2KANA

Solution nmr structure of ubiquitin-like domain of arabidopsis thaliana protein at2g32350. northeast structural genomics consortium target ar3433a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
MGHHHHHHSHAAVRKIHVTVKFPSKQFTVEVDRTETVSSLKDKIHIVENTPIKRMQLYYSGIELADDYRNLNEYGITEFSEIVVFLKSINRAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of ubiquitin-like domain of Arabidopsis thaliana protein At2g32350.
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein ar3433a
total genus 21
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2008-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kanA01
4MM3A 3U7DA 4ZYNA 1SGHA 3L17A 4GIVA 3R66C 4X57B 3KUCB 4IG7B 2N7EA 3U8ZA 1WE6A 3A1QA 1WYWB 4GGQA 2C5LC 2AL6A 2O2VA 2N9PC 4FN2A 1WX9A 2K39A 2ZZPB 3EC8A 3SHQA 3MTNB 3RUIB 1ZKHA 4MEMA 3MHSD 4DHZB 2WYQA 3WA0A 2AEHA 3UIOB 1GC6A 2JZ3B 2MRPA 3V60A 4WJPA 2D3GA 1MG8A 4FJZA 2KFKA 2BYEA 4DHJD 2LVOA 4PYZA 2MLBA 3PPAA 3R3MA 1WZ3A 4I6PA 3UGBB 2G45B 1WXAA 3MJWA 4ZRJA 1J19A 3DBHI 3IG3A 3ALBA 2L05A 2O2VB 4NJ7A 1E8ZA 2IO1B 2DAJA 4CYEA 4NNJB 4TUUA 2JRIB 4MH0E 2PE9A 5IA7A 3A9KB 4NQLB 2Z59B 3PHXB 1C1YB 2ZEQA 2N9EB 4ANWA 4FADA 3Q3FA 2XK5A 1GNUA 2RSUA 3DPDA 3KUZA 4PYUA 3KW5B 2B3AA 1TTNA 2DX5B 2BPSA 4MSQB 2MA9B 1WF9A 1WJ4A 2NBWB 3VUWA 4K1RB 3ONSA 2NBVB 4PS7A 2I1KA 2L7RA 2DZIA 2ZNVC 3B1LX 3CSFA 2KO3A 2BYVE 3RCZA 1V6EA 4EZLA 2NPTB 4HK2A 2OOBB 4KSLC 3V6EB 2FIFA 5CTRC 1CMXB 2R2OA 3L10B 3AU5A 4EEWA 3OJ3A 1IYFA 2JPHA 2UYZB 1V81A 4HJKA 2CHWA 1ISNA 3QQ8B 1XD3B 3N3KB 4HDQA 3T9LA 2LVQA 2NBUA 2PE6B 1GG3A 2OJRA 2C7MB 4IM0A 4MGIE 1WIAA 4K7UA 1HE8A 4ANXA 4NJ6A 4EFOA 4JLCA 4FJVB 3EHVA 4NAWB 5JHAA 5JH5C 2M8SA 4OVVA 4EUTA 3DVNV 3ZRFA 4BBNF 2UWQA 3PSEB 5D2MB 2JT4B 1WMHB 4G50A 4W9JA 2GBRA 2K6DB 1EUVB 4DWFA 2KD0A 1K8RB 4K7SA 5JZEB 4GDKA 2IY0B 4G11A 3ZDTA 2QHOA 2L0TA 2MCNB 3PZDA 4EZKA 1G6JA 3WAMA 1OGWA 1EF5A 1P98A 4RM9A 3ZDMC 3ZNGC 2KK8A 3KUDB 1YX5B 3PLUA 4KDIC 4MDKE 2XBBC 4ASWC 3KYDD 4EKUA 3VVWB 2HD5B 2L8JA 4ICUA 