2KANA

Solution nmr structure of ubiquitin-like domain of arabidopsis thaliana protein at2g32350. northeast structural genomics consortium target ar3433a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
MGHHHHHHSHAAVRKIHVTVKFPSKQFTVEVDRTETVSSLKDKIHIVENTPIKRMQLYYSGIELADDYRNLNEYGITEFSEIVVFLKSINRAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of ubiquitin-like domain of Arabidopsis thaliana protein At2g32350.
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein ar3433a
total genus 21
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2008-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kanA01
1XD3B 2D07B 4K1RB 4ZRJA 4WQOB 1WY8A 2BF8B 2K6DB 2ZJDA 4DK5A 3V61A 1VCBA 4AJYB 4IM3A 2N9PC 4W9IA 2DAFA 4EUTA 2KX0A 2JWZA 3QC8B 3CSFA 1H4RA 2LGXA 1WR6E 4BOZB 3NHEB 5LXIB 2KK8A 3KVFB 3APDA 3EC8A 5E6PA 5DCNA 1WX8A 4HPLB 1SIFA 4IG7B 2G4SA 4GDKB 3WA0A 5BO4B 5J17A 4K7SA 3VTVA 4B6WA 2QHOA 3L08A 1M94A 2FCQA 1WX9A 3H7PB 2DZIA 1ZKHA 5JH5C 2K8HA 3JW0X 2KVRA 2NS5A 1OQYA 2KFJA 1SE9A 4NJ7A 5LLIA 1I42A 4OVUA 3TIXA 2N1VA 2Z0EB 2L8JA 2N4FA 2BKRB 4K7WA 2CHZA 2LXCA 3PRZA 4I6NB 4II2B 4DBGA 2HD5B 2DYMA 1V2YA 3N3KB 4F7ZA 2KZRA 2D10A 4G50A 2MX2A 3DBRI 2JT4B 1EF1A 2Z59B 4KDLB 3UQAA 4MGYE 1WXSA 1Q5WB 2WDTB 3WIMA 2XK5B 4FLHA 3TJPA 1J19A 2C7MB 3TMPB 1WZ0A 2KJRA 2MRPA 4FULA 2L0FA 3UQBA 3QARA 3U7DA 4IWPA 3ZRCA 2C60A 2MA9B 3HM6X 2NBVB 3GOEA 4AP4C 4ZRIA 4DDGD 4TQ0A 3D32A 3LJ3A 2V4LA 3B1LX 3AI5A 4X57B 5CX3A 3M3JA 1E7VA 3EECA 2KTFA 1H8CA 2JRIB 3KUDB 4G0NB 3P2BA 1WGYA 3KW5B 4ANWA 3ML8A 1UD7A 1KM7A 2BGFA 2ZNVC 2CS4A 3AULA 2LRUA 2LWPA 1TGZB 3A9KA 3PHXB 3PV1A 3V6CB 3DPDA 4KSKC 3VH4B 3PLUA 4HCNB 2LD9A 2KX3A 4BKSD 3PGEA 4F1SA 4GXBA 3L0WB 2IO1B 1D3ZA 3RZFA 3VUYA 2CU1A 2LXAA 4TUUA 4DHJB 2PE6B 4GB9A 2IY1B 2RR9A 1UGMA 2ZZPB 4FHKA 4DHZB 5C23A 1GUAB 1TBEA 2FCNA 4WWNA 3RD2A 4OVVA 3VTWA 3OAWA 4IUMB 2NR2A 2LRWA 1AARA 3T9LA 5D6JB 1YQBA 4BBNF 2N7EA 2K8BA 3T8MA 2KLGA 2OOBB 1OEYA 5D94A 3KH0A 2GMIC 4A20A 1KLVA 1ZGUB 1GJZA 2KFKA 1G6JA 2HJ8A 3UINB 4PYUA 3QA8A 4GIVA 3VUWA 4MH0E 5JZEB 4ZRKA 3DVGX 3H1UA 2B3AA 3NOBA 3TL5A 3DVNV 1P1AA 2A5UA 4M8MA 4IM0A 3A9JB 4HDQA 5AEKB 2MQJA 3IG3A 1LFDA 2JZZA 2JRHA 4BKTA 4CHKA 1TZ1A 4HLEA 5FR6A 3QQ8B 2FNJB 2CR5A 4N9F4 3M62B 3HIZA 2KANA 3A1QB 4W9JA 2G3QB 3DOWA 1U4AA 2M8SA 3OLMD 2KMAA 4A3PA 2FUHB 3MJWA 2FCMA 3ZVVA 4W9CA 4PYZA 2AL6A 4LJPB 2IO2B 1GC7A 4K7UA 3ZNZB 2O2VB 1Q0WB 1YD8U 1YIWA 3B08A 4KZ0A 1R4NI 4AOFA 3DBSA 3RULA 4AWJA 3PS6A 4IWQA 4MELA 2MBOA 4HXDA 4AJWA 1UBIA 1A5RA 2ASQA 3ZDTA 4TKNA 3APFA 3NS8A 4KV2A 4WJPA 2LVQA 1EF5A 1QZEA 1TTNA 2LI5A 4W9HA 4I6PA 2XBBC 4E71A 2LGYA 2KTRB 3HK0A 2V3SA 2ZCCA 2GBRA 1V86A 4IC7B 2UWQA 1BT0A 1WMHA 3QX1A 3ZDMC 2JXXA 4W9GA 5AZHA 2D2QA 1S1QB 1VD2A 2JZ3B 3RCZA 3AU5A 4KDIC 2D3GA 4I6LB 3R7QA 3ZNID 1Z5SB 2JY6A 2NVUI 4TQ1A 2O6VB 4WWOA 4NQLB 5CHVC 1LQBA 2BYVE 1UH6A 2MBEA 4W9KA 3JSVB 3NY5A 4FBJB 2N1WA 4E3CA 2MP2A 3S2AA 3W1SA 2MBHA 4G11A 3ALBA 5CHWA 1C1YB 1V5TA 5GMVA 1Y8RC 1WX7A 4BFRA 3QCAA 2C5LC 1WIAA 4EFOA 3VXWA 4HPMB 4EKUA 4B9KA 1V9JA 3A1QA 2MP2B 1R4MI 3EFUA 2FIFA 2KJHB 3DDCB 3UF8A 2DYOA 3JSVA 1LXDA 3H9DA 1P3QU 2KQSA 2YLMA 3RT3B 3VFKA 4M8NA 5IAAC 1K8RB 3EHVA 3HHMA 3UIOB 1J0GA 2MSED 1YJ1A 3V60A 2G45B 1RFAA 1EUVB 2K25A 2ZCBA 5JHAA 3ZLZA 2FCSA 2LGDA 2RD0A 4URKA 4E74A 1WRDB 3QWZB 2L05A 3BY4B 4TV3A 3JYUA 2K8CA 3O65B 3SDLC 1NBFC 3SHQA 4IW0A 2IZVB 4XC2A 4EZLA 1E8ZA 5LXHA 5J18A 2EKEC 2J0MA 4JL9A 2N9XA 2BPSA 2NBWB 2ZEQA 3ZTCA 1WR1A 4K81A 2J0JA 4MGZE 1IP9A 2KWUB 4B95A 4A3OA 3DBHI 1Z2MA 2KDBA 4W9LA 4CO7A 2DHZA 4AUQC 2MW5A 4FJYA 1WJ4A 1UELA 2A4ZA 2DX5B 4JIOU 5D2MB 3VAWA 2KWVB 4PS7A 3V6EB 3W1SC 1P9DU 2L76A 2M0XA 4WWPA 3RYTA 3B0AA 5E6OA 2IYDB 3OJ3A 2AWTA 2G4DB 2LASA 2AEHA 2C9WB 2ZVNA 1UZXB 3K9PB 1IYFA 3VTUA 1WM3A 3NZUA 2KDFB 5J2RA 3UGBB 4ANXA 3MHSD 3ML9A 2VRRB 3X23A 2IBIB 4EZKA 3WAOA 4MJSB 4BBNC 4EOYA 1C3TA 3PT2B 3WALA 2DZKA 3DBLI 4II3B 3H7SA 5DPSA 3WANA 3ZRFA 4BVUC 2KC1A 2KD0A 3ZNGC 1V6EA 2LVPA 2PE9A 3ZKJC 3V62A 1ISNA 4BOSC 4HK2A 1FXTB 4NNJB 2KHWB 1E8YA 4KSLC 2ZNVB 1WGHA 3CSTA 2Z0DB 3QJZA 2WX0A 5E6NA 1JRUA 1L2NA 2L0TA 1V80A 2EMTA 2NBUA 4MSQB 3KUZA 2JUOA 2YVCA 2XK5A 3ZW3A 3SD5A 5CHFA 4NJ6A 3SU8X 1T0YA 2MWSB 2L3ZA 4LDTB 2J7QB 5D7GA 1WJUA 1P98A 1WF9A 3I3TB 1OGWA 1WGGA 1WI0A 2N9EB 3A4RA 3WAMA 3GZNI 1P0RA 4FADA 3M63B 3TBLD 3IFWB 4LCDE 4JGHB 1EO6A 3CF6E 1WXVA 3H6NA 1WZ3A 3PTFC 2MCNB 1WFYA 2NCNA 3LDZE 3VVWB 2GOWA 3NZSA 3A9KB 2AYOB 1WGRA 2RSUA 4GN1A 2DZJA 2R2QA 4JLCA 2CHXA 3JVZX 4NQKE 4ZYNA 3VUXA 2ZPNA 3ZO5B 3TCAA 3DVNU 4G3XB 3U30A 3ENEA 4FA6A 4CYEA 2BWES 4WJQA 4ICVA 2L7RA 4DHJD 2J0KA 4W9DA 2GBMA 1LM8B 5G2NA 1RAXA 4ANVA 3OJ4B 4W9FA 2DAJA 1V81A 3K9OB 5JHBA 5AZFA 5TR5A 2KDIA 3BINA 2HE7A 1E90A 4P7IA 4DXAB 4DDID 3PSEB 4HDOA 2M17A 2K6QA 3A9JA 3AXCA 2GBNA 3L10B 2KNBA 2JPHA 3MTNB 4FJVB 3VHTC 2LZ6A 4EZJA 4GOCA 4DWFA 2MBBB 1WE6A 3APCA 3ONSA 5L83A 1KOTA 5G55A 4RM9A 1XT9B 3R3MA 1WE7A 3ZTDA 4IWOA 4WJOA 1J8CA 2LJ5A 2ZPYA 5CTRC 2N7DA 2KMCA 4YL8A 2GBKA 3Q3JA 1XQQA 1I35A 1OEYJ 3QK0A 3A33B 5DPRA 1E5WA 3IBEA 2NPTB 3PREA 4LDTD 4GDLB 4NAWA 1RRBA 2M1MA 1RLFA 2KKCA 3A4SC 3N30A 4MJSA 4PS3A 2Y5BB 2WX1A 4PS8A 2FAZA 3R7RA 1L7YA 2PEAA 4IM2A 5DPWA 4XZ4A 4RM8A 4KVGB 4F8CB 3H7PA 5L95C 2KO3A 5IA7A 4BKSA 4MEMA 4LJOB 2RPQA 1V49A 1HE8A 3L13A 4ASWC 1ZW7A 1Q1OA 2K39A 4FN2A 1F9JA 3CMMB 2KWCA 2ZVOA 4HWIB 3M95A 3DCGA 4HCPB 1WYWB 2KLCA 4JQWC 4WJNA 2PJHA 4ANUA 2C7NB 3N32A 4GMVA 1OTRB 4MSMB 3AU4A 3PRPB 3X0WA 5C1ZA 4WAAA 2EMSA 5HKHA 2JVCA 1IPGA 1GNUA 2O6VA 4ICUA 3ECIA 4NAWB 3ZIMA 5EDSA 2REXA 1YX5B 1CMXB 2UYZB 2MLBA 4GDLA 2FIDA 2MBQA 2JF5A 4MDKE 2LVOA 3L54A 3PLVA 2I1KA 4KIKB 3PZDA 2L00B 4MM3A 4GSWA 2KFKB 1WMHB 3R66C 2AL3A 2DENB 4RMAA 1WXMA 2KOXA 2PPHA 3VH3B 2IY0B 4FJZA 2OJRA 2KTRA 4M0WB 4KIKA 3L17A 4NY0A 2V1YA 3PRMB 2IO3B 3KYCD 3IVFA 3KUCB 4KZCA 1WM2A 2BKFA 5KHQA 3U8ZA 4FHJA 1KJTA 1E7UA 5DPTA 3UIPB 2M4NA 2KQ7A 4MGKE 3WAPA 3VDZA 1NDDA 2HTHA 1MG8A 2O6VD 4MGIE 3ZNHB 4DHZE 2I1JA 3KYDD 2R2OA 2O2VA 1X1MA 2BWFA 2BYEA 2KN5A 2K1FA 4BKGA 1WJNA 2CHWA 2WYQA 4EEWA 2CKHB 1WJ6A 2DZMA 1PQSA 2KC2A 4GU2A 2KJ6A 1UBQA 3W1YA 2GBJA 1WGDA 5AZGA 1WH3A 1GG3A 1YX6B 3QHTA 3IHPC 4ZDVA 4HVBA 1S3SG 3RZWC 3QIJA 2D11A 2IO0B 3L16A 1E8XA 2NPTA 3PVLA 4GDKA 3VQIA 3Q3FA 3HM3A 2LUEA 3PPAA 4NPNA 1WXAA 1SGHA 3QAQA 4W9EA 2XEWA 4GGQA 4J6IA 2W9NA 2RGFA 3ZUNA 3PHWB 1V5OA 3DQVA 4XX5A 2BYFA 3C0RB 3DVGY 1NI2A 2C7HA 2DYBA 2KXJA 2WWZA 4HJKA 2KDEB 5KHOA 1GC6A 1E8WA 3RUIB
chains in the Genus database with same CATH superfamily
