CC3A 4MJDA 4XDWA 5BIRA 1KD14 2XR8B 3D9RA 2XRXB 1RDSA 1FGQA 3N54B 4N6V0 3RDEA 3DGLA 1WTHA 4IIAA 5AEWB 1RN7A 3GZXB 3H3HA 2XH9A 5LC6A 2GBWB 8RNTA 1B3SA 1GOVA 2W04A 5DREA 3ROBA 1TUHA 3UL5A 2HMLB 4R4KA 1MOLA 3VGNA 3CD63 2ML6A 1QAKA 3I0YA 1Q7Y4 1SQWA 1FUTA 3FG3A 1YIJ3 2GSPA 1GYBA 3CPW2 5BXQA 1FA3A 1OACA 2FGTA 2O3OA 3EQQB 3QRDA 3D79A 3URPA 1JN5A 1JRQA 2C4BA 2F98A 4CJNA 6RNTA 3J7Yd 3DXOA 1VQ93 5AYRB 1FYSA 4RZMA 5CF2A 2XSOB 2P09A 2KF6A 1JKGA 7GSPA 3NQZA 2M7OA 2HMOB 1BRNL 1WMOA 1BANA 1IV9A 3BU4A 2GU1A 4FR9A 1UI7A 1CQSA 4OVMA 1X1YA 3RNTA 3S27A 1BVIA 4OUQA 3E99A 2W03A 5IW9A 1U5OA 1UCKA 1DMQA 3X40A 1RGLA 3Q3FA 1YNVX 2K54A 9RNTA 4IT7A 1HZ1A 3DGMA 4WFOA 1OHOA 4EV2A 4EC6A 1WNHA 3U97A 5IENA 3CXC2 5EEOA 1ZGXA 2WGOA 4CCVA 2QIYA 5IG4A 3KN4A 1OF5B 1ASKA 3CNMA 4O2HA 4EYCA 5A0OB 1VQ53 4LZIA 1BSAA 3OWSA 3WMDA 3H51A 2XGLA 1IVUA 1X1XA 1D6ZA 2CG1A 1GMRA 4EBGA 1LRAA 2BT3A 2KCDA 4KFDA 1RGEA 2KRTA 3D3LA 1UDII 3MWZA 3GWRA 1N5PA 2WOHA 2V1LA 1STFI 3UL6A 1I2FA 1MWTA 3JUMA 1A2PA 1TRQA 2P0XA 1IK3A 3JUOA 4K1UA 1Q814 4N6TA 3X3YA 1W7CA 2Q07A 3CCE3 3LTAA 1CYUA 1MWSA 1B2MA 4KVHA 3IJEB 1EUIC 5TGNA 4L7KA 4J9AA 1VQO3 4U13A 1ZO2A 1O7PB 4STDA 1FGMA 3GZRA 3BNBA 3NV0A 1JB4A 2A15A 1IQ8A 3OWYA 4WHAA 3Q2PA 1BGSA 1BRGA 1UI8A 3OWUA 5G1LA 3RGAA 1MNLA 1JB5A 3D4AA 3HZPA 1RMSA 3NHXA 2Y74A 3K5TA 3MG3A 3MPHA 3LXUX 1D6UA 2HMNB 3KCHA 1MGWA 2FNQA 5G2GA 2CIUA 4TX4A 1KQS2 1BNEA 1TFOA 3WA3A 1HYFA 1Q40B 1W4NA 3T8UA 1OUNA 1YGWA 4BU4A 2CH9A 1BSCA 3X42A 5JPPA 2W56B 2Y73A 4IPBA 1I70A 1BRSA 3F9SA 2CG0A 1W00A 2BU4A 3UJMA 3WODG 1QALA 2Z6BA 4RNYA 3KZTA 2LQVA 3DGOA 4R9LA 2CFGA 1T2HA 1PYLA 2XFSA 1QVG2 3Q90A 3ZG0A 3AHWA 4FCZA 1I8VA 5CLKA 3HI7A 5KP1A 2INXA 4QWTA 2YFIB 1GY7A 3FF0A 2P38A 4BL3A 5RNTA 1VQN3 1GS3A 2P0MA 2GEYA 3DY5A 5M18A 4O3VA 1HKXA 4GHOA 2IYJA 4BTYA 1I2GA 1UW1A 2CW9A 2RSXA 3S5CA 7STDA 1M904 1SIIA 6GSPA 4HKVB 2BMRB 4KT3B 1D6YA 1NDOB 2KF5A 2KAAA 3T0UA 1GY6A 2W0QA 1K41A 3DZLA 3F7XA 5IG0A 2CWVA 3EBYA 4K61A 3RGRA 3ECFA 2ZL8A 1M1XB 3UNLA 1O7WB 2P05A 4N6UA 5D83A 3WDGB 4FMCA 1RRHA 2W9QA 2PZVA 3ER7A 1VQ63 2FXTA 2WGQA 3CPOA 3DM8A 2B1XB 2H0GA 2R41A 2HMJB 2XGNA 4HM3B 1KSIA 4J8TA 1MWUA 1RGKA 4I5QA 1BNJA 2Z77A 1GD4A 2ZDJA 4GL6A 2OOVA 1U8CB 1FGTA 1W02A 2QA43 3FSDA 1O7HB 1OCVA 4J5GA 3LTCA