4GXBA 2VRRB 4MGYE 2FUHB 3NOBA 4E3CA 2XK5B 4XX5A 3UQBA 3RD2A 2ZVOA 4JQWC 4W9IA 4PS3A 2M1MA 1RAXA 1V2YA 3DQVA 4IM3A 2BKFA 3UIPB 4HCPB 5FR6A 1EF1A 2C9WB 3L16A 3V6CB 2KJ6A 3WALA 4FLHA 3VH4B 2DENB 1V9JA 4HLEA 4FHKA 1Y8RC 2JVCA 1IPGA 3ZVVA 2L3ZA 2W9NA 1Q5WB 2FAZA 4GU2A 3QA8A 1PQSA 2MBBB 4ANVA 3B08A 5DPRA 4DDID 4GOCA 2D2QA 3DBSA 2N4FA 2KKCA 2CR5A 1E8YA 2LGXA 2LUEA 3R7RA 5J17A 1KLVA 1WGHA 2MP2A 3DOWA 3HM3A 4NY0A 4WAAA 1WR1A 4WWPA 5HKHA 3W1YA 4G0NB 1U4AA 4AWJA 1D3ZA 2D07B 2WWZA 5D6JB 4ZRIA 4B95A 4JGHB 2MBHA 1YQBA 2PPHA 1UELA 1UGMA 1E90A 1WE7A 4IC7B 2V1YA 3PHWB 3S2AA 1WM2A 2GMIC 2G4DB 2KANA 3APFA 3UINB 1VCBA 5EDSA 3H6NA 2K8CA 4PS8A 2CS4A 2ZVNA 1WJNA 4LDTD 5IAAC 3CF6E 5J18A 3PV1A 3OLMD 1UBQA 2YLMA 2KDFB 3ZTDA 5DPWA 2IY1B 3IFWB 3B0AA 3ML8A 3AXCA 3VFKA 4MGKE 1WX7A 3TJPA 1VD2A 3A4RA 4II2B 1WRDB 2LJ5A 4HXDA 4DBGA 3JW0X 4K7WA 2M17A 3SDLC 1P0RA 1TZ1A 3HM6X 2KDIA 1S3SG 4JIOU 4F7ZA 4NQKE 1H4RA 4W9LA 3RYTA 1IP9A 1T0YA 3H9DA 4GDLA 5KHQA 1Q0WB 3JVZX 4W9CA 5TR5A 2KTRB 2EKEC 2KXJA 2KMCA 3DCGA 4YL8A 3V61A 4LCDE 3QARA 1WZ0A 5C23A 3QHTA 2MBQA 4M8NA 5DPTA 1V5TA 2KQSA 2GBMA 3VAWA 1WGDA 3I3TB 4BKSA 3NY5A 1M94A 5DCNA 3C0RB 3ZLZA 1OEYJ 1F9JA 4HWIB 5D7GA 2L00B 2IZVB 3KYCD 4JL9A 3RZWC 2J7QB 2K25A 3QX1A 4MGZE 3K9OB 3TL5A 2KZRA 2O6VA 5AZGA 5CHWA 4GB9A 1GUAB 3NS8A 1E7UA 3PRPB 2FIDA 3WAOA 3M63B 1WGRA 5GMVA 5LXHA 4DHZE 1KM7A 2KTRA 2KVRA 2AWTA 4WJOA 2N1VA 3N30A 3A1QB 3ZUNA 2NR2A 4FA6A 4KDLB 4GDKB 4EOYA 4HCNB 3ZW3A 1UBIA 3A33B 3ML9A 4TQ0A 2MW5A 3M3JA 3VXWA 4KIKA 4KSKC 4OVUA 3VTWA 3WANA 4TKNA 2FCQA 2KHWB 3PREA 2JXXA 3QCAA 2NS5A 2K8HA 2RR9A 2RD0A 3A9JB 3PVLA 4MELA 4WJNA 5CHVC 2PEAA 4HVBA 3L13A 1YIWA 3X23A 3ZTCA 2KMAA 1RRBA 3APCA 3T8MA 3HHMA 1XQQA 3TBLD 3VUXA 2ZPNA 4KZCA 4W9EA 2LWPA 3KVFB 5CX3A 3Q3JA 1WMHA 2WX0A 4ANUA 2G4SA 1V5OA 5L95C 3AI5A 3PRMB 1KOTA 2LD9A 2ZNVB 3SD5A 1R4MI 3APDA 4A20A 5CHFA 2I1JA 2J0MA 1NDDA 4BKTA 1A5RA 1WR6E 1LXDA 3PRZA 3L0WB 2MX2A 3PS6A 1UD7A 1YD8U 2ASQA 2FCMA 3DVGY 4WQOB 2M0XA 3UF8A 3ZNZB 5D94A 