3NZ3A 1XO3A 4K1RB 1WY8A 2BF8B 2K6DB 2ZJDA 4DK5A 3V61A 1I4XA 2KDMA 2KX0A 3QC8B 1H4RA 5IN7A 3APDA 1TJEA 5DCNA 5BMGA 4YXDB 2ONQA 2G4SA 3WA0A 1YNTE 2W55A 4K7SA 5G5HA 4B6WA 1M94A 1F77A 2FCQA 2SEBD 3H7PB 1T3QA 5JH5C 2K8HA 1UWXA 2NS5A 3H8HA 3AEAB 2W3RA 1AW7A 1SE9A 4OVUA 3TIXA 2L8JA 2CHZA 2N9KA 3PRZA 2DYMA 3DHGC 2D10A 3LYYA 2V4IB 2MX2A 4KDLB 3AN1A 4FLHA 2C7MB 1WZ0A 2KJRA 2L0FA 4A6QA 2RMMA 4TQ0A 3D32A 4X57B 3MJ5A 3M3JA 4ZRPA 2LJIA 1E7PB 1EU4A 3HVDA 4ANWA 3SR6A 3AE6B 3ML8A 1TS3A 2MJEA 3V6CB 2H88B 3VH4B 2LD9A 4LNOA 3RN9C 4GXBA 3DBRB 2IO1B 2WDQB 2CU1A 1IBXA 2PE6B 4N58A 1UGMA 5IO9A 1TBEA 4OVVA 1ET9A 3DWGC 5D3IB 3T9LA 1YQBA 1MHHE 3DHHC 2VZKB 3T8MA 3KH0A 3P4RB 3RNAC 1KLVA 2J42A 1ESFA 1G6JA 2HJ8A 3UINB 5HG2A 1NENB 2EELA 4ZRKA 2B3AA 4IM0A 3ZYYX 3A9JB 4HDQA 5AEKB 1DOIA 2LEKA 1LFDA 2JZZA 4HLEA 4N9F4 2TSSA 4XDDA 3M62B 3HIZA 2G3QB 3DOWA 3C19A 1U4AA 3OLMD 2KMAA 4A3PA 1I4HA 2AL6A 1Q0WB 1FPYA 1R4NI 1XCQL 3RULA 2MBOA 4HXDA 4NZLB 1MPEA 3APFA 3NS1A 4KV2A 3Q3OC 4WJPA 1QZEA 4W9HA 4I6PA 2B76B 3FC4A 4L23A 4XE0A 4YTPB 3HK0A 2V3SA 2ICIA 2D3BA 2XN9C 2E3TA 1WMHA 3ZDMC 4W9GA 1D5MC 4KDIC 1MJDA 3R7QA 2JY6A 2NVUI 4WWOA 4NQLB 2BYVE 3ABVB 1JW9D 2BW2A 4RGNA 4FBJB 1FFVA 1JCKB 2IGHA 3ALBA 1C1YB 1WIAA 4B9KA 3OWEB 4FXCA 3AEFB 2QMTA 5EE1A 2DYOA 1LXDA 2KQSA 4M8NA 3HHMA 1YJ1A 3UI3A 5JHAA 3AE4B 1R4NB 1WRDB 2QCZA 3JYUA 1ZPSA 4XC2A 3SFDB 3FKYA 2WXFA 5LXHA 2EKEC 2J0MA 2N9XA 2NBWB 1WR1A 2J0JA 1IP9A 2KWUB 4A3OA 3BK1A 4CO7A 1DOYA 5D2MB 2KWVB 4PS7A 3NG0A 3OJ3A 2AWTA 1GB4A 2ZVNA 5AUKA 2AEHA 2C9WB 4ZOHC 2PTLA 2BS3B 3VTUA 4ANXA 2VRRB 3WAOA 4RGOS 2KC1A 2KD0A 3ZNGC 2JU6X 2PE9A 3ZKJC 2X38A 1E8YA 1WGHA 4IDIA 2WX0A 2WXNA 2L0TA 4O1NA 3ZQ4A 4XGAB 2KVZA 3KUZA 1TS5A 3NUHB 5CHFA 3SU8X 3I63C 5D7GA 1WJUA 4M0WA 1N63A 4OVZA 4MH8A 4FADA 3M63B 1YN5A 3IFWB 1VLBA 1WXVA 1WFYA 1XLQA 2NCNA 3GZNB 4USAA 3AE3B 2QC8A 3NZSA 2AYOB 2DZJA 2R2QA 4JLCA 2CHXA 3VUXA 3ZO5B 2FE8A 1FRRA 2IGGA 3LB8C 4G3XB 3RFZB 2BWES 1RAXA 1M4VA 2DAJA 1V81A 4LNIA 2DWQA 3BINA 3EFCA 4DXAB 4DDID 1WXQA 2WHIA 3AXCA 1TY2A 2KNBA 3VR9B 4FJVB 4EZJA 4GOCA 4RM9A 1WE7A 1J8CA 1RYJA 1Q10A 1ENFA 1XQQA 3QK0A 1PUTA 3IBEA 3BVMA 4P1CC 2M56B 4PS3A 4IM2A 4RNAA 5DPWA 2J53A 4BKSA 4KGSA 1C4PA 3L13A 1Q1OA 1F9JA 1K51A 2ZVOA 4HCPB 2JXTA 4WJNA 2PW9A 3U4EG 1L5PA 1QQRA 1HEZE 1TZOA 3X0WA 2EMSA 1IPGA 3ECIA 5EDSA 2REXA 2UYZB 4C4VA 4GDLA 2FIDA 2JF5A 2LVOA 3PLVA 4MM3A 2KFKB 1WMHB 4WWMA 4M0WB 1OQQA 3KUCB 4KZCA 2OHFA 2D5GA 2M4NA 1AWDA 1MG8A 2O6VD 3ZNHB 2I1JA 1X1MA 2JYEA 2CU3A 3P4SB 3V3XA 3RNBC 2KC2A 2BT6A 1WH3A 3Q8CA 1QOAA 1P7EA 4XYCA 4KKIA 2NPTA 1JRPA 3QAQA 2W9NA 4MT5A 1B1ZA 4MM3B 2BYFA 2IPKD 1WSPA 3VR8B 2WS3B 1K53A 1EWCA 5KHOA 3VRBB 3RNEC 4C00A 3EA6A 4ZRJA 3AH7A 4XDCA 2DNFA 4AJYB 4P1BC 1C77A 2LGXA 5H92C 3EC8A 1WX8A 4HPLB 1JWAD 1SIFA 4IG7B 5J17A 3OG5A 1BXTA 2DZIA 1ZKHA 1HQRD 2KVRA 4C56C 5LLIA 1VRAB 2N4FA 3AEGB 1GOZA 4II2B 3DBRI 3KQ4A 3RPFC 2Z59B 1WXSA 1Q5WB 2XK5B 3TJPA 1XLPA 1KTKA 3SFEB 3UQBA 3QARA 4RF1A 3U7DA 4IWPA 3ZRCA 3HM6X 2NBVB 1PFDA 3AI5A 5CX3A 3TEYA 1L0XB 3I5JC 1H8CA 1TT5B 2CJNA 4G0NB 3P2BA 1SE2A 3KW5B 2PIAA 3MFGA 1TGZB 3PV1A 3DPDA 5BMHA 3PLUA 4HCNB 4F1SA 2OJWA 3L0WB 1D3ZA 3RZFA 2FUG1 4HJGE 2KQ4X 2IY1B 5EE3A 4DHZB 5C23A 3DHIC 4LTUA 4OZAA 3AE2B 4IUMB 1KRHA 2NR2A 1XF5L 4BBNF 2HDEA 5D6JB 2OEDA 2K8BA 2KLGA 2QIEB 5D94A 1MG4A 1ZGUB 2KFKA 1KLGD 1N62A 2WLBA 4PYUA 3KWLA 4GIVA 4MH0E 1V1OA 3DVGX 3NOBA 3FILB 3BVZA 2L83A 3RMKC 3MC9A 4D2KA 2MQJA 3IG3A 3NVYA 1D4BA 4CHKA 3Q14C 5FR6A 3A1QB 4W9JA 2M8SA 2FUHB 3ZVVA 4A9AA 1YN4A 1T0RC 5IOIA 4W9CA 1I4QA 2IO2B 4K7UA 3T3OA 1WYGA 3DBSA 2BB5A 5HHDG 4IWQA 4AJWA 1NVID 1VZ6A 2LVQA 2NMQA 1ZXIA 2XBBC 4E71A 2KTRB 3NVZA 2UWQA 3QX1A 1A70A 2JXXA 2IDYA 2D3GA 2NTSA 4LK0M 1VJKA 4B0EA 2O6VB 3AE7B 4KGTA 5AUIA 3PZ7A 4W9KA 3JSVB 4E3CA 2MP2A 4G11A 1V5TA 5GMVA 4EFOA 3A1QA 2Y3AA 1R4MI 1VZ7A 1T6BX 1D6EC 2FIFA 3IT6B 5IAAC 3UIOB 1J0GA 2MSED 3V60A 4ZRQA 2K25A 1N60A 1Y56A 2LGDA 5C2TB 4E74A 2AQ1B 3I57A 1SBBB 2V9HA 2WU2B 3QWZB 3BY4B 3SDLC 3SHQA 4IW0A 4JWUC 1QOFA 4YT0B 2QILA 1FCLA 4JL9A 4K81A 3RNFC 4MGZE 1Z2MA 1C4AA 2DHZA 1WJ4A 1UELA 4WWPA 4RGTA 3W2DA 2V3PA 2G4DB 2LASA 3K9PB 3IAS1 1IYFA 1WM3A 5J2RA 3ML9A 3X23A 2E6XA 2WDVB 1F2RC 4EOYA 2LFIA 3P42A 1V6EA 4HK2A 3N9YC 1BMLC 3QJZA 2I2YA 1V80A 2EMTA 4MSQB 2YVCA 4AS1A 1TY0A 4NJ6A 1T0YA 2MWSB 1WF9A 4TSSA 1OGWA 2AX5A 2SAKA 3WAMA 3GZNI 1FXAA 4M00A 1EO6A 3Q69A 2MCNB 3VVWB 2HTME 4GN1A 3A9KB 2RSUA 2BVCA 2N9LA 2D3AA 3ENEA 4WJQA 2ON8A 3GB1A 2J0KA 4W9DA 2GBMA 1LM8B 3PZ8A 1CQVA 4H2AA 3OJ4B 3K9OB 2WXJA 2HE7A 3N1YC 4HDOA 3A9JA 3AB5A 3MTNB 1SSNA 3VHTC 1WE6A 3TSSA 1L6VA 3ONSA 5G55A 3MC0B 3BVGA 4WJOA 3AMZA 4IWOA 2ZPYA 2KMCA 4YL8A 1I35A 1OEYJ 2LGIA 1E5WA 2NPTB 4GDLB 4ZHOA 2M1MA 3A4SC 3N30A 1JQ4A 4MJSA 5IP4D 2WX1A 4KVGB 2MEKA 4MEMA 1I4PA 2PVGC 3CIRB 4ASWC 4WQMA 1ZW7A 1FEHA 3CMMB 2DBYA 2KWCA 2V3NA 2QDFA 1I7HA 5BYSA 2PJHA 2INDC 4KKJA 4ANUA 3N32A 3AEBB 1N5XA 2G1EA 1ZE3D 3C8YA 5HKHA 4ICUA 1FIQA 4NAWB 3ZIMA 1DYQA 1CMXB 2MLBA 2MBQA 3L54A 3RNCC 1FNUA 2DENB 4RMAA 1WXMA 4WAFA 2IY0B 2KTRA 1SB3C 2V1YA 3CWIA 3KYCD 1YN3A 2UU7A 2BKFA 2WNMA 1C76A 1FCCC 1MVKA 1L0YB 4FHJA 4LLGM 5DPTA 3UIPB 5H8YE 3VDZA 2HTHA 3W9CB 4DHZE 3AEEB 3KYDD 2MHJA 2O2VA 4YSZB 2BYEA 1EU3A 2K1FA 3PO0A 1WJNA 4EEWA 2CKHB 4GU2A 2KJ6A 1GPXA 1UBQA 1HA5A 1F0ZA 1F1HA 1PYWD 1YQ3B 1GG3A 3IHPC 4ZDVA 3QIJA 3FILA 2IO0B 3L16A 3HRDD 2MJ3A 3Q3FA 1DGJA 2M0AA 3DBLB 3HM3A 2LUEA 4NPNA 4W9EA 2XEWA 2QJLA 2RGFA 4XX5A 3C0RB 3DVGY 1NI2A 4HJKA 4KSKC 1E8WA 1KH0A 3RUIB 3Q3NC 4WQOB 4IM3A 4W9IA 2DAFA 1WR6E 3NHEB 5LXIB 2KK8A 2N7JA 4GDKB 5BO4B 4JE3B 3VTVA 1D5ZC 4JX1C 2QHOA 1TKGA 3L08A 1WX9A 3NRZA 2MH7A 2EKIA 4N59A 1C79A 4WH4A 1I42A 4K7WA 3NJTA 3LXFA 4DBGA 1RM6C 2Y5PA 1V8CA 1V2YA 2KZRA 1IGCA 4G50A 1E10A 2JT4B 1EF1A 4MGYE 4A8XC 2WDTB 3TMPB 2W3SA 4AP4C 4ZRIA 2FBWB 4B0MA 2QEJC 2JRIB 1WGYA 1UD7A 2BGFA 2ZNVC 2CS4A 2LRUA 2WGSA 3A9KA 3PHXB 4HKZE 2YEPB 1PGXA 1XLOA 4UDUC 4BKSD 3L4PA 1L4ZB 3HUIA 3I9V1 4IOIE 4ARCA 1YJIA 4DHJB 4GB9A 2ZZPB 4FHKA 4QAYA 3U7ZA 2FCNA 4WWNA 4RCOA 3VTWA 4KGRA 1AARA 1OEYA 1PGBA 4NAMA 4LNFA 1TS2A 5EE0A 4A20A 1GJZA 2XNAC 2YEPF 5D3DA 3QA8A 1JROA 3VUWA 3AE5B 2N0SB 3H1UA 3TL5A 1P1AA 3AV8A 3T3NA 3IT4B 4LNNA 1TZ1A 2CR5A 2M19A 2KANA 2X8XX 2LHEA 2BYTA 1JWUD 2FCMA 3BWUD 1I4GA 4YSXB 1GC7A 4KZ0A 1YIWA 3TEXA 5EE9A 1R7SA 4AWJA 4ZHPA 5G5GA 2ASQA 1A5RA 3ZDTA 1D5XC 3N20C 4S17A 3NS8A 5FKAC 3MC8A 4GLSC 1EF5A 5I4DA 1ET6A 1TTNA 2LGYA 1IGDA 2ZCCA 2GBRA 1R4MB 1BT0A 2D2QA 1S1QB 2WU5B 3RCZA 3AU5A 4C4VB 4I6LB 1NI3A 3V05A 5CHVC 1LQBA 3R8BA 1F2RI 1UH6A 2MBEA 1QLBB 3NY5A 2N1WA 4N6EB 2MBHA 4BFRA 1WX7A 3QCAA 3VXWA 4HPMB 4EKUA 1V9JA 2MP2B 2KJHB 3JSVA 2J4XA 1FNWA 2J52A 1J7CA 1P3QU 2YLMA 3RT3B 3ZJUA 3EHVA 1FNVA 3B2GA 4CQNA 3ZLZA 2AQ3B 2FCSA 2RD0A 4AQ7A 1JALA 2K8CA 2JWUA 1NBFC 3ZJTA 1V97A 4EZLA 2BPSA 2ZEQA 3ZTCA 2K22A 4W9LA 2MW5A 5BYRA 2A4ZA 3BZDB 2DX5B 4JIOU 3VAWA 3GP7A 2JZPA 1P9DU 2L76A 3R2IA 3RYTA 2IYDB 2WXGA 2G9HD 3ZGZA 1TKEA 3NZUA 2KDFB 5BMIA 3UGBB 5GXGB 1N61A 3DBLI 4II3B 4BVUC 2LVPA 2BS4B 2LHDA 1FM0D 5E6NA 1L2NA 1C4CA 3SEBA 2NBUA 2CJOA 2JUOA 2W82A 1STEA 3ZW3A 3SD5A 1MFWA 3FAHA 1HZ5A 2WXPA 2L3ZA 4RH6A 2WXHA 4XWWA 1WGGA 1OQRA 1WI0A 3N1ZC 3CF6E 3H6NA 1WZ3A 3PTFC 3LDZE 1L4DB 2K9XA 2GOWA 1WGRA 4ZYNA 3NVVA 3TCAA 3U52E 3DVNU 1NYRA 4YTMB 4CYEA 1TIFA 2Q5WD 4DHJD 3TUOA 4ANVA 4W9FA 5JHBA 2Z8LA 3N1XC 5TR5A 4NJCA 1E90A 2BB6A 4P7IA 2M17A 2K6QA 3BIID 2GBNA 1J7AA 1TS4A 2JPHA 1T0SC 4DXGA 4DWFA 2DLBA 3APCA 2RDHA 1KOTA 1QOGA 1XT9B 4US9A 1K52A 3ZTDA 4TMAB 4J3OD 4HPPA 2N7DA 1HXYD 3A33B 4LDTD 1L6UA 3PREA 4NAWA 1RRBA 2KKCA 3KWVA 3DBHB 4PS8A 2FAZA 1L7YA 4F8CB 3DWMA 2KO3A 5IA7A 4LJOB 2RPQA 2WDRB 1V49A 1C78A 2K39A 1XEEA 2KLCA 1EM7A 2WXOA 4GMVA 1OTRB 4MSMB 2WXQA 4RFBA 2KT7A 1ROEA 1YJJA 2JVCA 2BS2B 3IXSA 1LGRA 1YX5B 4KIKB 3PZDA 2L00B 3RNGC 4GSWA 3R66C 2AL3A 3VH3B 2KOXA 4PT5A 3HVZA 3L17A 4NY0A 3PRMB 2PMVA 3ZXVA 3IVFA 1ZDVA 1VDVA 1AYFA 2GLSA 2KQ7A 3WAPA 4MGIE 2RDGA 3P1MA 4BKGA 2CHWA 2WYQA 1WJ6A 