chains in the Genus database with same CATH topology
1HZ1A 3SYUA 1GOUA 1BIRA 4HAAA 1UCLA 2HOHA 1YVSA 1LNIA 1ZGXA 3AGOA 1BSAA 1GMQA 1RN1A 2SARA 1X1XA 1GMRA 1B20A 1FZUA 1LRAA 1RSNA 1X1UA 1B2XA 1LOVA 1RGEA 1C54A 1T2IA 3A5EA 1TTOA 1I2FA 4HOHA 1A2PA 1B2UA 1I0VA 1G02A 1BSEA 1RHLA 1TRQA 3DH2A 2KF3A 2KF4A 1FUSA 1I3IA 7RNTA 3AHSA 1AY7A 3WR2A 1Q9EA 1RGGA 1IYYA 1BRIA 1B2MA 2F5MA 1I3FA 9RNTA 2AADA 1B2ZA 3WHOA 1BUJA 1BGSA 4J5KA 1BRGA 1BSBA 1R4YA 3D4AA 1I2EA 1LOWA 2AAEA 1BSDA 1RMSA 1RGHA 4RNTA 1BAOA 1RN4A 1RTUA 1JBRA 2F5WA 1BNIA 2BIRA 4GSPA 5BU4A 1MGRA 3GSPA 3KCHA 1MGWA 1RGCA 1BNEA 2RNTA 1HYFA 1B21A 5GSPA 1AQZA 1YGWA 2RBIA 3AGNA 1CH0A 4BU4A 1B2SA 3DGYA 1BSCA 1I70A 1BRKA 1X1WA 1BRSA 2F4YA 1LOYA 3D5IA 2BU4A 1BNFA 1DE3A 3HOHA 5BIRA 1T2HA 1BOXA 1PYLA 1RNBA 3AHWA 1I8VA 1BRHA 1RDSA 1RNTA 5RNTA 1BRJA 8RNTA 1RCLA 1B3SA 1GOVA 1RGFA 1GOYA 4GHOA 1DETA 1I2GA 2F56A 6GSPA 1BNRA 2KF5A 1GSPA 2KAAA 1UCJA 1FUTA 2GSPA 1SARA 3URPA 1UCIA 6RNTA 2C4BA 1RCKA 1B27A 1RLSA 1BNGA 4BIRA 1FYSA 1TRPA 1RGAA 2KF6A 3D5GA 7GSPA 5HOHA 1FW7A 2ZA4A 1BU4A 1BRNL 1BANA 1I0XA 1RGKA 3BU4A 1GMPA 1X1YA 1BNSA 3RNTA 1BNJA 1BVIA 3BIRA 1JBTA 1UCKA 1JBSA 1RGLA 3Q3FA 1YNVX 1PY3A 4J5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZ1 A;  3SYU A;  1GOU A;  1BIR A;  4HAA A;  1UCL A;  2HOH A;  1YVS A;  1LNI A;  1ZGX A;  3AGO A;  1BSA A;  1GMQ A;  1RN1 A;  2SAR A;  1X1X A;  1GMR A;  1B20 A;  1FZU A;  1LRA A;  1RSN A;  1X1U A;  1B2X A;  1LOV A;  1RGE A;  1C54 A;  1T2I A;  3A5E A;  1TTO A;  1I2F A;  4HOH A;  1A2P A;  1B2U A;  1I0V A;  1G02 A;  1BSE A;  1RHL A;  1TRQ A;  3DH2 A;  2KF3 A;  2KF4 A;  1FUS A;  1I3I A;  7RNT A;  3AHS A;  1AY7 A;  3WR2 A;  1Q9E A;  1RGG A;  1IYY A;  1BRI A;  1B2M A;  2F5M A;  1I3F A;  9RNT A;  2AAD A;  1B2Z A;  3WHO A;  1BUJ A;  1BGS A;  4J5K A;  1BRG A;  1BSB A;  1R4Y A;  3D4A A;  1I2E A;  1LOW A;  2AAE A;  1BSD A;  1RMS A;  1RGH