3CSTA 4P7IA 2AYOB 4GSWA 1GJZA 1QZEA 2KWVB 1WXVA 3DBLI 2KNBA 2L76A 2KN5A 3VTUA 1RLFA 1R4NI 3DVGX 3AU4A 4ICVA 1ZW7A 3NZSA 2YVCA 3H1UA 3WIMA 2NPTA 1C3TA 2V3SA 1OQYA 3L54A 1S1QB 3QIJA 4ZRKA 2DZMA 3JSVB 1YX6B 4MSMB 2CU1A 3V62A 3O65B 4BOZB 3VDZA 5AZHA 3W1SA 3H7PA 2FNJB 4GDLB 4XC2A 4KVGB 1KJTA 4M0WB 4BFRA 1LM8B 2ZCBA 2KTFA 4K81A 1SE9A 4AUQC 1EO6A 1OTRB 3ENEA 2DYBA 4FHJA 4FULA 2Z0DB 5E6OA 3ZNHB 2Z0EB 4II3B 3IVFA 2G3QB 2IO0B 2KX0A 1I42A 3JSVA 2BF8B 4XZ4A 2DAFA 5AZFA 4EZJA 3GOEA 2IYDB 1SIFA 3RT3B 1H8CA 2N1WA 1OEYA 2LGYA 4GMVA 3RZFA 2MWSB 4I6LB 1WX8A 4MJSB 5AEKB 3H7PB 1LFDA 2IBIB 3CMMB 1FXTB 4NPNA 4B9KA 3D32A 4IWPA 3EFUA 3A4SC 2D10A 2DHZA 4N9F4 2IO3B 2K8BA 3P2BA 1P9DU 5C1ZA 1E8WA 2HJ8A 2LGDA 2MBEA 4W9HA 1J8CA 4AJYB 2KQ7A 2KC2A 1UZXB 4W9GA 2DZJA 2DYOA 1V80A 5G2NA 4DDGD 3VH3B 2GBKA 2V4LA 1LQBA 2MQJA 2C60A 2EMTA 4HPMB 1AARA 2GBNA 2BYFA 2LVPA 3PGEA 1L2NA 2IO2B 1NI2A 4CHKA 2JF5A 3ZRCA 4DK5A 5DPSA 3AULA 1JRUA 3QK0A 3IHPC 2LASA 2LXAA 4MJSA 4TV3A 4IWQA 2HTHA 4HPLB 3ZKJC 4KZ0A 1NBFC 3QJZA 4GN1A 4IUMB 3TCAA 2ZCCA 4HDOA 4W9FA 3GZNI 3PT2B 3JYUA 2N7DA 3M95A 5JHBA 1E5WA 1WM3A 4W9KA 3DDCB 2Y5BB 4J6IA 2KWCA 4LJPB 2LXCA 4A3OA 2O6VD 2N9XA 2C7HA 4KV2A 2LI5A 3DBRI 2LRWA 4IWOA 2FCNA 2KLGA 4LJOB 2JWZA 2J0KA 3KH0A 1GC7A 3U30A 4F8CB 5L83A 2HE7A 1WI0A 2KFKB 2GBJA 4BKSD 2MBOA 1WXMA 1X1MA 2FCSA 2JZZA 2A4ZA 1WH3A 3K9PB 4IM2A 5LXIB 2CHZA 4AOFA 4URKA 5LLIA 2EMSA 3QWZB 3IBEA 1J0GA 2NVUI 2R2QA 2K1FA 3VQIA 3H7SA 2BKRB 2BGFA 2C7NB 4WJQA 3R7QA 2REXA 4IW0A 3ECIA 3BINA 1WJ6A 3OJ4B 4B6WA 4KIKB 2ZJDA 4LDTB 1E8XA 1P3QU 2KWUB 3SU8X 3ZNID 2ZPYA 1Q1OA 4I6NB 4RM8A 4DHJB 1WY8A 4E74A 2KDEB 3N32A 4W9DA 2D11A 4CO7A 3BY4B 2KLCA 1WFYA 3VUYA 1WJUA 2KOXA 2LZ6A 3PLVA 2NCNA 3X0WA 3DVNU 2XEWA 1BT0A 4WWOA 4FBJB 3OAWA 1V86A 2O6VB 3QAQA 2JRHA 1WXSA 2A5UA 1Z2MA 1P1AA 3HIZA 3W1SC 2KJRA 4TQ1A 3VHTC 3ZO5B 3NZUA 1TGZB 2BWES 2AL3A 2JY6A 1TBEA 1ZGUB 2DZKA 1XT9B 2KDBA 2WX1A 4F1SA 2L0FA 2MSED 4RMAA 4M8MA 4NAWA 5G55A 4BOSC 2WDTB 4FJYA 2RPQA 4AJWA 