1PQSA 3VRAB 2INCC 3KLSX 1SEBD 4L1BA 3E56A 1L0VB 1GB1A 1YX6B 3QHTA 1HZ6A 1S3SG 3P4PB 3RZWC 2D11A 1ZDXA 3BK2A 1E8XA 1WWTA 3PVLA 2INPE 3EGRA 5C3JB 1SE3A 2L52A 1UF0A 4J6IA 1V5OA 2I38A 3DQVA 1BUIC 1FFUA 2PVOD 3ZJVA 2KDEB 1ISNA 4C7YA 1XD3B 2D07B 1VCBA 2N9PC 2AQ2B 4EUTA 2JWZA 3CSFA 4BOZB 3TEZA 3KVFB 5E6PA 1E0ZA 1F52A 3Q8AA 4US8A 1ZXHA 2WQYB 1QT9A 4JPSA 4DQOC 3JW0X 2JX5A 4C80A 1OQYA 2KFJA 1I4RA 1GAQB 4NJ7A 2N1VA 2WXKA 2Z0EB 3E9SA 2BKRB 2GB1A 2LXCA 4I6NB 2HD5B 4WURA 1CZPA 3N3KB 1VZ8A 4F7ZA 2WP9B 2D3CA 1T0QC 3UQAA 3WIMA 1J19A 2MRPA 4FULA 2ACZB 1XLNA 2C60A 2MA9B 4LNKA 3GOEA 4DDGD 3LJ3A 3O13A 2V4LA 3B1LX 1FRDA 2WXIA 3B2FA 1E7VA 2PKOA 2WXRA 2KTFA 3EECA 1SE4A 3KUDB 1ZUD2 1KM7A 3Q8BA 3AULA 4Q2JA 2BQQA 3GE3C 2QSDA 2LWPA 5T8IA 2KX3A 3PGEA 1JWSD 3VUYA 1QKZA 4C7ZA 2LXAA 3ETRA 2INNE 4TUUA 1ZOYB 2RR9A 1E9MA 1GUAB 3RD2A 3OAWA 2LRWA 3AE9B 4OZBA 4PK1A 2N7EA 2JYTA 2OOBB 5HFYA 1V1PA 4ARIA 2GMIC 2LUMA 5JZEB 2LMCA 4XWTA 1QOBA 3DVNV 5IKCM 2A5UA 4M8MA 2RPVA 2JRHA 4BKTA 3Q8FA 3QQ8B 2FNJB 2KACA 2Y5CA 2L32A 1WGKA 1YMHE 3MJWA 4PYZA 4LJPB 3ZNZB 2O2VB 1YD8U 3B08A 1TKYA 1VR9A 1QILA 2V0GA 4AOFA 3PS6A 4KX6B 4WIPA 4MELA 1UBIA 1N6ZA 1SXTA 4TKNA 2GI9A 1T5XD 1RFKA 2JSVX 2K3UA 1XXGA 2NTTA 2LI5A 3Q3MC 1V86A 4IC7B 4L2YA 5AZHA 1VD2A 2IGDA 2JZ3B 3B9JA 4RF0A 3ZNID 1OFFA 1Z5SB 4ITKA 4TQ1A 4YWGG 1LO5D 4M01A 2KWDA 1UWMA 2WXLA 3MHZA 1WRIA 3S2AA 1SIJA 3W1SA 5CHWA 5FK9C 1Y8RC 2C5LC 5HI1A 1AN8A 3EFUA 2KMMA 4OZCA 3DDCB 3UF8A 3H9DA 3VFKA 2ZW1A 1K8RB 2ZW0A 4EE2A 4IKGA 1IUEA 2G45B 1RFAA 1EUVB 2ZCBA 5BYQA 2BTEA 3BYTB 1FD6A 1JWBD 4OHJA 4URKA 1FMAD 3AEDB 2L05A 4TV3A 3Q8EA 1V1PB 3O65B 4REZA 2IZVB 1FXIA 2VZKD 1E8ZA 5J18A 2BBCA 1K50A 1MHXA 4M02A 4BAXA 3TEWA 4B95A 3DBHI 2KDBA 3AM9A 4YSYB 4AUQC 4FJYA 1E6EB 4ACFA 3V6EB 1UUPA 3W1SC 2M0XA 4BZAA 3B0AA 5E6OA 1EWYC 1YQ4B 1YOVB 1UZXB 3URYA 3P4QB 1DOXA 1JWMD 2JQRB 3MHSD 4EZKA 2IBIB 4MJSB 4BBNC 2IJ0A 2L1AA 1C3TA 2W54A 2KAJA 3PT2B 3WALA 2DZKA 3H7SA 5DPSA 3WANA 3ZRFA 4BOSC 3V62A 1FXTB 4NNJB 2KHWB 4KSLC 2ZNVB 3CSTA 2Z0DB 2R61A 1JRUA 3R2TA 3AE8B 4K3BA 2RDBC 2XK5A 1QF6A 1C9FA 4MACA 3AECB 4LDTB 4OW0A 2J7QB 3NVWA 1P98A 3I3TB 2N9EB 3A4RA 1ACCA 1P0RA 5FR3A 3TBLD 2K0PA 4LCDE 4JGHB 3P63A 2KYWA 2VH1A 2GRIA 4NQKE 3BYYB 3JVZX 2ZPNA 5JXVA 3U30A 3MP9A 3GS2A 4FA6A 4HKQA 4ICVA 2L7RA 5G2NA 5AZFA 4HEA1 2PLPA 1KLUD 2KDIA 4P6VF 2VH2A 1UGJA 3PSEB 4R3DA 4P16A 2H89B 1FO4A 3L10B 1NYQA 1PGAA 1MI0A 2LZ6A 2MBBB 2LGSA 5L83A 5E6JA 3R3MA 3J9CA 2HJ1A 2LJ5A 5CTRC 2GBKA 3Q3JA 5DPRA 3Q2AC 3GE8C 3AE1B 1JMLA 1RLFA 2MJDA 2Y5BB 3R7RA 1TYGB 2PEAA 1PDXA 4XZ4A 4RM8A 1XCTL 3H7PA 1NEKB 5L95C 4HRSA 3RI7C 1CJEA 4K3CA 3U2SC 1HTOA 1HE8A 1IBXB 4FN2A 5MPOA 1RWSA 1B9RA 4HWIB 4JQWC 3M95A 3DCGA 1WYWB 1SJED 2C7NB 4ZYSA 3AU4A 3Q6BA 3PRPB 5C1ZA 4WAAA 1ZP0B 2O6VA 1GNUA 4RGMA 2KN4A 4MDKE 2I1KA 4S0RA 2PPHA 4FJZA 2OJRA 4HROA 4KIKA 2IO3B 4JWSC 1WM2A 5KHQA 3U8ZA 1KJTA 1E7UA 4MGKE 1NDDA 2WXMA 1N5WA 1SF0A 3WCQA 2R2OA 2BWFA 1SJHD 2KN5A 4YTNB 2DZMA 1P7FA 3W1YA 2GBJA 1UNSA 5LNK1 1WGDA 4A55A 1HTQA 5AZGA 4DXFA 3W5VB 4HVBA 3IAM1 1J7BA 4A90A 3VQIA 4GDKA 1CK1A 3EUB2 5TSSA 3ZXRA 1KFYB 2K5PA 3W5UB 1KF6B 3PPAA 1WXAA 1SGHA 4GGQA 3ZUNA 3PHWB 2C7HA 2DYBA 2KXJA 2WWZA 1GC6A
chains in the Genus database with same CATH topology
1XD3B 2D07B 4K1RB 4ZRJA 4WQOB 1WY8A 2BF8B 2K6DB 2ZJDA 4DK5A 3V61A 1VCBA 4AJYB 4IM3A 2N9PC 4W9IA 2DAFA 4EUTA 2KX0A 2JWZA 3QC8B 3CSFA 1H4RA 2LGXA 1WR6E 4BOZB 3NHEB 5LXIB 2KK8A 3KVFB 3APDA 3EC8A 5E6PA 5DCNA 1WX8A 4HPLB 1SIFA 4IG7B 2G4SA 4GDKB 3WA0A 5BO4B 5J17A 4K7SA 3VTVA 4B6WA 2QHOA 3L08A 1M94A 2FCQA 1WX9A 3H7PB 2DZIA 1ZKHA 5JH5C 2K8HA 3JW0X 2KVRA 2NS5A 1OQYA 2KFJA 1SE9A 4NJ7A 5LLIA 1I42A 4OVUA 3TIXA 2N1VA 2Z0EB 2L8JA 2N4FA 2BKRB 4K7WA 2CHZA 2LXCA 3PRZA 4I6NB 4II2B 4DBGA 2HD5B 2DYMA 1V2YA 3N3KB 4F7ZA 2KZRA 2D10A 4G50A 2MX2A 3DBRI 2JT4B 1EF1A 2Z59B 4KDLB 3UQAA 4MGYE 1WXSA 1Q5WB 2WDTB 3WIMA 2XK5B 4FLHA 3TJPA 1J19A 2C7MB 3TMPB 1WZ0A 2KJRA 2MRPA 4FULA 2L0FA 3UQBA 3QARA 3U7DA 4IWPA 3ZRCA 2C60A 2MA9B 3HM6X 2NBVB 3GOEA 4AP4C 4ZRIA 4DDGD 4TQ0A 3D32A 3LJ3A 2V4LA 3B1LX 3AI5A 4X57B 5CX3A 3M3JA 1E7VA 3EECA 2KTFA 1H8CA 2JRIB 3KUDB 4G0NB 3P2BA 1WGYA 3KW5B 4ANWA 3ML8A 1UD7A 1KM7A 2BGFA 2ZNVC 2CS4A 3AULA 2LRUA 2LWPA 1TGZB 3A9KA 3PHXB 3PV1A 3V6CB 3DPDA 4KSKC 3VH4B 3PLUA 4HCNB 2LD9A 2KX3A 4BKSD 3PGEA 4F1SA 4GXBA 3L0WB 2IO1B 1D3ZA 3RZFA 3VUYA 2CU1A 2LXAA 4TUUA 4DHJB 2PE6B 4GB9A 2IY1B 2RR9A 1UGMA 2ZZPB 4FHKA 4DHZB 5C23A 1GUAB 1TBEA 2FCNA 4WWNA 3RD2A 4OVVA 3VTWA 3OAWA 4IUMB 2NR2A 2LRWA 1AARA 3T9LA 5D6JB 1YQBA 4BBNF 2N7EA 2K8BA 3T8MA 2KLGA 2OOBB 1OEYA 5D94A 3KH0A 2GMIC 4A20A 1KLVA 1ZGUB 1GJZA 2KFKA 1G6JA 2HJ8A 3UINB 4PYUA 3QA8A 4GIVA 3VUWA 4MH0E 5JZEB 4ZRKA 3DVGX 3H1UA 2B3AA 3NOBA 3TL5A 3DVNV 1P1AA 2A5UA 4M8MA 4IM0A 3A9JB 4HDQA 5AEKB 2MQJA 3IG3A 1LFDA 2JZZA 2JRHA 4BKTA 4CHKA 1TZ1A 4HLEA 5FR6A 3QQ8B 2FNJB 2CR5A 4N9F4 3M62B 3HIZA 2KANA 3A1QB 4W9JA 2G3QB 3DOWA 1U4AA 2M8SA 3OLMD 2KMAA 4A3PA 2FUHB 3MJWA 2FCMA 3ZVVA 4W9CA 4PYZA 2AL6A 4LJPB 2IO2B 1GC7A 4K7UA 3ZNZB 2O2VB 1Q0WB 1YD8U 1YIWA 3B08A 4KZ0A 1R4NI 4AOFA 3DBSA 3RULA 4AWJA 3PS6A 4IWQA 4MELA 2MBOA 4HXDA 4AJWA 1UBIA 1A5RA 2ASQA 3ZDTA 4TKNA 3APFA 3NS8A 4KV2A 4WJPA 2LVQA 1EF5A 1QZEA 1TTNA 2LI5A 4W9HA 4I6PA 2XBBC 4E71A 2LGYA 2KTRB 3HK0A 2V3SA 2ZCCA 2GBRA 1V86A 4IC7B 2UWQA 1BT0A 1WMHA 3QX1A 3ZDMC 2JXXA 4W9GA 5AZHA 2D2QA 1S1QB 1VD2A 2JZ3B 3RCZA 3AU5A 4KDIC 2D3GA 4I6LB 3R7QA 3ZNID 1Z5SB 2JY6A 2NVUI 4TQ1A 2O6VB 4WWOA 4NQLB 5CHVC 1LQBA 2BYVE 1UH6A 2MBEA 4W9KA 3JSVB 3NY5A 4FBJB 2N1WA 4E3CA 2MP2A 3S2AA 3W1SA 2MBHA 4G11A 3ALBA 5CHWA 1C1YB 1V5TA 5GMVA 1Y8RC 1WX7A 4BFRA 3QCAA 2C5LC 1WIAA 4EFOA 3VXWA 4HPMB 4EKUA 4B9KA 1V9JA 3A1QA 2MP2B 1R4MI 3EFUA 2FIFA 2KJHB 3DDCB 3UF8A 2DYOA 3JSVA 1LXDA 3H9DA 1P3QU 2KQSA 2YLMA 3RT3B 3VFKA 4M8NA 5IAAC 1K8RB 3EHVA 3HHMA 3UIOB 1J0GA 2MSED 1YJ1A 3V60A 2G45B 1RFAA 1EUVB 2K25A 2ZCBA 5JHAA 3ZLZA 2FCSA 2LGDA 2RD0A 4URKA 4E74A 1WRDB 3QWZB 2L05A 3BY4B 4TV3A 3JYUA 2K8CA 3O65B 3SDLC 1NBFC 3SHQA 4IW0A 2IZVB 4XC2A 4EZLA 1E8ZA 5LXHA 5J18A 2EKEC 2J0MA 4JL9A 2N9XA 2BPSA 2NBWB 2ZEQA 3ZTCA 1WR1A 4K81A 2J0JA 4MGZE 1IP9A 2KWUB 4B95A 4A3OA 3DBHI 1Z2MA 2KDBA 4W9LA 4CO7A 2DHZA 4AUQC 2MW5A 4FJYA 1WJ4A 1UELA 2A4ZA 2DX5B 4JIOU 5D2MB 3VAWA 2KWVB 4PS7A 3V6EB 3W1SC 1P9DU 2L76A 2M0XA 4WWPA 3RYTA 3B0AA 5E6OA 2IYDB 3OJ3A 2AWTA 2G4DB 2LASA 2AEHA 2C9WB 2ZVNA 1UZXB 3K9PB 1IYFA 3VTUA 1WM3A 3NZUA 2KDFB 5J2RA 3UGBB 4ANXA 3MHSD 3ML9A 2VRRB 3X23A 2IBIB 4EZKA 3WAOA 4MJSB 4BBNC 4EOYA 1C3TA 3PT2B 3WALA 2DZKA 3DBLI 4II3B 3H7SA 5DPSA 3WANA 3ZRFA 4BVUC 2KC1A 2KD0A 3ZNGC 1V6EA 2LVPA 2PE9A 3ZKJC 3V62A 1ISNA 4BOSC 4HK2A 1FXTB 4NNJB 2KHWB 1E8YA 4KSLC 2ZNVB 1WGHA 3CSTA 2Z0DB 3QJZA 2WX0A 5E6NA 1JRUA 1L2NA 2L0TA 1V80A 2EMTA 2NBUA 4MSQB 3KUZA 2JUOA 2YVCA 2XK5A 3ZW3A 3SD5A 5CHFA 4NJ6A 3SU8X 1T0YA 2MWSB 2L3ZA 4LDTB 2J7QB 5D7GA 1WJUA 1P98A 1WF9A 3I3TB 1OGWA 1WGGA 1WI0A 2N9EB 3A4RA 3WAMA 3GZNI 1P0RA 4FADA 3M63B 3TBLD 3IFWB 4LCDE 4JGHB 1EO6A 3CF6E 1WXVA 3H6NA 1WZ3A 3PTFC 2MCNB 1WFYA 2NCNA 3LDZE 3VVWB 2GOWA 3NZSA 3A9KB 2AYOB 1WGRA 2RSUA 4GN1A 2DZJA 2R2QA 4JLCA 2CHXA 3JVZX 4NQKE 4ZYNA 3VUXA 2ZPNA 3ZO5B 3TCAA 3DVNU 4G3XB 3U30A 3ENEA 4FA6A 4CYEA 2BWES 4WJQA 4ICVA 2L7RA 4DHJD 2J0KA 4W9DA 2GBMA 