A;  4RNT A;  1BAO A;  1RN4 A;  1RTU A;  1JBR A;  2F5W A;  1BNI A;  2BIR A;  4GSP A;  5BU4 A;  1MGR A;  3GSP A;  3KCH A;  1MGW A;  1RGC A;  1BNE A;  2RNT A;  1HYF A;  1B21 A;  5GSP A;  1AQZ A;  1YGW A;  2RBI A;  3AGN A;  1CH0 A;  4BU4 A;  1B2S A;  3DGY A;  1BSC A;  1I70 A;  1BRK A;  1X1W A;  1BRS A;  2F4Y A;  1LOY A;  3D5I A;  2BU4 A;  1BNF A;  1DE3 A;  3HOH A;  5BIR A;  1T2H A;  1BOX A;  1PYL A;  1RNB A;  3AHW A;  1I8V A;  1BRH A;  1RDS A;  1RNT A;  5RNT A;  1BRJ A;  8RNT A;  1RCL A;  1B3S A;  1GOV A;  1RGF A;  1GOY A;  4GHO A;  1DET A;  1I2G A;  2F56 A;  6GSP A;  1BNR A;  2KF5 A;  1GSP A;  2KAA A;  1UCJ A;  1FUT A;  2GSP A;  1SAR A;  3URP A;  1UCI A;  6RNT A;  2C4B A;  1RCK A;  1B27 A;  1RLS A;  1BNG A;  4BIR A;  1FYS A;  1TRP A;  1RGA A;  2KF6 A;  3D5G A;  7GSP A;  5HOH A;  1FW7 A;  2ZA4 A;  1BU4 A;  1BRN L;  1BAN A;  1I0X A;  1RGK A;  3BU4 A;  1GMP A;  1X1Y A;  1BNS A;  3RNT A;  1BNJ A;  1BVI A;  3BIR A;  1JBT A;  1UCK A;  1JBS A;  1RGL A;  3Q3F A;  1YNV X;  1PY3 A;  4J5G A; 
#chains in the Genus database with same CATH topology
 1IT7 A;  1R4C A;  3HIG A;  3SX1 A;  2OQE A;  1J2B A;  3KII A;  1A2V A;  3JVC A;  1UCL A;  1YVS A;  3OXA A;  1YHQ 3;  3EX9 A;  1LXE A;  3K63 A;  3G71 3;  3SOA A;  1ZX2 A;  2Z7A A;  1NB3 I;  1UUW B;  3NQY A;  3PS8 A;  1W5Z A;  1RN1 A;  1E3R A;  1ULI B;  2JQ5 A;  3BNE A;  1B2X A;  1LOV A;  1QJG A;  1RJO A;  1N9J A;  1KC8 4;  1FGR A;  1K28 A;  1T2I A;  3PCR A;  2BNG A;  1IT8 A;  1O7M B;  1QMA A;  2MC8 A;  4HZ9 B;  1RHL A;  4PEJ A;  3DH2 A;  1F8N A;  3KSP A;  5IEO A;  4CDL A;  1T3B A;  5IG3 A;  1ISK A;  2QGU A;  3AHS A;  1A2K A;  1JV2 B;  1YJ9 3;  1LOX A;  4ZM8 A;  1Q86 4;  1Q9E A;  4EV5 A;  1IYY A;  1BRI A;  1W01 A;  5EQL A;  2D42 A;  5IF6 A;  2XEP A;  3CC7 3;  5D82 A;  1OF5 A;  2E2V A;  3B7C A;  3SED A;  5CXO A;  4R80 A;  3LYG A;  2L1S A;  3NBJ A;  1W2Z A;  4XBY A;  5BVB A;  4X2O A;  1B2Z A;  1GD3 A;  4HZB B;  3I55 3;  1W6C A;  1NU3 A;  1BUQ A;  1Q7H A;  1BSB A;  1S72 3;  1I2E A;  2IUK A;  1YJW 3;  2C11 A;  4GB5 A;  3UB1 