2M4NA 3QC8B 1YJ1A 3M62B 2MP2B 3A9KA 5E6PA 2BWFA 2KFJA 3LJ3A 1Z5SB 3ZIMA 5E6NA 1I35A 1L7YA 2JUOA 2KC1A 4BKGA 5J2RA 2KJHB 1WGYA 2KX3A 2PJHA 3L08A 1E7VA 1UH6A 2GOWA 1WGGA 3TMPB 4G3XB 2K6QA 4E71A 3EECA 3NHEB 2DYMA 2RGFA 1V49A 3WAPA 4DXAB 4A3PA 4BVUC 3VTVA 3UQAA 3PTFC 2J0JA 2CKHB 1RFAA 2LRUA 4WWNA 3RULA 4ZDVA 3A9JA 4AP4C 2CHXA 3HK0A 5BO4B 5KHOA 4BBNC 3LDZE 3TIXA
chains in the Genus database with same CATH superfamily
2IGDA 4KGRA 1UWMA 3KUCB 2WXHA 1N63A 3U8ZA 4GGQA 1J7AA 2YEPB 1ZXIA 3SHQA 3RUIB 2FE8A 4DHZB 1EWCA 3V60A 1PFDA 2KFKA 2BYEA 4PYZA 3UGBB 3ZXVA 1NENB 3DBHI 3IG3A 2G9HD 2IO1B 4CYEA 4TUUA 2JRIB 4NQLB 2JU6X 2RSUA 2H89B 3DPDA 1TTNA 2DX5B 4MSQB 4REZA 2J4XA 1I4RA 2V4IB 2NBVB 2L7RA 3VR8B 1F0ZA 4HK2A 2K3UA 2OOBB 2R2OA 2HTME 3L10B 2JPHA 1V81A 3QQ8B 2AQ1B 5MPOA 3Q8EA 5BMIA 2OJRA 2K0PA 4ANXA 4EFOA 5JH5C 2WXJA 3RMKC 4BBNF 5G5GA 3AEDB 2HDEA 4G50A 4W9JA 2GBRA 1DYQA 4US8A 5JZEB 1OQRA 4XYCA 4GDKA 4L23A 2ON8A 2MCNB 5JXVA 1G6JA 3ZNGC 2KK8A 3BVMA 1Q10A 4BZAA 3KYDD 4EKUA 4ICUA 5EE1A 4K3CA 2FUHB 3NOBA 4XX5A 3RD2A 4JQWC 4PS3A 2M1MA 3DQVA 2BKFA 1EF1A 1QF6A 1HA5A 2DENB 3EUB2 4HLEA 2JVCA 1WRIA 4IKGA 1IPGA 3ZVVA 2W9NA 4YSZB 4S17A 3QA8A 3W5VB 4ANVA 3B08A 5DPRA 4DDID 1MPEA 1E8YA 5J17A 1KLVA 4WAAA 4WWPA 1WR1A 5HKHA 1CZPA 4AWJA 3NVVA 1D3ZA 2D3BA 4JGHB 1JQ4A 3SFEB 4M01A 1QOGA 2VZKD 2GMIC 3APFA 3UINB 3H6NA 2ZVNA 1WJNA 4C4VA 1UBQA 3TEZA 1BUIC 3VFKA 4MGKE 1SE2A 1VD2A 1FFUA 1C4CA 4YSYB 1D5ZC 2WGSA 2LJ5A 5IO9A 3DHGC 1PGAA 3JW0X 2M0AA 1S3SG 4W9LA 3RYTA 4C7ZA 1JRPA 4JWUC 3V61A 1WZ0A 1XLPA 1V5TA 1GB4A 1I4PA 1WGDA 5T8IA 3CWIA 1M94A 3FILB 1HQRD 5DCNA 1OEYJ 4HWIB 2L00B 3RZWC 2J7QB 4MGZE 3VR9B 2KZRA 1DGJA 4GB9A 1GUAB 1E7UA 3PRPB 2FIDA 1L5PA 3WAOA 1WGKA 3TEXA 2KVRA 2AWTA 2QEJC 3N30A 4KDLB 3ZW3A 1C77A 2MW5A 3M3JA 4KIKA 3WANA 4TKNA 2TSSA 2NS5A 4HVBA 3PVLA 3A9JB 4MELA 1SF0A 3L13A 3HHMA 1EM7A 1D5MC 1ZXHA 4OVZA 5CX3A 2V3NA 3Q3JA 2PLPA 2QIEB 3SD5A 2J0MA 1NDDA 2I1JA 4P16A 1A5RA 4YXDB 1LXDA 1KLUD 4J3OD 1UD7A 3T3NA 1T0SC 3ZNZB 