1LM8B 5G2NA 1RAXA 4ANVA 3OJ4B 4W9FA 2DAJA 1V81A 3K9OB 5JHBA 5AZFA 5TR5A 2KDIA 3BINA 2HE7A 1E90A 4P7IA 4DXAB 4DDID 3PSEB 4HDOA 2M17A 2K6QA 3A9JA 3AXCA 2GBNA 3L10B 2KNBA 2JPHA 3MTNB 4FJVB 3VHTC 2LZ6A 4EZJA 4GOCA 4DWFA 2MBBB 1WE6A 3APCA 3ONSA 5L83A 1KOTA 5G55A 4RM9A 1XT9B 3R3MA 1WE7A 3ZTDA 4IWOA 4WJOA 1J8CA 2LJ5A 2ZPYA 5CTRC 2N7DA 2KMCA 4YL8A 2GBKA 3Q3JA 1XQQA 1I35A 1OEYJ 3QK0A 3A33B 5DPRA 1E5WA 3IBEA 2NPTB 3PREA 4LDTD 4GDLB 4NAWA 1RRBA 2M1MA 1RLFA 2KKCA 3A4SC 3N30A 4MJSA 4PS3A 2Y5BB 2WX1A 4PS8A 2FAZA 3R7RA 1L7YA 2PEAA 4IM2A 5DPWA 4XZ4A 4RM8A 4KVGB 4F8CB 3H7PA 5L95C 2KO3A 5IA7A 4BKSA 4MEMA 4LJOB 2RPQA 1V49A 1HE8A 3L13A 4ASWC 1ZW7A 1Q1OA 2K39A 4FN2A 1F9JA 3CMMB 2KWCA 2ZVOA 4HWIB 3M95A 3DCGA 4HCPB 1WYWB 2KLCA 4JQWC 4WJNA 2PJHA 4ANUA 2C7NB 3N32A 4GMVA 1OTRB 4MSMB 3AU4A 3PRPB 3X0WA 5C1ZA 4WAAA 2EMSA 5HKHA 2JVCA 1IPGA 1GNUA 2O6VA 4ICUA 3ECIA 4NAWB 3ZIMA 5EDSA 2REXA 1YX5B 1CMXB 2UYZB 2MLBA 4GDLA 2FIDA 2MBQA 2JF5A 4MDKE 2LVOA 3L54A 3PLVA 2I1KA 4KIKB 3PZDA 2L00B 4MM3A 4GSWA 2KFKB 1WMHB 3R66C 2AL3A 2DENB 4RMAA 1WXMA 2KOXA 2PPHA 3VH3B 2IY0B 4FJZA 2OJRA 2KTRA 4M0WB 4KIKA 3L17A 4NY0A 2V1YA 3PRMB 2IO3B 3KYCD 3IVFA 3KUCB 4KZCA 1WM2A 2BKFA 5KHQA 3U8ZA 4FHJA 1KJTA 1E7UA 5DPTA 3UIPB 2M4NA 2KQ7A 4MGKE 3WAPA 3VDZA 1NDDA 2HTHA 1MG8A 2O6VD 4MGIE 3ZNHB 4DHZE 2I1JA 3KYDD 2R2OA 2O2VA 1X1MA 2BWFA 2BYEA 2KN5A 2K1FA 4BKGA 1WJNA 2CHWA 2WYQA 4EEWA 2CKHB 1WJ6A 2DZMA 1PQSA 2KC2A 4GU2A 2KJ6A 1UBQA 3W1YA 2GBJA 1WGDA 5AZGA 1WH3A 1GG3A 1YX6B 3QHTA 3IHPC 4ZDVA 4HVBA 1S3SG 3RZWC 3QIJA 2D11A 2IO0B 3L16A 1E8XA 2NPTA 3PVLA 4GDKA 3VQIA 3Q3FA 3HM3A 2LUEA 3PPAA 4NPNA 1WXAA 1SGHA 3QAQA 4W9EA 2XEWA 4GGQA 4J6IA 2W9NA 2RGFA 3ZUNA 3PHWB 1V5OA 3DQVA 4XX5A 2BYFA 3C0RB 3DVGY 1NI2A 2C7HA 2DYBA 2KXJA 2WWZA 4HJKA 2KDEB 5KHOA 1GC6A 1E8WA 3RUIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XD3 B;  2D07 B;  4K1R B;  4ZRJ A;  4WQO B;  1WY8 A;  2BF8 B;  2K6D B;  2ZJD A;  4DK5 A;  3V61 A;  1VCB A;  4AJY B;  4IM3 A;  2N9P C;  4W9I A;  2DAF A;  4EUT A;  2KX0 A;  2JWZ A;  3QC8 B;  3CSF A;  1H4R A;  2LGX A;  1WR6 E;  4BOZ B;  3NHE B;  5LXI B;  2KK8 A;  3KVF B;  3APD A;  3EC8 A;  5E6P A;  5DCN A;  1WX8 A;  4HPL B;  1SIF A;  4IG7 B;  2G4S A;  4GDK B;  3WA0 A;  5BO4 B;  5J17 A;  4K7S A;  3VTV A;  4B6W A;  2QHO A;  3L08 A;  1M94 A;  2FCQ A;  1WX9 A;  3H7P B;  2DZI A;  1ZKH A;  5JH5 C;  2K8H A;  3JW0 X;  2KVR A;  2NS5 A;  1OQY A;  2KFJ A;  1SE9 A;  4NJ7 A;  5LLI A;  1I42 A;  4OVU A;  3TIX A;  2N1V A;  2Z0E B;  2L8J A;  2N4F A;  2BKR B;  4K7W A;  2CHZ A;  2LXC A;  3PRZ A;  4I6N B;  4II2 B;  4DBG A;  2HD5 B;  2DYM A;  1V2Y A;  3N3K B;  4F7Z A;  2KZR A;  2D10 A;  4G50 A;  2MX2 A;  3DBR I;  2JT4 B;  1EF1 A;  2Z59 B;  4KDL B;  3UQA A;  4MGY E;  1WXS A;  1Q5W B;  2WDT B;  3WIM A;  2XK5 B;  4FLH A;  3TJP A;  1J19 A;  2C7M B;  3TMP B;  1WZ0 A;  2KJR A;  2MRP A;  4FUL A;  2L0F A;  3UQB A;  3QAR A;  3U7D A;  4IWP A;  3ZRC A;  2C60 A;  2MA9 B;  3HM6 X;  2NBV B;  3GOE A;  4AP4 C;  4ZRI A;  4DDG D;  4TQ0 A;  3D32 A;  3LJ3 A;  2V4L A;  3B1L X;  3AI5 A;  4X57 B;  5CX3 A;  3M3J A;  1E7V A;  3EEC A;  2KTF A;  1H8C A;  2JRI B;  3KUD B;  4G0N B;  3P2B A;  1WGY A;  3KW5 B;  4ANW A;  3ML8 A;  1UD7 A;  1KM7 A;  2BGF A;  2ZNV C;  2CS4 A;  3AUL A;  2LRU A;  2LWP A;  1TGZ B;  3A9K A;  3PHX B;  3PV1 A;  3V6C B;  3DPD A;  4KSK C;  3VH4 B;  3PLU A;  4HCN B;  2LD9 A;  2KX3 A;  4BKS D;  3PGE A;  4F1S A;  4GXB A;  3L0W B;  2IO1 B;  1D3Z A;  3RZF A;  3VUY A;  2CU1 A;  2LXA A;  4TUU A;  4DHJ B;  2PE6 B;  4GB9 A;  2IY1 B;  2RR9 A;  1UGM A;  2ZZP B;  4FHK A;  4DHZ B;  5C23 A;  1GUA B;  1TBE A;  2FCN A;  4WWN A;  3RD2 A;  4OVV A;  3VTW A;  3OAW A;  4IUM B;  2NR2 A;  2LRW A;  1AAR A;  3T9L A;  5D6J B;  1YQB A;  4BBN F;  2N7E A;  2K8B A;  3T8M A;  2KLG A;  2OOB B;  1OEY A;  5D94 A;  3KH0 A;  2GMI C;  4A20 A;  1KLV A;  1ZGU B;  1GJZ A;  2KFK A;  1G6J A;  2HJ8 A;  3UIN B;  4PYU A;  3QA8 A;  4GIV A;  3VUW A;  4MH0 E;  5JZE B;  4ZRK A;  3DVG X;  3H1U A;  2B3A A;  3NOB A;  3TL5 A;  3DVN V;  1P1A A;  2A5U A;  4M8M A;  4IM0 A;  3A9J B;  4HDQ A;  5AEK B;  2MQJ A;  3IG3 A;  1LFD A;  2JZZ A;  2JRH A;  4BKT A;  4CHK A;  1TZ1 A;  4HLE A;  5FR6 A;  3QQ8 B;  2FNJ B;  2CR5 A;  4N9F 4;  3M62 B;  3HIZ A;  2KAN A;  3A1Q B;  4W9J A;  2G3Q B;  3DOW A;  1U4A A;  2M8S A;  3OLM D;  2KMA A;  4A3P A;  2FUH B;  3MJW A;  2FCM A;  3ZVV A;  4W9C A;  4PYZ A;  2AL6 A;  4LJP B;  2IO2 B;  1GC7 A;  4K7U A;  3ZNZ B;  2O2V B;  1Q0W B;  1YD8 U;  1YIW A;  3B08 A;  4KZ0 A;  1R4N I;  4AOF A;  3DBS A;  3RUL A;  4AWJ A;  3PS6 A;  4IWQ A;  4MEL A;  2MBO A;  4HXD A;  4AJW A;  1UBI A;  1A5R A;  2ASQ A;  3ZDT A;  4TKN A;  3APF A;  3NS8 A;  4KV2 A;  4WJP A;  2LVQ A;  1EF5 A;  1QZE A;  1TTN A;  2LI5 A;  4W9H A;  4I6P A;  2XBB C;  4E71 A;  2LGY A;  2KTR B;  3HK0 A;  2V3S A;  2ZCC A;  2GBR A;  1V86 A;  4IC7 B;  2UWQ A;  1BT0 A;  1WMH A;  3QX1 A;  3ZDM C;  2JXX A;  4W9G A;  5AZH A;  2D2Q A;  1S1Q B;  1VD2 A;  2JZ3 B;  3RCZ A;  3AU5 A;  4KDI C;  2D3G A;  4I6L B;  3R7Q A;  3ZNI D;  1Z5S B;  2JY6 A;  2NVU I;  4TQ1 A;  2O6V B;  4WWO A;  4NQL B;  5CHV C;  1LQB A;  2BYV E;  1UH6 A;  2MBE A;  4W9K A;  3JSV B;  3NY5 A;  4FBJ B;  2N1W A;  4E3C A;  2MP2 A;  3S2A A;  3W1S A;  2MBH A;  4G11 A;  3ALB A;  5CHW A;  1C1Y B;  1V5T A;  5GMV A;  1Y8R C;  1WX7 A;  4BFR A;  3QCA A;  2C5L C;  1WIA A;  4EFO A;  3VXW A;  4HPM B;  4EKU A;  4B9K A;  1V9J A;  3A1Q A;  2MP2 B;  1R4M I;  3EFU A;  2FIF A;  2KJH B;  3DDC B;  3UF8 A;  2DYO A;  3JSV A;  1LXD A;  3H9D A;  1P3Q U;  2KQS A;  2YLM A;  3RT3 B;  3VFK A;  4M8N A;  5IAA C;  1K8R B;  3EHV A;  3HHM A;  3UIO B;  1J0G A;  2MSE D;  1YJ1 A;  3V60 A;  2G45 B;  1RFA A;  1EUV B;  2K25 A;  2ZCB A;  5JHA A;  3ZLZ A;  2FCS A;  2LGD A;  2RD0 A;  4URK A;  4E74 A;  1WRD B;  3QWZ B;  2L05 A;  3BY4 B;  4TV3 A;  3JYU A;  2K8C A;  3O65 B;  3SDL C;  1NBF C;  3SHQ A;  4IW0 A;  2IZV B;  4XC2 A;  4EZL A;  1E8Z A;  5LXH A;  5J18 A;  2EKE C;  2J0M A;  4JL9 A;  2N9X A;  2BPS A;  2NBW B;  2ZEQ A;  3ZTC A;  1WR1 A;  4K81 A;  2J0J A;  4MGZ E;  1IP9 A;  2KWU B;  4B95 A;  4A3O A;  3DBH I;  1Z2M A;  2KDB A;  4W9L A;  4CO7 A;  2DHZ A;  4AUQ C;  2MW5 A;  4FJY A;  1WJ4 A;  1UEL A;  2A4Z A;  2DX5 B;  4JIO U;  5D2M B;  3VAW A;  2KWV B;  4PS7 A;  3V6E B;  3W1S C;  1P9D U;  2L76 A;  2M0X A;  4WWP A;  3RYT A;  3B0A A;  5E6O A;  2IYD B;  3OJ3 A;  2AWT A;  2G4D B;  2LAS A;  2AEH A;  2C9W B;  2ZVN A;  1UZX B;  3K9P B;  1IYF A;  3VTU A;  1WM3 A;  3NZU A;  2KDF B;  5J2R A;  3UGB B;  4ANX A;  3MHS D;  3ML9 A;  2VRR B;  3X23 A;  2IBI B;  4EZK A;  3WAO A;  4MJS B;  4BBN C;  4EOY A;  1C3T A;  3PT2 B;  3WAL A;  2DZK A;  3DBL I;  4II3 B;  3H7S A;  5DPS A;  3WAN A;  3ZRF A;  4BVU C;  2KC1 A;  2KD0 A;  3ZNG C;  1V6E A;  2LVP A;  2PE9 A;  3ZKJ C;  3V62 A;  1ISN A;  4BOS C;  4HK2 A;  1FXT B;  4NNJ B;  2KHW B;  1E8Y A;  4KSL C;  2ZNV B;  1WGH A;  3CST A;  2Z0D B;  3QJZ A;  2WX0 A;  5E6N A;  1JRU A;  1L2N A;  2L0T A;  1V80 A;  2EMT A;  2NBU A;  4MSQ B;  3KUZ A;  2JUO A;  2YVC A;  2XK5 A;  3ZW3 A;  3SD5 A;  5CHF A;  4NJ6 A;  3SU8 X;  1T0Y A;  2MWS B;  2L3Z A;  4LDT B;  2J7Q