A;  3G0K A;  1RN4 A;  3G8Z A;  1RTU A;  3FGY A;  4LEH A;  4RNT A;  4BL2 A;  1YJN 3;  3CCJ 3;  1QAF A;  2ML5 A;  3CNX A;  4NHF A;  3F14 A;  5KP3 A;  4N6O B;  4FCM A;  1RGC A;  2W2C A;  3GZB A;  2RNT A;  3M8C A;  2R4I A;  5ELJ A;  3GZY B;  3V98 A;  3S28 A;  5AII A;  1VQ8 3;  4G1M B;  2RBI A;  3EF8 A;  2B24 B;  3CCL 3;  1B2S A;  1IQY A;  1YI2 3;  3V92 A;  1NNV A;  5JPU A;  1DMM A;  3PCS A;  1O7G B;  3VSY A;  3OW2 2;  1PFP A;  4L8O A;  3EBT A;  2BMO B;  3F8H A;  1Q82 4;  1BOX A;  1JNQ A;  4OK0 A;  1RNB A;  2OTJ 3;  1LNH A;  2J8X B;  1SPU A;  1BRH A;  3DUK A;  2GXF A;  2YFJ B;  3LH4 A;  3LT9 A;  3PXM A;  5FW5 A;  1RNT A;  2HMM B;  3BB9 A;  2WOF A;  1RCL A;  1RGF A;  1Q40 A;  1RKY A;  1AVL A;  1G96 A;  2BHM A;  3FCS B;  2F56 A;  1V57 A;  2D1W A;  4HBR A;  1K9M 4;  2GU3 A;  3FZW A;  3K7C A;  3X3X A;  2W56 A;  4LYL B;  4Q53 A;  3K0Z A;  4R9K A;  4N3V A;  4HM5 B;  2Z76 A;  4LGQ A;  2SBL A;  2WO0 A;  2RFR A;  3LT8 A;  5IER A;  2K0M A;  5LC7 A;  4WYK B;  1KWI A;  1UCI A;  3WOF B;  1RCK A;  2CHC A;  1RLS A;  1BNG A;  4BIR A;  4N6N B;  1DVD A;  1TRP A;  3HK4 A;  3CME 3;  1YGE A;  3SLU A;  4N6M A;  5HOH A;  5I97 A;  1EQK A;  2XSH B;  1S5A A;  1VQ4 3;  1FW7 A;  1AVK A;  2GEX A;  4ILF A;  1WMP A;  3OV4 A;  2W6J H;  1AV4 A;  2CK3 H;  2CFD A;  4EW5 A;  4MMZ B;  3JUP A;  3AMO B;  4HYZ A;  5AIF A;  1M1K 4;  1DVC A;  1BNS A;  1ROA A;  3FKA A;  1JBS A;  1OHP A;  2OTL 3;  5AIG A;  1PY3 A;  3FF2 A;  4EXR A;  3CC2 3;  2BMQ B;  3EB8 A;  3BND A;  1VQP 3;  1BIR A;  2CFK A;  2HOH A;  4FCJ A;  1LNI A;  3CCU 3;  1FGO A;  4AEQ A;  3L0R A;  3MG1 A;  1NO3 A;  1T5Y A;  3V99 A;  2O9U X;  1MWR A;  2RCD A;  4HM6 B;  1NWW A;  2SAR A;  1GY5 A;  1FZU A;  3NX0 A;  3OX9 A;  3G6E 3;  1X1U A;  1FUW A;  4JF8 A;  4L8P A;  4FMA A;  4LSO A;  3A5E A;  5AI1 A;  1C54 A;  2IUJ A;  1TTO A;  1VQM 3;  3NBB A;  2E2T A;  1V74 A;  3CU3 A;  1G02 A;  2OQE C;  6STD A;  2KF4 A;  3EN8 A;  2QEX 3;  7RNT A;  3NUV A;  1AY7 A;  1RGG A;  3MSO A;  2XFT A;  2F5M A;  1NB5 I;  1I3F A;  1OGZ A;  4RBN A;  1M9G A;  1N8Q A;  