2N0SB 5D94A 4ACFA 2Q5WD 3SEBA 4P7IA 1TIFA 3PO0A 3AEAB 1C4AA 1QZEA 1KFYB 1EWYC 2KN5A 1R4NI 4ICVA 4D2KA 2V3SA 4ZRKA 1F52A 1YX6B 2QMTA 4LNNA 2CU1A 3V62A 1VZ8A 3AV8A 1I4QA 1KJTA 2LEKA 1CQVA 2RMMA 1WXQA 1JMLA 1LM8B 2LGIA 1FNVA 3GB1A 1EO6A 3I5JC 1PYWD 4FHJA 4FULA 1L4ZB 3KWVA 1AYFA 4P1BC 4II3B 2WXKA 1OQQA 3IVFA 1I42A 2NMQA 1L6UA 4EZJA 2RDBC 3Q8FA 4RF0A 2N1WA 2JYEA 3PZ8A 2BT6A 2WU2B 3RZFA 2WXPA 1N6ZA 1ZOYB 4MJSB 3H7PB 1FXTB 4NPNA 4ARIA 1QOBA 2DHZA 2HJ8A 2MBEA 1J8CA 2KQ7A 2FUG1 3AMZA 2AX5A 1V1OA 1F2RI 4DDGD 2GBKA 3I57A 4OHJA 1E10A 2INNE 1L2NA 2X8XX 2IO2B 1NI2A 3HVDA 5DPSA 1JRUA 2LXAA 1T0RC 2ZW1A 4TV3A 1XLNA 1NBFC 3QJZA 1JW9D 4GN1A 3TCAA 3M95A 1HEZE 1E5WA 5JHBA 3KQ4A 3DDCB 1ZDVA 2O6VD 5FK9C 3KH0A 1SE3A 1WSPA 3AN1A 1WI0A 2BB5A 2GBJA 4K3BA 2W82A 1X1MA 2JZZA 3MHZA 2A4ZA 1SEBD 4IM2A 1D6EC 4URKA 5LLIA 2EMSA 2NVUI 2R2QA 2IJ0A 4HRSA 4HKZE 3BINA 2K22A 4KIKB 3SU8X 4RM8A 1WY8A 4CO7A 1B1ZA 1WFYA 2EELA 4RFBA 3VUYA 2LZ6A 2XEWA 1BT0A 2LUMA 4ZRPA 4C4VB 5EE0A 3AE2B 2JRHA 2RDGA 2KDMA 3HIZA 4TQ1A 1J7BA 2BWES 4RGMA 2DWQA 2KDBA 1K50A 2MSED 3C8YA 3BK2A 4FJYA 2RPQA 3ETRA 1SJED 3QC8B 3NVYA 2KWDA 5E6JA 3A9KA 3LJ3A 3ZIMA 1L7YA 2JUOA 1WGYA 2PJHA 1E7VA 2GOWA 3TMPB 4G3XB 4WWMA 4E71A 3Q8CA 3UQAA 4KKIA 3RULA 4LNFA 2ICIA 1DOXA 3LDZE 3RN9C 3TIXA 4MM3A 4X57B 4IG7B 2N7EA 2SEBD 5TSSA 2C5LC 2AL6A 2N9PC 2K39A 2ZZPB 3EC8A 1N62A 3MTNB 4KKJA 4ZRQA 4MEMA 4OZCA 1VJKA 1XCQL 1HTOA 1OFFA 1GC6A 2JZ3B 3UIOB 1T5XD 2MLBA 4I6PA 2G45B 1WXAA 3MJWA 2O2VB 3AE8B 3H8HA 1E8ZA 2PVGC 5IA7A 5GXGB 3PHXB 2KAJA 5BYRA 2N9EB 4FADA 2MHJA 1N61A 2XK5A 4ZHOA 1YJIA 3Q6BA 1SSNA 1ZPSA 2MA9B 4JX1C 1WJ4A 4K1RB 1XXGA 2GRIA 2Y5CA 3RCZA 5BYQA 4HKQA 5CTRC 1CMXB 4EEWA 3OJ3A 1IYFA 2CHWA 1XD3B 4HDQA 1C9FA 2VH2A 2LVQA 2MEKA 2NBUA 2WS3B 1GG3A 4MGIE 4K7UA 4NJ6A 1JWMD 3EHVA 1L6VA 4C7YA 2INDC 2N9LA 3IAM1 1XO3A 1WMHB 4BAXA 2JYTA 4TSSA 2K6DB 4LNOA 4LNIA 4K7SA 2BW2A 2WXIA 3RI7C 2L0TA 1EU4A 3PZDA 2J53A 3WAMA 2QC8A 1OGWA 1EF5A 4RM9A 4XWWA 3KUDB 3DWGC 3VVWB 4GXBA 4MGYE 2INPE 