B;  5D7G A;  1WJU A;  1P98 A;  1WF9 A;  3I3T B;  1OGW A;  1WGG A;  1WI0 A;  2N9E B;  3A4R A;  3WAM A;  3GZN I;  1P0R A;  4FAD A;  3M63 B;  3TBL D;  3IFW B;  4LCD E;  4JGH B;  1EO6 A;  3CF6 E;  1WXV A;  3H6N A;  1WZ3 A;  3PTF C;  2MCN B;  1WFY A;  2NCN A;  3LDZ E;  3VVW B;  2GOW A;  3NZS A;  3A9K B;  2AYO B;  1WGR A;  2RSU A;  4GN1 A;  2DZJ A;  2R2Q A;  4JLC A;  2CHX A;  3JVZ X;  4NQK E;  4ZYN A;  3VUX A;  2ZPN A;  3ZO5 B;  3TCA A;  3DVN U;  4G3X B;  3U30 A;  3ENE A;  4FA6 A;  4CYE A;  2BWE S;  4WJQ A;  4ICV A;  2L7R A;  4DHJ D;  2J0K A;  4W9D A;  2GBM A;  1LM8 B;  5G2N A;  1RAX A;  4ANV A;  3OJ4 B;  4W9F A;  2DAJ A;  1V81 A;  3K9O B;  5JHB A;  5AZF A;  5TR5 A;  2KDI A;  3BIN A;  2HE7 A;  1E90 A;  4P7I A;  4DXA B;  4DDI D;  3PSE B;  4HDO A;  2M17 A;  2K6Q A;  3A9J A;  3AXC A;  2GBN A;  3L10 B;  2KNB A;  2JPH A;  3MTN B;  4FJV B;  3VHT C;  2LZ6 A;  4EZJ A;  4GOC A;  4DWF A;  2MBB B;  1WE6 A;  3APC A;  3ONS A;  5L83 A;  1KOT A;  5G55 A;  4RM9 A;  1XT9 B;  3R3M A;  1WE7 A;  3ZTD A;  4IWO A;  4WJO A;  1J8C A;  2LJ5 A;  2ZPY A;  5CTR C;  2N7D A;  2KMC A;  4YL8 A;  2GBK A;  3Q3J A;  1XQQ A;  1I35 A;  1OEY J;  3QK0 A;  3A33 B;  5DPR A;  1E5W A;  3IBE A;  2NPT B;  3PRE A;  4LDT D;  4GDL B;  4NAW A;  1RRB A;  2M1M A;  1RLF A;  2KKC A;  3A4S C;  3N30 A;  4MJS A;  4PS3 A;  2Y5B B;  2WX1 A;  4PS8 A;  2FAZ A;  3R7R A;  1L7Y A;  2PEA A;  4IM2 A;  5DPW A;  4XZ4 A;  4RM8 A;  4KVG B;  4F8C B;  3H7P A;  5L95 C;  2KO3 A;  5IA7 A;  4BKS A;  4MEM A;  4LJO B;  2RPQ A;  1V49 A;  1HE8 A;  3L13 A;  4ASW C;  1ZW7 A;  1Q1O A;  2K39 A;  4FN2 A;  1F9J A;  3CMM B;  2KWC A;  2ZVO A;  4HWI B;  3M95 A;  3DCG A;  4HCP B;  1WYW B;  2KLC A;  4JQW C;  4WJN A;  2PJH A;  4ANU A;  2C7N B;  3N32 A;  4GMV A;  1OTR B;  4MSM B;  3AU4 A;  3PRP B;  3X0W A;  5C1Z A;  4WAA A;  2EMS A;  5HKH A;  2JVC A;  1IPG A;  1GNU A;  2O6V A;  4ICU A;  3ECI A;  4NAW B;  3ZIM A;  5EDS A;  2REX A;  1YX5 B;  1CMX B;  2UYZ B;  2MLB A;  4GDL A;  2FID A;  2MBQ A;  2JF5 A;  4MDK E;  2LVO A;  3L54 A;  3PLV A;  2I1K A;  4KIK B;  3PZD A;  2L00 B;  4MM3 A;  4GSW A;  2KFK B;  1WMH B;  3R66 C;  2AL3 A;  2DEN B;  4RMA A;  1WXM A;  2KOX A;  2PPH A;  3VH3 B;  2IY0 B;  4FJZ A;  2OJR A;  2KTR A;  4M0W B;  4KIK A;  3L17 A;  4NY0 A;  2V1Y A;  3PRM B;  2IO3 B;  3KYC D;  3IVF A;  3KUC B;  4KZC A;  1WM2 A;  2BKF A;  5KHQ A;  3U8Z A;  4FHJ A;  1KJT A;  1E7U A;  5DPT A;  3UIP B;  2M4N A;  2KQ7 A;  4MGK E;  3WAP A;  3VDZ A;  1NDD A;  2HTH A;  1MG8 A;  2O6V D;  4MGI E;  3ZNH B;  4DHZ E;  2I1J A;  3KYD D;  2R2O A;  2O2V A;  1X1M A;  2BWF A;  2BYE A;  2KN5 A;  2K1F A;  4BKG A;  1WJN A;  2CHW A;  2WYQ A;  4EEW A;  2CKH B;  1WJ6 A;  2DZM A;  1PQS A;  2KC2 A;  4GU2 A;  2KJ6 A;  1UBQ A;  3W1Y A;  2GBJ A;  1WGD A;  5AZG A;  1WH3 A;  1GG3 A;  1YX6 B;  3QHT A;  3IHP C;  4ZDV A;  4HVB A;  1S3S G;  3RZW C;  3QIJ A;  2D11 A;  2IO0 B;  3L16 A;  1E8X A;  2NPT A;  3PVL A;  4GDK A;  3VQI A;  3Q3F A;  3HM3 A;  2LUE A;  3PPA A;  4NPN A;  1WXA A;  1SGH A;  3QAQ A;  4W9E A;  2XEW A;  4GGQ A;  4J6I A;  2W9N A;  2RGF A;  3ZUN A;  3PHW B;  1V5O A;  3DQV A;  4XX5 A;  2BYF A;  3C0R B;  3DVG Y;  1NI2 A;  2C7H A;  2DYB A;  2KXJ A;  2WWZ A;  4HJK A;  2KDE B;  5KHO A;  1GC6 A;  1E8W A;  3RUI B; 
#chains in the Genus database with same CATH topology
 3NZ3 A;  1XO3 A;  4K1R B;  1WY8 A;  2BF8 B;  2K6D B;  2ZJD A;  4DK5 A;  3V61 A;  1I4X A;  2KDM A;  2KX0 A;  3QC8 B;  1H4R A;  5IN7 A;  3APD A;  1TJE A;  5DCN A;  5BMG A;  4YXD B;  2ONQ A;  2G4S A;  3WA0 A;  1YNT E;  2W55 A;  4K7S A;  5G5H A;  4B6W A;  1M94 A;  1F77 A;  2FCQ A;  2SEB D;  3H7P B;  1T3Q A;  5JH5 C;  2K8H A;  1UWX A;  2NS5 A;  3H8H A;  3AEA B;  2W3R A;  1AW7 A;  1SE9 A;  4OVU A;  3TIX A;  2L8J A;  2CHZ A;  2N9K A;  3PRZ A;  2DYM A;  3DHG C;  2D10 A;  3LYY A;  2V4I B;  2MX2 A;  4KDL B;  3AN1 A;  4FLH A;  2C7M B;  1WZ0 A;  2KJR A;  2L0F A;  4A6Q A;  2RMM A;  4TQ0 A;  3D32 A;  4X57 B;  3MJ5 A;  3M3J A;  4ZRP A;  2LJI A;  1E7P B;  1EU4 A;  3HVD A;  4ANW A;  3SR6 A;  3AE6 B;  3ML8 A;  1TS3 A;  2MJE A;  3V6C B;  2H88 B;  3VH4 B;  2LD9 A;  4LNO A;  3RN9 C;  4GXB A;  3DBR B;  2IO1 B;  2WDQ B;  2CU1 A;  1IBX A;  2PE6 B;  4N58 A;  1UGM A;  5IO9 A;  1TBE A;  4OVV A;  1ET9 A;  3DWG C;  5D3I B;  3T9L A;  1YQB A;  1MHH E;  3DHH C;  2VZK B;  3T8M A;  3KH0 A;  3P4R B;  3RNA C;  1KLV A;  2J42 A;  1ESF A;  1G6J A;  2HJ8 A;  3UIN B;  5HG2 A;  1NEN B;  2EEL A;  4ZRK A;  2B3A A;  4IM0 A;  3ZYY X;  3A9J B;  4HDQ A;  5AEK B;  1DOI A;  2LEK A;  1LFD A;  2JZZ A;  4HLE A;  4N9F 4;  2TSS A;  4XDD A;  3M62 B;  3HIZ A;  2G3Q B;  3DOW A;  3C19 A;  1U4A A;  3OLM D;  2KMA A;  4A3P A;  1I4H A;  2AL6 A;  1Q0W B;  1FPY A;  1R4N I;  1XCQ L;  3RUL A;  2MBO A;  4HXD A;  4NZL B;  1MPE A;  3APF A;  3NS1 A;  4KV2 A;  3Q3O C;  4WJP A;  1QZE A;  4W9H A;  4I6P A;  2B76 B;  3FC4 A;  4L23 A;  4XE0 A;  4YTP B;  3HK0 A;  2V3S A;  2ICI A;  2D3B A;  2XN9 C;  2E3T A;  1WMH A;  3ZDM C;  4W9G A;  1D5M C;  4KDI C;  1MJD A;  3R7Q A;  2JY6 A;  2NVU I;  4WWO A;  4NQL B;  2BYV E;  3ABV B;  1JW9 D;  2BW2 A;  4RGN A;  4FBJ B;  1FFV A;  1JCK B;  2IGH A;  3ALB A;  1C1Y B;  1WIA A;  4B9K A;  3OWE B;  4FXC A;  3AEF B;  2QMT A;  5EE1 A;  2DYO A;  1LXD A;  2KQS A;  4M8N A;  3HHM A;  1YJ1 A;  3UI3 A;  5JHA A;  3AE4 B;  1R4N B;  1WRD B;  2QCZ A;  3JYU A;  1ZPS A;  4XC2 A;  3SFD B;  3FKY A;  2WXF A;  5LXH A;  2EKE C;  2J0M A;  2N9X A;  2NBW B;  1WR1 A;  2J0J A;  1IP9 A;  2KWU B;  4A3O A;  3BK1 A;  4CO7 A;  1DOY A;  5D2M B;  2KWV B;  4PS7 A;  3NG0 A;  3OJ3 A;  2AWT A;  1GB4 A;  2ZVN A;  5AUK A;  2AEH A;  2C9W B;  4ZOH C;  2PTL A;  2BS3 B;  3VTU A;  4ANX A;  2VRR B;  3WAO A;  4RGO S;  2KC1 A;  2KD0 A;  3ZNG C;  2JU6 X;  2PE9 A;  3ZKJ C;  2X38 A;  1E8Y A;  1WGH A;  4IDI A;  2WX0 A;  2WXN A;  2L0T A;  4O1N A;  3ZQ4 A;  4XGA B;  2KVZ A;  3KUZ A;  1TS5 A;  3NUH B;  5CHF A;  3SU8 X;  3I63 C;  5D7G A;  1WJU A;  4M0W A;  1N63 A;  4OVZ A;  4MH8 A;  4FAD A;  3M63 B;  1YN5 A;  3IFW B;  1VLB A;  1WXV A;  1WFY A;  1XLQ A;  2NCN A;  3GZN B;  4USA A;  3AE3 B;  2QC8 A;  3NZS A;  2AYO B;  2DZJ A;  2R2Q A;  4JLC A;  2CHX A;  3VUX A;  3ZO5 B;  2FE8 A;  1FRR A;  2IGG A;  3LB8 C;  4G3X B;  3RFZ B;  2BWE S;  1RAX A;  1M4V A;  2DAJ A;  1V81 A;  4LNI A;  2DWQ A;  3BIN A;  3EFC A;  4DXA B;  4DDI D;  1WXQ A;  2WHI A;  3AXC A;  1TY2 A;  2KNB A;  3VR9 B;  4FJV B;  4EZJ A;  4GOC A;  4RM9 A;  1WE7 A;  1J8C A;  1RYJ A;  1Q10 A;  1ENF A;  1XQQ A;  3QK0 A;  1PUT A;  3IBE A;  3BVM A;  4P1C C;  2M56 B;  4PS3 A;  4IM2 A;  4RNA A;  5DPW A;  2J53 A;  4BKS A;  4KGS A;  1C4P A;  3L13 A;  1Q1O A;  1F9J A;  1K51 A;  2ZVO A;  4HCP B;  2JXT A;  4WJN A;  2PW9 A;  3U4E G;  1L5P A;  1QQR A;  1HEZ E;  1TZO A;  3X0W A;  2EMS A;  1IPG A;  3ECI A;  5EDS A;  2REX A;  2UYZ B;  4C4V A;  4GDL A;  2FID A;  2JF5 A;  2LVO A;  3PLV A;  4MM3 A;  2KFK B;  1WMH B;  4WWM A;  4M0W B;  1OQQ A;  3KUC B;  4KZC A;  2OHF A;  2D5G A;  2M4N A;  1AWD A;  1MG8 A;  2O6V D;  3ZNH B;  2I1J A;  1X1M A;  2JYE A;  2CU3 A;  3P4S B;  3V3X A;  3RNB C;  2KC2 A;  2BT6 A;  1WH3 A;  3Q8C A;  1QOA A;  