4ORL A;  5G1K A;  4H61 A;  3K9M C;  5M19 A;  1ZS7 A;  2GBX B;  1BUJ A;  1L5G B;  4KFF A;  2LYX A;  1IU7 A;  4J5K A;  2CWT A;  3NM2 A;  3MG2 A;  3CMA 3;  1E3V A;  1LOW A;  4BTX A;  1K8A 4;  5FGO A;  1BSD A;  1RGH A;  1TFK A;  1BAO A;  1VZZ A;  4HM7 B;  1IV7 A;  2H0I A;  1TJD A;  3ZG5 A;  1DYU A;  2CKF B;  4GSP A;  5BU4 A;  1MGR A;  3GSP A;  3PYJ A;  3A76 A;  4XBT A;  3PGB A;  2HMK B;  4HVN A;  2ZHX B;  4XDV A;  1IVW A;  3IMA B;  4K90 B;  3DMC A;  4O8S A;  5GSP A;  1TU5 A;  1AQZ A;  3I56 3;  3LTB A;  5IEP A;  1CH0 A;  1OHS A;  3DGY A;  3F40 A;  4LMI A;  1WQL B;  1OGX A;  4I4K A;  3EJV A;  5STD A;  3CCS 3;  1G0T A;  1UGI A;  1BRK A;  2K3D A;  3B4P A;  2F4Y A;  3ZFZ A;  1O7N B;  3D5I A;  4KFE A;  4HM0 B;  1BNF A;  3B4O A;  1CEW I;  3B8L A;  1IVV A;  3HII A;  3IPT A;  3LML A;  1DMN A;  1JN5 B;  1VQQ A;  5EVH A;  1TIJ A;  2JDI H;  2L4V A;  1VQK 3;  1UUG B;  1US1 A;  1BRJ A;  1JKG B;  5IG5 A;  3F8X A;  1GOY A;  5KP4 A;  1DET A;  3T8N A;  5M1A A;  2XF3 A;  3EN1 B;  3LZA A;  2I9W A;  1BNR A;  3WOE B;  1UUV B;  1GSP A;  2MF7 A;  3CCR 3;  1UCJ A;  4XBX A;  3N8B A;  1W6Y A;  3EC9 A;  1YIT 3;  3G16 A;  1VQL 3;  3O8Y A;  1SAR A;  4FMD A;  1EA2 A;  4DKI A;  3MKI A;  4WWU C;  4X2H A;  8CHO A;  5ELU A;  1Z1S A;  4RNZ A;  1B27 A;  4BTW A;  1RGA A;  2OCT A;  4N6L A;  4WP5 A;  5DRV A;  3SOY A;  3D5G A;  1JB2 A;  1WMN A;  2ZA4 A;  5HGR A;  1BU4 A;  1Q42 A;  5CF1 A;  5D81 A;  3FG4 A;  1VQ7 3;  1A67 A;  2H0H A;  3MYT A;  1I0X A;  3F7S A;  4HM8 B;  1GMP A;  3G4S 3;  1LQG C;  2YX9 A;  1IVX A;  1IDP A;  3BIR A;  3KKG A;  1JBT A;  4FMB A;  1JJ2 2;  1A90 A;  3NBR A;  1OPY A;  3TDG A;  3NM7 A;  1LVN A;  4HJL B;  4WYK A;  5CK6 A;  1Y4K A;  2IA7 A;  3EHC A;  1W6G A;  3SYU A;  4AKY A;  4CPK A;  1GOU A;  1IQX A;  3BLZ A;  3GAX A;  4HAA A;  2C10 A;  4XM4 A;  3MHE A;  4HM2 B;  3LOY A;  1JZD A;  5AIH A;  4HM1 B;  3AGO A;  2UX0 A;  3S29 A;  1N8R 4;  3JUQ A;  2F86 B;  3X3Z A;  1PU4 A;  2E2U A;  3HX8 A;  1V58 A;  1GMQ A;  1ULJ B;  4MEI A;  5AEU B;  3Q1C A;  1HU9 A;  3NV0 B;  1RSN A;  1B20 