4C80A 3UQBA 4W9IA 4HCPB 1JWUD 2PVOD 2HJ1A 1V9JA 4FHKA 4AS1A 2FAZA 3HRDD 5H92C 2INCC 1KF6B 2LUEA 2RPVA 2MP2A 4NY0A 4G0NB 2BYTA 4ZRIA 1WE7A 2V1YA 3S2AA 4RF1A 1VCBA 1SBBB 2K8CA 4XGAB 4PS8A 2CS4A 1QLBB 1MHXA 4ARCA 5IAAC 3PV1A 1V8CA 3OLMD 3ZTDA 1YN4A 5DPWA 2IY1B 3B9JA 3B0AA 3ML8A 4LLGM 2W54A 2JX5A 3AXCA 3TJPA 3ZJUA 1WRDB 4K7WA 3P63A 3SDLC 1TZ1A 3H9DA 4GDLA 5TR5A 2EKEC 2KQ4X 2L83A 4WAFA 3DCGA 3FILA 3AE7B 2K9XA 3QARA 5C23A 3QHTA 4M8NA 2KQSA 4CQNA 3VAWA 3I3TB 2JWUA 3NY5A 2SAKA 1TKGA 3C0RB 1F9JA 1I4GA 2IZVB 3KYCD 2WXRA 1MFWA 2IGHA 5AZGA 4LNKA 3M63B 5GMVA 4JE3B 5LXHA 4DHZE 4WJOA 4FA6A 3A1QB 4EOYA 3E9SA 4TQ0A 3VXWA 4OVUA 3PREA 3VRBB 2JXXA 2NTSA 5CHVC 2DBYA 2VH1A 1K51A 1RRBA 2WXFA 1XQQA 3MP9A 4C56C 4YT0B 3VUXA 4KZCA 4W9EA 2LWPA 3KVFB 4ZOHC 1WMHA 2L52A 1WWTA 3PRMB 4P6VF 3N1XC 5CHFA 1UGJA 1WR6E 3L0WB 1UNSA 2M0XA 1GPXA 1TZOA 1JWSD 3NS1A 1GJZA 3DBLI 1FXIA 1F77A 2KNBA 1E0ZA 1RLFA 1ZW7A 2R61A 2NPTA 3IT4B 3GS2A 1OQYA 2PW9A 1S1QB 3L54A 3QIJA 1SJHD 5I4DA 2DZMA 4BOZB 3H7PA 3MC9A 5HG2A 4BFRA 1IUEA 1SE9A 4AUQC 1OTRB 3ENEA 1XF5L 2DYBA 3W9CB 1FPYA 5E6OA 3ZNHB 2Z0EB 1TS3A 4DQOC 1KRHA 2G3QB 2KX0A 2BS3B 2IYDB 3RT3B 3AH7A 1JWBD 1WX8A 2IBIB 4B9KA 4IWPA 3IAS1 2D10A 4N9F4 3B2FA 4R3DA 5D3IB 2GLSA 2IO3B 2K8BA 3P2BA 5C1ZA 3NUHB 5D3DA 2DZJA 2DYOA 2MJEA 2V4LA 2D3CA 1AARA 2BYFA 2V3PA 4WURA 3TSSA 5AUIA 4CHKA 3OG5A 2JF5A 2X38A 3IHPC 3U2SC 4W9FA 2WXLA 1VZ7A 3JYUA 2QDFA 2QSDA 2LXCA 3AE6B 2QJLA 2C7HA 3DBRI 1L0YB 2FCNA 2JWZA 1GC7A 4P1CC 5HI1A 2HE7A 2MBOA 2WXMA 3C19A 4KGTA 4YTNB 1WH3A 3K9PB 3P4RB 3QWZB 3IBEA 3MC8A 4YWGG 3Q3OC 4WJQA 2REXA 3RNAC 4B6WA 2ZJDA 4LDTB 2KWUB 2EKIA 5AUKA 1Q1OA 4E74A 1CJEA 3N32A 2KMMA 1STEA 4B0MA 2J52A 2KLCA 2DLBA 2KOXA 3X0WA 3DVNU 4WWOA 5IKCM 4XDCA 1FXAA 3BVGA 1SE4A 2O6VB 3SR6A 3BVZA 3QAQA 1Z2MA 1PGXA 1YOVB 4TMAB 3NZUA 1TGZB 2JY6A 3BYTB 3RPFC 3AE1B 4NAWA 2LGSA 2KVZA 1GB1A 2WDTB 3BWUD 4LK0M 2M4NA 1UWXA 4L2YA 5HFYA 5E6PA 2KFJA 2KACA 3LB8C 1TJEA 3DBHB 2MH7A 1UH6A 2D3AA 2K6QA 3P4PB 2DYMA 2RGFA 1V49A 