1P7E A;  4XYC A;  4KKI A;  2NPT A;  1JRP A;  3QAQ A;  2W9N A;  4MT5 A;  1B1Z A;  4MM3 B;  2BYF A;  2IPK D;  1WSP A;  3VR8 B;  2WS3 B;  1K53 A;  1EWC A;  5KHO A;  3VRB B;  3RNE C;  4C00 A;  3EA6 A;  4ZRJ A;  3AH7 A;  4XDC A;  2DNF A;  4AJY B;  4P1B C;  1C77 A;  2LGX A;  5H92 C;  3EC8 A;  1WX8 A;  4HPL B;  1JWA D;  1SIF A;  4IG7 B;  5J17 A;  3OG5 A;  1BXT A;  2DZI A;  1ZKH A;  1HQR D;  2KVR A;  4C56 C;  5LLI A;  1VRA B;  2N4F A;  3AEG B;  1GOZ A;  4II2 B;  3DBR I;  3KQ4 A;  3RPF C;  2Z59 B;  1WXS A;  1Q5W B;  2XK5 B;  3TJP A;  1XLP A;  1KTK A;  3SFE B;  3UQB A;  3QAR A;  4RF1 A;  3U7D A;  4IWP A;  3ZRC A;  3HM6 X;  2NBV B;  1PFD A;  3AI5 A;  5CX3 A;  3TEY A;  1L0X B;  3I5J C;  1H8C A;  1TT5 B;  2CJN A;  4G0N B;  3P2B A;  1SE2 A;  3KW5 B;  2PIA A;  3MFG A;  1TGZ B;  3PV1 A;  3DPD A;  5BMH A;  3PLU A;  4HCN B;  4F1S A;  2OJW A;  3L0W B;  1D3Z A;  3RZF A;  2FUG 1;  4HJG E;  2KQ4 X;  2IY1 B;  5EE3 A;  4DHZ B;  5C23 A;  3DHI C;  4LTU A;  4OZA A;  3AE2 B;  4IUM B;  1KRH A;  2NR2 A;  1XF5 L;  4BBN F;  2HDE A;  5D6J B;  2OED A;  2K8B A;  2KLG A;  2QIE B;  5D94 A;  1MG4 A;  1ZGU B;  2KFK A;  1KLG D;  1N62 A;  2WLB A;  4PYU A;  3KWL A;  4GIV A;  4MH0 E;  1V1O A;  3DVG X;  3NOB A;  3FIL B;  3BVZ A;  2L83 A;  3RMK C;  3MC9 A;  4D2K A;  2MQJ A;  3IG3 A;  3NVY A;  1D4B A;  4CHK A;  3Q14 C;  5FR6 A;  3A1Q B;  4W9J A;  2M8S A;  2FUH B;  3ZVV A;  4A9A A;  1YN4 A;  1T0R C;  5IOI A;  4W9C A;  1I4Q A;  2IO2 B;  4K7U A;  3T3O A;  1WYG A;  3DBS A;  2BB5 A;  5HHD G;  4IWQ A;  4AJW A;  1NVI D;  1VZ6 A;  2LVQ A;  2NMQ A;  1ZXI A;  2XBB C;  4E71 A;  2KTR B;  3NVZ A;  2UWQ A;  3QX1 A;  1A70 A;  2JXX A;  2IDY A;  2D3G A;  2NTS A;  4LK0 M;  1VJK A;  4B0E A;  2O6V B;  3AE7 B;  4KGT A;  5AUI A;  3PZ7 A;  4W9K A;  3JSV B;  4E3C A;  2MP2 A;  4G11 A;  1V5T A;  5GMV A;  4EFO A;  3A1Q A;  2Y3A A;  1R4M I;  1VZ7 A;  1T6B X;  1D6E C;  2FIF A;  3IT6 B;  5IAA C;  3UIO B;  1J0G A;  2MSE D;  3V60 A;  4ZRQ A;  2K25 A;  1N60 A;  1Y56 A;  2LGD A;  5C2T B;  4E74 A;  2AQ1 B;  3I57 A;  1SBB B;  2V9H A;  2WU2 B;  3QWZ B;  3BY4 B;  3SDL C;  3SHQ A;  4IW0 A;  4JWU C;  1QOF A;  4YT0 B;  2QIL A;  1FCL A;  4JL9 A;  4K81 A;  3RNF C;  4MGZ E;  1Z2M A;  1C4A A;  2DHZ A;  1WJ4 A;  1UEL A;  4WWP A;  4RGT A;  3W2D A;  2V3P A;  2G4D B;  2LAS A;  3K9P B;  3IAS 1;  1IYF A;  1WM3 A;  5J2R A;  3ML9 A;  3X23 A;  2E6X A;  2WDV B;  1F2R C;  4EOY A;  2LFI A;  3P42 A;  1V6E A;  4HK2 A;  3N9Y C;  1BML C;  3QJZ A;  2I2Y A;  1V80 A;  2EMT A;  4MSQ B;  2YVC A;  4AS1 A;  1TY0 A;  4NJ6 A;  1T0Y A;  2MWS B;  1WF9 A;  4TSS A;  1OGW A;  2AX5 A;  2SAK A;  3WAM A;  3GZN I;  1FXA A;  4M00 A;  1EO6 A;  3Q69 A;  2MCN B;  3VVW B;  2HTM E;  4GN1 A;  3A9K B;  2RSU A;  2BVC A;  2N9L A;  2D3A A;  3ENE A;  4WJQ A;  2ON8 A;  3GB1 A;  2J0K A;  4W9D A;  2GBM A;  1LM8 B;  3PZ8 A;  1CQV A;  4H2A A;  3OJ4 B;  3K9O B;  2WXJ A;  2HE7 A;  3N1Y C;  4HDO A;  3A9J A;  3AB5 A;  3MTN B;  1SSN A;  3VHT C;  1WE6 A;  3TSS A;  1L6V A;  3ONS A;  5G55 A;  3MC0 B;  3BVG A;  4WJO A;  3AMZ A;  4IWO A;  2ZPY A;  2KMC A;  4YL8 A;  1I35 A;  1OEY J;  2LGI A;  1E5W A;  2NPT B;  4GDL B;  4ZHO A;  2M1M A;  3A4S C;  3N30 A;  1JQ4 A;  4MJS A;  5IP4 D;  2WX1 A;  4KVG B;  2MEK A;  4MEM A;  1I4P A;  2PVG C;  3CIR B;  4ASW C;  4WQM A;  1ZW7 A;  1FEH A;  3CMM B;  2DBY A;  2KWC A;  2V3N A;  2QDF A;  1I7H A;  5BYS A;  2PJH A;  2IND C;  4KKJ A;  4ANU A;  3N32 A;  3AEB B;  1N5X A;  2G1E A;  1ZE3 D;  3C8Y A;  5HKH A;  4ICU A;  1FIQ A;  4NAW B;  3ZIM A;  1DYQ A;  1CMX B;  2MLB A;  2MBQ A;  3L54 A;  3RNC C;  1FNU A;  2DEN B;  4RMA A;  1WXM A;  4WAF A;  2IY0 B;  2KTR A;  1SB3 C;  2V1Y A;  3CWI A;  3KYC D;  1YN3 A;  2UU7 A;  2BKF A;  2WNM A;  1C76 A;  1FCC C;  1MVK A;  1L0Y B;  4FHJ A;  4LLG M;  5DPT A;  3UIP B;  5H8Y E;  3VDZ A;  2HTH A;  3W9C B;  4DHZ E;  3AEE B;  3KYD D;  2MHJ A;  2O2V A;  4YSZ B;  2BYE A;  1EU3 A;  2K1F A;  3PO0 A;  1WJN A;  4EEW A;  2CKH B;  4GU2 A;  2KJ6 A;  1GPX A;  1UBQ A;  1HA5 A;  1F0Z A;  1F1H A;  1PYW D;  1YQ3 B;  1GG3 A;  3IHP C;  4ZDV A;  3QIJ A;  3FIL A;  2IO0 B;  3L16 A;  3HRD D;  2MJ3 A;  3Q3F A;  1DGJ A;  2M0A A;  3DBL B;  3HM3 A;  2LUE A;  4NPN A;  4W9E A;  2XEW A;  2QJL A;  2RGF A;  4XX5 A;  3C0R B;  3DVG Y;  1NI2 A;  4HJK A;  4KSK C;  1E8W A;  1KH0 A;  3RUI B;  3Q3N C;  4WQO B;  4IM3 A;  4W9I A;  2DAF A;  1WR6 E;  3NHE B;  5LXI B;  2KK8 A;  2N7J A;  4GDK B;  5BO4 B;  4JE3 B;  3VTV A;  1D5Z C;  4JX1 C;  2QHO A;  1TKG A;  3L08 A;  1WX9 A;  3NRZ A;  2MH7 A;  2EKI A;  4N59 A;  1C79 A;  4WH4 A;  1I42 A;  4K7W A;  3NJT A;  3LXF A;  4DBG A;  1RM6 C;  2Y5P A;  1V8C A;  1V2Y A;  2KZR A;  1IGC A;  4G50 A;  1E10 A;  2JT4 B;  1EF1 A;  4MGY E;  4A8X C;  2WDT B;  3TMP B;  2W3S A;  4AP4 C;  4ZRI A;  2FBW B;  4B0M A;  2QEJ C;  2JRI B;  1WGY A;  1UD7 A;  2BGF A;  2ZNV C;  2CS4 A;  2LRU A;  2WGS A;  3A9K A;  3PHX B;  4HKZ E;  2YEP B;  1PGX A;  1XLO A;  4UDU C;  4BKS D;  3L4P A;  1L4Z B;  3HUI A;  3I9V 1;  4IOI E;  4ARC A;  1YJI A;  4DHJ B;  4GB9 A;  2ZZP B;  4FHK A;  4QAY A;  3U7Z A;  2FCN A;  4WWN A;  4RCO A;  3VTW A;  4KGR A;  1AAR A;  1OEY A;  1PGB A;  4NAM A;  4LNF A;  1TS2 A;  5EE0 A;  4A20 A;  1GJZ A;  2XNA C;  2YEP F;  5D3D A;  3QA8 A;  1JRO A;  3VUW A;  3AE5 B;  2N0S B;  3H1U A;  3TL5 A;  1P1A A;  3AV8 A;  3T3N A;  3IT4 B;  4LNN A;  1TZ1 A;  2CR5 A;  2M19 A;  2KAN A;  2X8X X;  2LHE A;  2BYT A;  1JWU D;  2FCM A;  3BWU D;  1I4G A;  4YSX B;  1GC7 A;  4KZ0 A;  1YIW A;  3TEX A;  5EE9 A;  1R7S A;  4AWJ A;  4ZHP A;  5G5G A;  2ASQ A;  1A5R A;  3ZDT A;  1D5X C;  3N20 C;  4S17 A;  3NS8 A;  5FKA C;  3MC8 A;  4GLS C;  1EF5 A;  5I4D A;  1ET6 A;  1TTN A;  2LGY A;  1IGD A;  2ZCC A;  2GBR A;  1R4M B;  1BT0 A;  2D2Q A;  1S1Q B;  2WU5 B;  3RCZ A;  3AU5 A;  4C4V B;  4I6L B;  1NI3 A;  3V05 A;  5CHV C;  1LQB A;  3R8B A;  1F2R I;  1UH6 A;  2MBE A;  1QLB B;  3NY5 A;  2N1W A;  4N6E B;  2MBH A;  4BFR A;  1WX7 A;  3QCA A;  3VXW A;  4HPM B;  4EKU A;  1V9J A;  2MP2 B;  2KJH B;  3JSV A;  2J4X A;  1FNW A;  2J52 A;  1J7C A;  1P3Q U;  2YLM A;  3RT3 B;  3ZJU A;  3EHV A;  1FNV A;  3B2G A;  4CQN A;  3ZLZ A;  2AQ3 B;  2FCS A;  2RD0 A;  4AQ7 A;  1JAL A;  2K8C A;  2JWU A;  1NBF C;  3ZJT A;  1V97 A;  4EZL A;  2BPS A;  2ZEQ A;  3ZTC A;  2K22 A;  4W9L A;  2MW5 A;  5BYR A;  2A4Z A;  3BZD B;  2DX5 B;  4JIO U;  3VAW A;  3GP7 A;  2JZP A;  1P9D U;  2L76 A;  3R2I A;  3RYT A;  2IYD B;  2WXG A;  2G9H D;  3ZGZ A;  1TKE A;  3NZU A;  2KDF B;  5BMI A;  3UGB B;  5GXG B;  1N61 A;  3DBL I;  4II3 B;  4BVU C;  2LVP A;  2BS4 B;  2LHD A;  1FM0 D;  5E6N A;  1L2N A;  1C4C A;  3SEB A;  2NBU A;  2CJO A;  2JUO A;  2W82 A;  1STE A;  3ZW3 A;  3SD5 A;  1MFW A;  3FAH A;  1HZ5 A;  2WXP A;  2L3Z A;  4RH6 A;  2WXH A;  4XWW A;  1WGG A;  1OQR A;  1WI0 A;  3N1Z C;  3CF6 E;  3H6N A;  1WZ3 A;  3PTF C;  3LDZ E;  1L4D B;  2K9X A;  2GOW A;  1WGR A;  4ZYN A;  3NVV A;  3TCA A;  3U52 E;  3DVN U;  1NYR A;  4YTM B;  4CYE A;  1TIF A;  2Q5W D;  4DHJ D;  3TUO A;  4ANV A;  4W9F A;  5JHB A;  2Z8L A;  3N1X C;  5TR5 A;  4NJC A;  1E90 A;  2BB6 A;  4P7I A;  2M17 A;  2K6Q A;  3BII D;  2GBN