A;  3AMO A;  3CCM 3;  1ROV A;  4MMY B;  3U1W A;  3CCQ 3;  4NRE A;  2STD A;  3QK9 A;  4HOH A;  2OWP A;  1B2U A;  1I0V A;  1BSE A;  3BNC A;  2KF3 A;  3EE1 A;  4AKZ A;  1FUS A;  1I3I A;  1AR0 A;  3SXX A;  3WR2 A;  1RRL A;  2IY2 A;  3PZW A;  1JZO A;  1C7H A;  3CC4 3;  3LTD A;  1UGH I;  3DGN A;  3WA2 X;  2RGQ A;  2PNC A;  1N5H A;  1YVB I;  1STD A;  4K1V A;  2BO9 B;  3N9H A;  3JUN A;  2KXG A;  2AAD A;  2F99 A;  4MMX B;  3WHO A;  1QVF 2;  4KZ1 A;  3FH1 A;  1R4Y A;  4NPB A;  1E97 A;  2AAE A;  2CFW A;  2CWU A;  3KE7 A;  1EG9 B;  4O02 B;  4XB5 A;  2OOV C;  1EKM A;  2UGI A;  1JBR A;  3S67 A;  1NJI 4;  2F5W A;  1BNI A;  2W9P A;  2BIR A;  3SVA A;  5AYS C;  3STD A;  1SJW A;  1K73 4;  3KSE D;  1TP6 A;  1N9E A;  2CFL A;  3FG1 A;  4H3U A;  4R1K A;  3FLJ A;  2UUG C;  5JBS A;  1W2B 2;  1B21 A;  3VF1 A;  3AGN A;  1CYV A;  1OH0 A;  3ALA A;  2CX0 A;  2CX1 A;  4HM4 B;  1SIH A;  3KFQ C;  2IMJ A;  3GRD A;  1X1W A;  4JRF A;  3X41 A;  1LOY A;  1EEJ A;  2YFL B;  3NXJ A;  3CCV 3;  1LQM B;  1DE3 A;  3HOH A;  2CC3 A;  4MJD A;  4XDW A;  5BIR A;  1KD1 4;  2XR8 B;  3D9R A;  2XRX B;  1RDS A;  1FGQ A;  3N54 B;  4N6V 0;  3RDE A;  3DGL A;  1WTH A;  4IIA A;  5AEW B;  1RN7 A;  3GZX B;  3H3H A;  2XH9 A;  5LC6 A;  2GBW B;  8RNT A;  1B3S A;  1GOV A;  2W04 A;  5DRE A;  3ROB A;  1TUH A;  3UL5 A;  2HML B;  4R4K A;  1MOL A;  3VGN A;  3CD6 3;  2ML6 A;  1QAK A;  3I0Y A;  1Q7Y 4;  1SQW A;  1FUT A;  3FG3 A;  1YIJ 3;  2GSP A;  1GYB A;  3CPW 2;  5BXQ A;  1FA3 A;  1OAC A;  2FGT A;  2O3O A;  3EQQ B;  3QRD A;  3D79 A;  3URP A;  1JN5 A;  1JRQ A;  2C4B A;  2F98 A;  4CJN A;  6RNT A;  3J7Y d;  3DXO A;  1VQ9 3;  5AYR B;  1FYS A;  4RZM A;  5CF2 A;  2XSO B;  2P09 A;  2KF6 A;  1JKG A;  7GSP A;  3NQZ A;  2M7O A;  2HMO B;  1BRN L;  1WMO A;  1BAN A;  1IV9 A;  3BU4 A;  2GU1 A;  4FR9 A;  1UI7 A;  1CQS A;  4OVM A;  1X1Y A;  3RNT A;  3S27 A;  1BVI A;  4OUQ A;  3E99 A;  2W03 A;  5IW9 A;  1U5O A;  1UCK A;  1DMQ A;  3X40 A;  1RGL A;  3Q3F A;  1YNV X;  2K54 A;  9RNT A;  4IT7 A;  1HZ1 A;  3DGM A;  4WFO A;  1OHO A;  4EV2 A;  