4A3PA 3AE4B 5IP4D 1N60A 1SB3C 1BXTA 5KHOA 4ZYNA 3L17A 3R66C 5FR3A 1WYWB 3NZ3A 3ABVB 4KX6B 1DOYA 1QOAA 1WX9A 3GZNB 4B0EA 2LHEA 2M19A 1ZKHA 3RNGC 4WIPA 2B76B 2D3GA 3PPAA 3R3MA 1WZ3A 1J19A 3MC0B 3ALBA 2BTEA 4NJ7A 2DAJA 4NZLB 4MH0E 1IBXB 2PE9A 3A9KB 4ANWA 1C1YB 4XDDA 2JSVX 2BS4B 4PYUA 1YN5A 2MJ3A 3KW5B 2NBWB 1WF9A 3VUWA 4C00A 2DZIA 3B1LX 2KO3A 1SXTA 1V6EA 4YSXB 1R7SA 4Q2JA 1N5XA 2UYZB 4HJKA 4ITKA 1ISNA 2L32A 4KGSA 3T9LA 2C7MB 2E6XA 1WIAA 1HE8A 1FNWA 4JLCA 4FJVB 4NAWB 5JHAA 2M8SA 4OVVA 4EUTA 3DVNV 3ZRFA 3N20C 2LMCA 1JALA 1EUVB 4DWFA 2KD0A 3ZGZA 5C2TB 1NVID 4H2AA 1UUPA 1M4VA 3EFCA 3LXFA 1ESFA 1PDXA 2WP9B 3PLUA 1YX5B 4MDKE 2XBBC 2OEDA 2HD5B 3RNCC 3U52E 2VRRB 3DHHC 2J42A 2XK5B 3MFGA 1RAXA 1V2YA 2JQRB 4IM3A 3L16A 2KJ6A 3WALA 4FLHA 1Q5WB 1RFKA 1PQSA 4MH8A 1T6BX 2PIAA 3R7RA 1KLGD 1WGHA 1U4AA 2WWZA 1YQBA 2PPHA 3Q2AC 1UGMA 1E90A 4IC7B 1HZ5A 1WM2A 3P42A 2G4DB 2KYWA 3BIID 4LDTD 3CF6E 5J18A 3RFZB 2YLMA 4AQ7A 1FEHA 4RH6A 2ACZB 4II2B 4DBGA 3HM6X 4JIOU 1H4RA 3AEFB 5KHQA 1YMHE 3JVZX 4W9CA 2KMCA 1IGDA 5FKAC 4PT5A 4LCDE 1MG4A 2WXGA 1K52A 2VZKB 5HHDG 2FBWB 2NTTA 4MM3B 3DBLB 4ZYSA 1QKZA 1ZP0B 1NI3A 3TL5A 1QQRA 3R2TA 2K25A 3K9OB 1TY0A 1ZE3D 4N58A 4M0WA 2WXOA 1WGRA 3ZJVA 1KM7A 4A6QA 2OJWA 3W2DA 3P4QB 3ML9A 1E6EB 2I38A 4KSKC 2W55A 3VTWA 3W5UB 5BMHA 4RGTA 2FCQA 2KHWB 3AE5B 2RD0A 2V0GA 2G1EA 2JXTA 3X23A 3ZTCA 1HZ6A 2KMAA 3LYYA 3NG0A 3T8MA 4ANUA 2WX0A 3KWLA 1ZUD2 2G4SA 1V5OA 1KOTA 2ZNVB 1R4MI 3APDA 1RWSA 2CJOA 2MX2A 1FRDA 3PS6A 1YD8U 2FCMA 4WQOB 1D4BA 3UF8A 3CSTA 2BQQA 2AYOB 2IPKD 1I7HA 4GSWA 1EU3A 2L76A 3VTUA 3DVGX 3AU4A 3NZSA 3H1UA 1C3TA 3JSVB 4MSMB 3VDZA 3AEBB 5AZHA 3W1SA 4XC2A 1V97A 4K81A 2WDQB 3IXSA 1VLBA 1QOFA 3V3XA 1FM0D 3TUOA 2XNAC 1XCTL 4WQMA 4PK1A 2IO0B 3KLSX 2DAFA 3AB5A 3GOEA 2Y3AA 1OEYA 2LGYA 4GMVA 2MWSB 3Q8BA 4I6LB 5AEKB 5BYSA 3BK1A 1C4PA 3D32A 1T0QC 4OZBA 2M56B 1P9DU 1E8WA 2GI9A 3RNBC 4W9HA 4YTMB 2KC2A 1UZXB 1V80A 4RGNA 2WQYB 2C60A 3ZYYX 1ZDXA 2EMTA 2GBNA 3E56A 3PGEA 1NYRA 3ZRCA 3QK0A 