A;  1J7A A;  1TS4 A;  2JPH A;  1T0S C;  4DXG A;  4DWF A;  2DLB A;  3APC A;  2RDH A;  1KOT A;  1QOG A;  1XT9 B;  4US9 A;  1K52 A;  3ZTD A;  4TMA B;  4J3O D;  4HPP A;  2N7D A;  1HXY D;  3A33 B;  4LDT D;  1L6U A;  3PRE A;  4NAW A;  1RRB A;  2KKC A;  3KWV A;  3DBH B;  4PS8 A;  2FAZ A;  1L7Y A;  4F8C B;  3DWM A;  2KO3 A;  5IA7 A;  4LJO B;  2RPQ A;  2WDR B;  1V49 A;  1C78 A;  2K39 A;  1XEE A;  2KLC A;  1EM7 A;  2WXO A;  4GMV A;  1OTR B;  4MSM B;  2WXQ A;  4RFB A;  2KT7 A;  1ROE A;  1YJJ A;  2JVC A;  2BS2 B;  3IXS A;  1LGR A;  1YX5 B;  4KIK B;  3PZD A;  2L00 B;  3RNG C;  4GSW A;  3R66 C;  2AL3 A;  3VH3 B;  2KOX A;  4PT5 A;  3HVZ A;  3L17 A;  4NY0 A;  3PRM B;  2PMV A;  3ZXV A;  3IVF A;  1ZDV A;  1VDV A;  1AYF A;  2GLS A;  2KQ7 A;  3WAP A;  4MGI E;  2RDG A;  3P1M A;  4BKG A;  2CHW A;  2WYQ A;  1WJ6 A;  1PQS A;  3VRA B;  2INC C;  3KLS X;  1SEB D;  4L1B A;  3E56 A;  1L0V B;  1GB1 A;  1YX6 B;  3QHT A;  1HZ6 A;  1S3S G;  3P4P B;  3RZW C;  2D11 A;  1ZDX A;  3BK2 A;  1E8X A;  1WWT A;  3PVL A;  2INP E;  3EGR A;  5C3J B;  1SE3 A;  2L52 A;  1UF0 A;  4J6I A;  1V5O A;  2I38 A;  3DQV A;  1BUI C;  1FFU A;  2PVO D;  3ZJV A;  2KDE B;  1ISN A;  4C7Y A;  1XD3 B;  2D07 B;  1VCB A;  2N9P C;  2AQ2 B;  4EUT A;  2JWZ A;  3CSF A;  4BOZ B;  3TEZ A;  3KVF B;  5E6P A;  1E0Z A;  1F52 A;  3Q8A A;  4US8 A;  1ZXH A;  2WQY B;  1QT9 A;  4JPS A;  4DQO C;  3JW0 X;  2JX5 A;  4C80 A;  1OQY A;  2KFJ A;  1I4R A;  1GAQ B;  4NJ7 A;  2N1V A;  2WXK A;  2Z0E B;  3E9S A;  2BKR B;  2GB1 A;  2LXC A;  4I6N B;  2HD5 B;  4WUR A;  1CZP A;  3N3K B;  1VZ8 A;  4F7Z A;  2WP9 B;  2D3C A;  1T0Q C;  3UQA A;  3WIM A;  1J19 A;  2MRP A;  4FUL A;  2ACZ B;  1XLN A;  2C60 A;  2MA9 B;  4LNK A;  3GOE A;  4DDG D;  3LJ3 A;  3O13 A;  2V4L A;  3B1L X;  1FRD A;  2WXI A;  3B2F A;  1E7V A;  2PKO A;  2WXR A;  2KTF A;  3EEC A;  1SE4 A;  3KUD B;  1ZUD 2;  1KM7 A;  3Q8B A;  3AUL A;  4Q2J A;  2BQQ A;  3GE3 C;  2QSD A;  2LWP A;  5T8I A;  2KX3 A;  3PGE A;  1JWS D;  3VUY A;  1QKZ A;  4C7Z A;  2LXA A;  3ETR A;  2INN E;  4TUU A;  1ZOY B;  2RR9 A;  1E9M A;  1GUA B;  3RD2 A;  3OAW A;  2LRW A;  3AE9 B;  4OZB A;  4PK1 A;  2N7E A;  2JYT A;  2OOB B;  5HFY A;  1V1P A;  4ARI A;  2GMI C;  2LUM A;  5JZE B;  2LMC A;  4XWT A;  1QOB A;  3DVN V;  5IKC M;  2A5U A;  4M8M A;  2RPV A;  2JRH A;  4BKT A;  3Q8F A;  3QQ8 B;  2FNJ B;  2KAC A;  2Y5C A;  2L32 A;  1WGK A;  1YMH E;  3MJW A;  4PYZ A;  4LJP B;  3ZNZ B;  2O2V B;  1YD8 U;  3B08 A;  1TKY A;  1VR9 A;  1QIL A;  2V0G A;  4AOF A;  3PS6 A;  4KX6 B;  4WIP A;  4MEL A;  1UBI A;  1N6Z A;  1SXT A;  4TKN A;  2GI9 A;  1T5X D;  1RFK A;  2JSV X;  2K3U A;  1XXG A;  2NTT A;  2LI5 A;  3Q3M C;  1V86 A;  4IC7 B;  4L2Y A;  5AZH A;  1VD2 A;  2IGD A;  2JZ3 B;  3B9J A;  4RF0 A;  3ZNI D;  1OFF A;  1Z5S B;  4ITK A;  4TQ1 A;  4YWG G;  1LO5 D;  4M01 A;  2KWD A;  1UWM A;  2WXL A;  3MHZ A;  1WRI A;  3S2A A;  1SIJ A;  3W1S A;  5CHW A;  5FK9 C;  1Y8R C;  2C5L C;  5HI1 A;  1AN8 A;  3EFU A;  2KMM A;  4OZC A;  3DDC B;  3UF8 A;  3H9D A;  3VFK A;  2ZW1 A;  1K8R B;  2ZW0 A;  4EE2 A;  4IKG A;  1IUE A;  2G45 B;  1RFA A;  1EUV B;  2ZCB A;  5BYQ A;  2BTE A;  3BYT B;  1FD6 A;  1JWB D;  4OHJ A;  4URK A;  1FMA D;  3AED B;  2L05 A;  4TV3 A;  3Q8E A;  1V1P B;  3O65 B;  4REZ A;  2IZV B;  1FXI A;  2VZK D;  1E8Z A;  5J18 A;  2BBC A;  1K50 A;  1MHX A;  4M02 A;  4BAX A;  3TEW A;  4B95 A;  3DBH I;  2KDB A;  3AM9 A;  4YSY B;  4AUQ C;  4FJY A;  1E6E B;  4ACF A;  3V6E B;  1UUP A;  3W1S C;  2M0X A;  4BZA A;  3B0A A;  5E6O A;  1EWY C;  1YQ4 B;  1YOV B;  1UZX B;  3URY A;  3P4Q B;  1DOX A;  1JWM D;  2JQR B;  3MHS D;  4EZK A;  2IBI B;  4MJS B;  4BBN C;  2IJ0 A;  2L1A A;  1C3T A;  2W54 A;  2KAJ A;  3PT2 B;  3WAL A;  2DZK A;  3H7S A;  5DPS A;  3WAN A;  3ZRF A;  4BOS C;  3V62 A;  1FXT B;  4NNJ B;  2KHW B;  4KSL C;  2ZNV B;  3CST A;  2Z0D B;  2R61 A;  1JRU A;  3R2T A;  3AE8 B;  4K3B A;  2RDB C;  2XK5 A;  1QF6 A;  1C9F A;  4MAC A;  3AEC B;  4LDT B;  4OW0 A;  2J7Q B;  3NVW A;  1P98 A;  3I3T B;  2N9E B;  3A4R A;  1ACC A;  1P0R A;  5FR3 A;  3TBL D;  2K0P A;  4LCD E;  4JGH B;  3P63 A;  2KYW A;  2VH1 A;  2GRI A;  4NQK E;  3BYY B;  3JVZ X;  2ZPN A;  5JXV A;  3U30 A;  3MP9 A;  3GS2 A;  4FA6 A;  4HKQ A;  4ICV A;  2L7R A;  5G2N A;  5AZF A;  4HEA 1;  2PLP A;  1KLU D;  2KDI A;  4P6V F;  2VH2 A;  1UGJ A;  3PSE B;  4R3D A;  4P16 A;  2H89 B;  1FO4 A;  3L10 B;  1NYQ A;  1PGA A;  1MI0 A;  2LZ6 A;  2MBB B;  2LGS A;  5L83 A;  5E6J A;  3R3M A;  3J9C A;  2HJ1 A;  2LJ5 A;  5CTR C;  2GBK A;  3Q3J A;  5DPR A;  3Q2A C;  3GE8 C;  3AE1 B;  1JML A;  1RLF A;  2MJD A;  2Y5B B;  3R7R A;  1TYG B;  2PEA A;  1PDX A;  4XZ4 A;  4RM8 A;  1XCT L;  3H7P A;  1NEK B;  5L95 C;  4HRS A;  3RI7 C;  1CJE A;  4K3C A;  3U2S C;  1HTO A;  1HE8 A;  1IBX B;  4FN2 A;  5MPO A;  1RWS A;  1B9R A;  4HWI B;  4JQW C;  3M95 A;  3DCG A;  1WYW B;  1SJE D;  2C7N B;  4ZYS A;  3AU4 A;  3Q6B A;  3PRP B;  5C1Z A;  4WAA A;  1ZP0 B;  2O6V A;  1GNU A;  4RGM A;  2KN4 A;  4MDK E;  2I1K A;  4S0R A;  2PPH A;  4FJZ A;  2OJR A;  4HRO A;  4KIK A;  2IO3 B;  4JWS C;  1WM2 A;  5KHQ A;  3U8Z A;  1KJT A;  1E7U A;  4MGK E;  1NDD A;  2WXM A;  1N5W A;  1SF0 A;  3WCQ A;  2R2O A;  2BWF A;  1SJH D;  2KN5 A;  4YTN B;  2DZM A;  1P7F A;  3W1Y A;  2GBJ A;  1UNS A;  5LNK 1;  1WGD A;  4A55 A;  1HTQ A;  5AZG A;  4DXF A;  3W5V B;  4HVB A;  3IAM 1;  1J7B A;  4A90 A;  3VQI A;  4GDK A;  1CK1 A;  3EUB 2;  5TSS A;  3ZXR A;  1KFY B;  2K5P A;  3W5U B;  1KF6 B;  3PPA A;  1WXA A;  1SGH A;  4GGQ A;  3ZUN A;  3PHW B;  2C7H A;  2DYB A;  2KXJ A;  2WWZ A;  1GC6 A; 
#chains in the Genus database with same CATH homology
 1XD3 B;  2D07 B;  4K1R B;  4ZRJ A;  4WQO B;  1WY8 A;  2BF8 B;  2K6D B;  2ZJD A;  4DK5 A;  3V61 A;  1VCB A;  4AJY B;  4IM3 A;  2N9P C;  4W9I A;  2DAF A;  4EUT A;  2KX0 A;  2JWZ A;  3QC8 B;  3CSF A;  1H4R A;  2LGX A;  1WR6 E;  4BOZ B;  3NHE B;  5LXI B;  2KK8 A;  3KVF B;  3APD A;  3EC8 A;  5E6P A;  5DCN A;  1WX8 A;  4HPL B;  1SIF A;  4IG7 B;  2G4S A;  4GDK B;  3WA0 A;  5BO4 B;  5J17 A;  4K7S A;  3VTV A;  4B6W A;  2QHO A;  3L08 A;  1M94 A;  2FCQ A;  1WX9 A;  3H7P B;  2DZI A;  1ZKH A;  5JH5 C;  2K8H A;  3JW0 X;  2KVR A;  2NS5 A;  1OQY A;  2KFJ A;  1SE9 A;  4NJ7 A;  5LLI A;  1I42 A;  4OVU A;  3TIX A;  2N1V A;  2Z0E B;  2L8J A;  2N4F A;  2BKR B;  4K7W A;  2CHZ A;  2LXC A;  3PRZ A;  4I6N B;  4II2 B;  4DBG A;  2HD5 B;  2DYM A;  1V2Y A;  3N3K B;  4F7Z A;  2KZR A;  2D10 A;  4G50 A;  2MX2 A;  3DBR I;  2JT4 B;  1EF1 A;  2Z59 B;  4KDL B;  3UQA A;  4MGY E;  1WXS A;  1Q5W B;  2WDT B;  3WIM A;  2XK5 B;  4FLH A;  3TJP A;  1J19 A;  2C7M B;  3TMP B;  1WZ0 A;  2KJR A;  2MRP A;  4FUL A;  2L0F A;  3UQB A;  3QAR A;  3U7D A;  4IWP A;  3ZRC A;  2C60 A;  2MA9 B;  3HM6 X;  2NBV B;  3GOE A;  4AP4 C;  4ZRI A;  4DDG D;  4TQ0 A;  3D32 A;  3LJ3 A;  2V4L A;  3B1L X;  3AI5 A;  4X57 B;  5CX3 A;  3M3J A;  1E7V A;  3EEC A;  2KTF A;  1H8C A;  2JRI B;  3KUD B;  4G0N B;  3P2B A;  1WGY A;  3KW5 B;  4ANW A;  3ML8 A;  1UD7 A;  1KM7 A;  2BGF A;  2ZNV C;  2CS4 A;  3AUL A;  2LRU A;  2LWP A;  1TGZ B;  3A9K A;  3PHX B;  3PV1 A;  3V6C B;  3DPD A;  