4EC6 A;  1WNH A;  3U97 A;  5IEN A;  3CXC 2;  5EEO A;  1ZGX A;  2WGO A;  4CCV A;  2QIY A;  5IG4 A;  3KN4 A;  1OF5 B;  1ASK A;  3CNM A;  4O2H A;  4EYC A;  5A0O B;  1VQ5 3;  4LZI A;  1BSA A;  3OWS A;  3WMD A;  3H51 A;  2XGL A;  1IVU A;  1X1X A;  1D6Z A;  2CG1 A;  1GMR A;  4EBG A;  1LRA A;  2BT3 A;  2KCD A;  4KFD A;  1RGE A;  2KRT A;  3D3L A;  1UDI I;  3MWZ A;  3GWR A;  1N5P A;  2WOH A;  2V1L A;  1STF I;  3UL6 A;  1I2F A;  1MWT A;  3JUM A;  1A2P A;  1TRQ A;  2P0X A;  1IK3 A;  3JUO A;  4K1U A;  1Q81 4;  4N6T A;  3X3Y A;  1W7C A;  2Q07 A;  3CCE 3;  3LTA A;  1CYU A;  1MWS A;  1B2M A;  4KVH A;  3IJE B;  1EUI C;  5TGN A;  4L7K A;  4J9A A;  1VQO 3;  4U13 A;  1ZO2 A;  1O7P B;  4STD A;  1FGM A;  3GZR A;  3BNB A;  3NV0 A;  1JB4 A;  2A15 A;  1IQ8 A;  3OWY A;  4WHA A;  3Q2P A;  1BGS A;  1BRG A;  1UI8 A;  3OWU A;  5G1L A;  3RGA A;  1MNL A;  1JB5 A;  3D4A A;  3HZP A;  1RMS A;  3NHX A;  2Y74 A;  3K5T A;  3MG3 A;  3MPH A;  3LXU X;  1D6U A;  2HMN B;  3KCH A;  1MGW A;  2FNQ A;  5G2G A;  2CIU A;  4TX4 A;  1KQS 2;  1BNE A;  1TFO A;  3WA3 A;  1HYF A;  1Q40 B;  1W4N A;  3T8U A;  1OUN A;  1YGW A;  4BU4 A;  2CH9 A;  1BSC A;  3X42 A;  5JPP A;  2W56 B;  2Y73 A;  4IPB A;  1I70 A;  1BRS A;  3F9S A;  2CG0 A;  1W00 A;  2BU4 A;  3UJM A;  3WOD G;  1QAL A;  2Z6B A;  4RNY A;  3KZT A;  2LQV A;  3DGO A;  4R9L A;  2CFG A;  1T2H A;  1PYL A;  2XFS A;  1QVG 2;  3Q90 A;  3ZG0 A;  3AHW A;  4FCZ A;  1I8V A;  5CLK A;  3HI7 A;  5KP1 A;  2INX A;  4QWT A;  2YFI B;  1GY7 A;  3FF0 A;  2P38 A;  4BL3 A;  5RNT A;  1VQN 3;  1GS3 A;  2P0M A;  2GEY A;  3DY5 A;  5M18 A;  4O3V A;  1HKX A;  4GHO A;  2IYJ A;  4BTY A;  1I2G A;  1UW1 A;  2CW9 A;  2RSX A;  3S5C A;  7STD A;  1M90 4;  1SII A;  6GSP A;  4HKV B;  2BMR B;  4KT3 B;  1D6Y A;  1NDO B;  2KF5 A;  2KAA A;  3T0U A;  1GY6 A;  2W0Q A;  1K41 A;  3DZL A;  3F7X A;  5IG0 A;  2CWV A;  3EBY A;  4K61 A;  3RGR A;  3ECF A;  2ZL8 A;  1M1X B;  3UNL A;  1O7W B;  2P05 A;  4N6U A;  5D83 A;  3WDG B;  4FMC A;  1RRH A;  2W9Q A;  2PZV A;  3ER7 A;  1VQ6 3;  2FXT A;  2WGQ A;  3CPO A;  3DM8 A;  2B1X B;  2H0G A;  2R41 A;  2HMJ B;  2XGN A;  4HM3 B;  1KSI A;  4J8T A;  1MWU A;  1RGK A;  4I5Q A;  1BNJ A;  2Z77 A;  1GD4 A;  2ZDJ A;  4GL6 A;  2OOV A;  1U8C B;  1FGT A;  1W02 A;  2QA4 3;  3FSD A;  1O7H B;  1OCV A;  4J5G A;  3LTC A; 
#chains in the Genus database with same CATH homology
 1HZ1 A;  3SYU A;  1GOU A;  1BIR A;  4HAA A;  1UCL A;  2HOH A;  1YVS A;  1LNI A;  1ZGX A;  3AGO A;  1BSA A;  1GMQ A;  1RN1 A;  2SAR A;  1X1X A;  1GMR A;  1B20 A;  1FZU A;  1LRA A;  1RSN A;  1X1U A;  1B2X A;  1LOV A;  1RGE A;  1C54 A;  1T2I A;  3A5E A;  1TTO A;  1I2F A;  4HOH A;  1A2P A;  1B2U A;  1I0V A;  1G02 A;  1BSE A;  1RHL A;  1TRQ A;  3DH2 A;  2KF3 A;  2KF4 A;  1FUS A;  1I3I A;  7RNT A;  3AHS A;  1AY7 A;  3WR2 A;  1Q9E A;  1RGG A;  1IYY A;  1BRI A;  1B2M A;  2F5M A;  1I3F A;  9RNT A;  2AAD A;  1B2Z A;  3WHO A;  1BUJ A;  1BGS A;  4J5K A;  1BRG A;  1BSB A;  1R4Y A;  3D4A A;  1I2E A;  1LOW A;  2AAE A;  1BSD A;  1RMS A;  1RGH A;  4RNT A;  1BAO A;  1RN4 A;  1RTU A;  1JBR A;  2F5W A;  1BNI A;  2BIR A;  4GSP A;  5BU4 A;  1MGR A;  3GSP A;  3KCH A;  1MGW A;  1RGC A;  1BNE A;  2RNT A;  1HYF A;  1B21 A;  5GSP A;  1AQZ A;  1YGW A;  2RBI A;  3AGN A;  1CH0 A;  4BU4 A;  1B2S A;  3DGY A;  1BSC A;  1I70 A;  1BRK A;  1X1W A;  1BRS A;  2F4Y A;  1LOY A;  3D5I A;  2BU4 A;  1BNF A;  1DE3 A;  3HOH A;  5BIR A;  1T2H A;  1BOX A;  1PYL A;  1RNB A;  3AHW A;  1I8V A;  1BRH A;  1RDS A;  1RNT A;  5RNT A;  1BRJ A;  8RNT A;  1RCL A;  1B3S A;  1GOV A;  1RGF A;  1GOY A;  4GHO A;  1DET A;  1I2G A;  2F56 A;  6GSP A;  1BNR A;  2KF5 A;  1GSP A;  2KAA A;  1UCJ A;  1FUT A;  2GSP A;  1SAR A;  3URP A;  1UCI A;  6RNT A;  2C4B A;  1RCK A;  1B27 A;  1RLS A;  1BNG A;  4BIR A;  1FYS A;  1TRP A;  1RGA A;  2KF6 A;  3D5G A;  7GSP A;  5HOH A;  1FW7 A;  2ZA4 A;  1BU4 A;  1BRN L;  1BAN A;  1I0X A;  1RGK A;  3BU4 A;  1GMP A;  1X1Y A;  1BNS A;  3RNT A;  1BNJ A;  1BVI A;  3BIR A;  1JBT A;  1UCK A;  1JBS A;  1RGL A;  3Q3F A;  1YNV X;  1PY3 A;  4J5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...