4KSK C;  3VH4 B;  3PLU A;  4HCN B;  2LD9 A;  2KX3 A;  4BKS D;  3PGE A;  4F1S A;  4GXB A;  3L0W B;  2IO1 B;  1D3Z A;  3RZF A;  3VUY A;  2CU1 A;  2LXA A;  4TUU A;  4DHJ B;  2PE6 B;  4GB9 A;  2IY1 B;  2RR9 A;  1UGM A;  2ZZP B;  4FHK A;  4DHZ B;  5C23 A;  1GUA B;  1TBE A;  2FCN A;  4WWN A;  3RD2 A;  4OVV A;  3VTW A;  3OAW A;  4IUM B;  2NR2 A;  2LRW A;  1AAR A;  3T9L A;  5D6J B;  1YQB A;  4BBN F;  2N7E A;  2K8B A;  3T8M A;  2KLG A;  2OOB B;  1OEY A;  5D94 A;  3KH0 A;  2GMI C;  4A20 A;  1KLV A;  1ZGU B;  1GJZ A;  2KFK A;  1G6J A;  2HJ8 A;  3UIN B;  4PYU A;  3QA8 A;  4GIV A;  3VUW A;  4MH0 E;  5JZE B;  4ZRK A;  3DVG X;  3H1U A;  2B3A A;  3NOB A;  3TL5 A;  3DVN V;  1P1A A;  2A5U A;  4M8M A;  4IM0 A;  3A9J B;  4HDQ A;  5AEK B;  2MQJ A;  3IG3 A;  1LFD A;  2JZZ A;  2JRH A;  4BKT A;  4CHK A;  1TZ1 A;  4HLE A;  5FR6 A;  3QQ8 B;  2FNJ B;  2CR5 A;  4N9F 4;  3M62 B;  3HIZ A;  2KAN A;  3A1Q B;  4W9J A;  2G3Q B;  3DOW A;  1U4A A;  2M8S A;  3OLM D;  2KMA A;  4A3P A;  2FUH B;  3MJW A;  2FCM A;  3ZVV A;  4W9C A;  4PYZ A;  2AL6 A;  4LJP B;  2IO2 B;  1GC7 A;  4K7U A;  3ZNZ B;  2O2V B;  1Q0W B;  1YD8 U;  1YIW A;  3B08 A;  4KZ0 A;  1R4N I;  4AOF A;  3DBS A;  3RUL A;  4AWJ A;  3PS6 A;  4IWQ A;  4MEL A;  2MBO A;  4HXD A;  4AJW A;  1UBI A;  1A5R A;  2ASQ A;  3ZDT A;  4TKN A;  3APF A;  3NS8 A;  4KV2 A;  4WJP A;  2LVQ A;  1EF5 A;  1QZE A;  1TTN A;  2LI5 A;  4W9H A;  4I6P A;  2XBB C;  4E71 A;  2LGY A;  2KTR B;  3HK0 A;  2V3S A;  2ZCC A;  2GBR A;  1V86 A;  4IC7 B;  2UWQ A;  1BT0 A;  1WMH A;  3QX1 A;  3ZDM C;  2JXX A;  4W9G A;  5AZH A;  2D2Q A;  1S1Q B;  1VD2 A;  2JZ3 B;  3RCZ A;  3AU5 A;  4KDI C;  2D3G A;  4I6L B;  3R7Q A;  3ZNI D;  1Z5S B;  2JY6 A;  2NVU I;  4TQ1 A;  2O6V B;  4WWO A;  4NQL B;  5CHV C;  1LQB A;  2BYV E;  1UH6 A;  2MBE A;  4W9K A;  3JSV B;  3NY5 A;  4FBJ B;  2N1W A;  4E3C A;  2MP2 A;  3S2A A;  3W1S A;  2MBH A;  4G11 A;  3ALB A;  5CHW A;  1C1Y B;  1V5T A;  5GMV A;  1Y8R C;  1WX7 A;  4BFR A;  3QCA A;  2C5L C;  1WIA A;  4EFO A;  3VXW A;  4HPM B;  4EKU A;  4B9K A;  1V9J A;  3A1Q A;  2MP2 B;  1R4M I;  3EFU A;  2FIF A;  2KJH B;  3DDC B;  3UF8 A;  2DYO A;  3JSV A;  1LXD A;  3H9D A;  1P3Q U;  2KQS A;  2YLM A;  3RT3 B;  3VFK A;  4M8N A;  5IAA C;  1K8R B;  3EHV A;  3HHM A;  3UIO B;  1J0G A;  2MSE D;  1YJ1 A;  3V60 A;  2G45 B;  1RFA A;  1EUV B;  2K25 A;  2ZCB A;  5JHA A;  3ZLZ A;  2FCS A;  2LGD A;  2RD0 A;  4URK A;  4E74 A;  1WRD B;  3QWZ B;  2L05 A;  3BY4 B;  4TV3 A;  3JYU A;  2K8C A;  3O65 B;  3SDL C;  1NBF C;  3SHQ A;  4IW0 A;  2IZV B;  4XC2 A;  4EZL A;  1E8Z A;  5LXH A;  5J18 A;  2EKE C;  2J0M A;  4JL9 A;  2N9X A;  2BPS A;  2NBW B;  2ZEQ A;  3ZTC A;  1WR1 A;  4K81 A;  2J0J A;  4MGZ E;  1IP9 A;  2KWU B;  4B95 A;  4A3O A;  3DBH I;  1Z2M A;  2KDB A;  4W9L A;  4CO7 A;  2DHZ A;  4AUQ C;  2MW5 A;  4FJY A;  1WJ4 A;  1UEL A;  2A4Z A;  2DX5 B;  4JIO U;  5D2M B;  3VAW A;  2KWV B;  4PS7 A;  3V6E B;  3W1S C;  1P9D U;  2L76 A;  2M0X A;  4WWP A;  3RYT A;  3B0A A;  5E6O A;  2IYD B;  3OJ3 A;  2AWT A;  2G4D B;  2LAS A;  2AEH A;  2C9W B;  2ZVN A;  1UZX B;  3K9P B;  1IYF A;  3VTU A;  1WM3 A;  3NZU A;  2KDF B;  5J2R A;  3UGB B;  4ANX A;  3MHS D;  3ML9 A;  2VRR B;  3X23 A;  2IBI B;  4EZK A;  3WAO A;  4MJS B;  4BBN C;  4EOY A;  1C3T A;  3PT2 B;  3WAL A;  2DZK A;  3DBL I;  4II3 B;  3H7S A;  5DPS A;  3WAN A;  3ZRF A;  4BVU C;  2KC1 A;  2KD0 A;  3ZNG C;  1V6E A;  2LVP A;  2PE9 A;  3ZKJ C;  3V62 A;  1ISN A;  4BOS C;  4HK2 A;  1FXT B;  4NNJ B;  2KHW B;  1E8Y A;  4KSL C;  2ZNV B;  1WGH A;  3CST A;  2Z0D B;  3QJZ A;  2WX0 A;  5E6N A;  1JRU A;  1L2N A;  2L0T A;  1V80 A;  2EMT A;  2NBU A;  4MSQ B;  3KUZ A;  2JUO A;  2YVC A;  2XK5 A;  3ZW3 A;  3SD5 A;  5CHF A;  4NJ6 A;  3SU8 X;  1T0Y A;  2MWS B;  2L3Z A;  4LDT B;  2J7Q B;  5D7G A;  1WJU A;  1P98 A;  1WF9 A;  3I3T B;  1OGW A;  1WGG A;  1WI0 A;  2N9E B;  3A4R A;  3WAM A;  3GZN I;  1P0R A;  4FAD A;  3M63 B;  3TBL D;  3IFW B;  4LCD E;  4JGH B;  1EO6 A;  3CF6 E;  1WXV A;  3H6N A;  1WZ3 A;  3PTF C;  2MCN B;  1WFY A;  2NCN A;  3LDZ E;  3VVW B;  2GOW A;  3NZS A;  3A9K B;  2AYO B;  1WGR A;  2RSU A;  4GN1 A;  2DZJ A;  2R2Q A;  4JLC A;  2CHX A;  3JVZ X;  4NQK E;  4ZYN A;  3VUX A;  2ZPN A;  3ZO5 B;  3TCA A;  3DVN U;  4G3X B;  3U30 A;  3ENE A;  4FA6 A;  4CYE A;  2BWE S;  4WJQ A;  4ICV A;  2L7R A;  4DHJ D;  2J0K A;  4W9D A;  2GBM A;  1LM8 B;  5G2N A;  1RAX A;  4ANV A;  3OJ4 B;  4W9F A;  2DAJ A;  1V81 A;  3K9O B;  5JHB A;  5AZF A;  5TR5 A;  2KDI A;  3BIN A;  2HE7 A;  1E90 A;  4P7I A;  4DXA B;  4DDI D;  3PSE B;  4HDO A;  2M17 A;  2K6Q A;  3A9J A;  3AXC A;  2GBN A;  3L10 B;  2KNB A;  2JPH A;  3MTN B;  4FJV B;  3VHT C;  2LZ6 A;  4EZJ A;  4GOC A;  4DWF A;  2MBB B;  1WE6 A;  3APC A;  3ONS A;  5L83 A;  1KOT A;  5G55 A;  4RM9 A;  1XT9 B;  3R3M A;  1WE7 A;  3ZTD A;  4IWO A;  4WJO A;  1J8C A;  2LJ5 A;  2ZPY A;  5CTR C;  2N7D A;  2KMC A;  4YL8 A;  2GBK A;  3Q3J A;  1XQQ A;  1I35 A;  1OEY J;  3QK0 A;  3A33 B;  5DPR A;  1E5W A;  3IBE A;  2NPT B;  3PRE A;  4LDT D;  4GDL B;  4NAW A;  1RRB A;  2M1M A;  1RLF A;  2KKC A;  3A4S C;  3N30 A;  4MJS A;  4PS3 A;  2Y5B B;  2WX1 A;  4PS8 A;  2FAZ A;  3R7R A;  1L7Y A;  2PEA A;  4IM2 A;  5DPW A;  4XZ4 A;  4RM8 A;  4KVG B;  4F8C B;  3H7P A;  5L95 C;  2KO3 A;  5IA7 A;  4BKS A;  4MEM A;  4LJO B;  2RPQ A;  1V49 A;  1HE8 A;  3L13 A;  4ASW C;  1ZW7 A;  1Q1O A;  2K39 A;  4FN2 A;  1F9J A;  3CMM B;  2KWC A;  2ZVO A;  4HWI B;  3M95 A;  3DCG A;  4HCP B;  1WYW B;  2KLC A;  4JQW C;  4WJN A;  2PJH A;  4ANU A;  2C7N B;  3N32 A;  4GMV A;  1OTR B;  4MSM B;  3AU4 A;  3PRP B;  3X0W A;  5C1Z A;  4WAA A;  2EMS A;  5HKH A;  2JVC A;  1IPG A;  1GNU A;  2O6V A;  4ICU A;  3ECI A;  4NAW B;  3ZIM A;  5EDS A;  2REX A;  1YX5 B;  1CMX B;  2UYZ B;  2MLB A;  4GDL A;  2FID A;  2MBQ A;  2JF5 A;  4MDK E;  2LVO A;  3L54 A;  3PLV A;  2I1K A;  4KIK B;  3PZD A;  2L00 B;  4MM3 A;  4GSW A;  2KFK B;  1WMH B;  3R66 C;  2AL3 A;  2DEN B;  4RMA A;  1WXM A;  2KOX A;  2PPH A;  3VH3 B;  2IY0 B;  4FJZ A;  2OJR A;  2KTR A;  4M0W B;  4KIK A;  3L17 A;  4NY0 A;  2V1Y A;  3PRM B;  2IO3 B;  3KYC D;  3IVF A;  3KUC B;  4KZC A;  1WM2 A;  2BKF A;  5KHQ A;  3U8Z A;  4FHJ A;  1KJT A;  1E7U A;  5DPT A;  3UIP B;  2M4N A;  2KQ7 A;  4MGK E;  3WAP A;  3VDZ A;  1NDD A;  2HTH A;  1MG8 A;  2O6V D;  4MGI E;  3ZNH B;  4DHZ E;  2I1J A;  3KYD D;  2R2O A;  2O2V A;  1X1M A;  2BWF A;  2BYE A;  2KN5 A;  2K1F A;  4BKG A;  1WJN A;  2CHW A;  2WYQ A;  4EEW A;  2CKH B;  1WJ6 A;  2DZM A;  1PQS A;  2KC2 A;  4GU2 A;  2KJ6 A;  1UBQ A;  3W1Y A;  2GBJ A;  1WGD A;  5AZG A;  1WH3 A;  1GG3 A;  1YX6 B;  3QHT A;  3IHP C;  4ZDV A;  4HVB A;  1S3S G;  3RZW C;  3QIJ A;  2D11 A;  2IO0 B;  3L16 A;  1E8X A;  2NPT A;  3PVL A;  4GDK A;  3VQI A;  3Q3F A;  3HM3 A;  2LUE A;  3PPA A;  4NPN A;  1WXA A;  1SGH A;  3QAQ A;  4W9E A;  2XEW A;  4GGQ A;  4J6I A;  2W9N A;  2RGF A;  3ZUN A;  3PHW B;  1V5O A;  3DQV A;  4XX5 A;  2BYF A;  3C0R B;  3DVG Y;  1NI2 A;  2C7H A;  2DYB A;  2KXJ A;  2WWZ A;  4HJK A;  2KDE B;  5KHO A;  1GC6 A;  1E8W A;  3RUI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...