3DBRB 4IWQA 2HTHA 3T3OA 4IUMB 2ZCCA 4HDOA 3NRZA 2N7DA 1QILA 4W9KA 2Y5BB 2W3SA 2KWCA 1MHHE 4A3OA 2N9XA 1FMAD 4KV2A 2LI5A 4IWOA 2LRWA 1FO4A 2LJIA 2J0KA 1FCCC 4F8CB 3U30A 5L83A 4A90A 3EGRA 1IBXA 1WXMA 4USAA 5LXIB 3ZQ4A 2IGGA 1ENFA 2OHFA 2WXQA 1XEEA 2C7NB 1B9RA 1K53A 1I4XA 5LNK1 3OJ4B 1HTQA 2BB6A 2I2YA 1P3QU 3ZNID 2ZPYA 4I6NB 4DHJB 5BMGA 2BVCA 1TS5A 2BS2B 2H88B 2D11A 1WJUA 4FBJB 3OAWA 3I9V1 4L1BA 1LGRA 1UF0A 1V86A 1WXSA 2KJRA 1L4DB 3B2GA 1TBEA 2WX1A 4F1SA 2L0FA 4RMAA 4M8MA 3SFDB 4ZHPA 5G55A 4BOSC 4AJWA 3GP7A 1YJ1A 4HROA 1GOZA 1I35A 5E6NA 4BKGA 2KJHB 1ET6A 2WDRB 3L08A 1WGGA 1MVKA 1CK1A 1AW7A 1FNUA 1QT9A 3ZJTA 1AWDA 4DXAB 4BVUC 3VTVA 2J0JA 2YEPF 4WWNA 1RFAA 3L4PA 3I63C 4AP4C 1VRAB 3U7DA 1SGHA 4GIVA 3NJTA 5EE3A 1FFVA 1WE6A 3A1QA 2O2VA 2KT7A 3DHIC 4FN2A 2PKOA 1C79A 1IGCA 3MHSD 2WYQA 4M00A 3WA0A 1MJDA 2AEHA 2MRPA 1KH0A 1VR9A 4WJPA 3N9YC 1MG8A 4FJZA 4DHJD 2LVOA 2WHIA 1L0VB 2ONQA 4ZRJA 1LO5D 2AQ3B 2L05A 3GE8C 3OWEB 4N6EB 4NNJB 2Z59B 2ZEQA 1Y56A 1FIQA 3PZ7A 3Q3FA 1YNTE 1E9MA 1GNUA 3FKYA 3KUZA 2B3AA 2WU5B 2BPSA 1XLOA 3ONSA 4PS7A 2K5PA 2I1KA 1TS4A 2ZNVC 3CSFA 1ROEA 2BYVE 4EZLA 1YJJA 2NPTB 3AE9B 4KSLC 3V6EB 2FIFA 3AU5A 3AE3B 3N3KB 4A9AA 2PE6B 5G5HA 3HUIA 4IM0A 1VDVA 1C78A 1J7CA 1JCKB 4FXCA 3GE3C 2UWQA 2WLBA 4EE2A 3PSEB 5D2MB 3IT6B 2JT4B 1GAQB 4M02A 1R4NB 1K8RB 2IY0B 4G11A 3ZDTA 2QHOA 4EZKA 1BMLC 2XN9C 2N9KA 1P98A 1TYGB 3ZDMC 4NAMA 4KDIC 4ASWC 3O13A 4A8XC 2L8JA 4E3CA 1R4MB 2ZVOA 4GLSC 3DWMA 3UIPB 5FR6A 1HXYD 3RNFC 2C9WB 3V6CB 3BYYB 3VH4B 4JPSA 1Y8RC 2L1AA 3NVZA 4WH4A 2L3ZA 1YQ3B 4JWSC 1YQ4B 1I4HA 2UU7A 4GU2A 2MBBB 4GOCA 2D2QA 2GB1A 3DBSA 3R2IA 2N4FA 1ET9A 2CR5A 2KKCA 2LGXA 3DOWA 3HM3A 3W1YA 1MI0A 2D07B 5D6JB 4B95A 2MBHA 3P1MA 4N59A 1UELA 3PHWB 3Q14C 2KANA 4XWTA 5EDSA 2KDFB 3ZXRA 4MT5A 4YTPB 4DXFA 4HEA1 3IFWB 1WX7A 3A4RA 2ZW0A 4HXDA 1NEKB 2M17A 1P0RA 3N1YC 2KDIA 4F7ZA 4NQKE 1IP9A 1V1PB 1T0YA 1Q0WB 2KTRB 2CU3A 2KXJA 1WYGA 4RNAA 2Y5PA 4YL8A 4IOIE 1AN8A 1E7PB 2MBQA 5DPTA 5EE9A 1N5WA 2GBMA 4BKSA 3Q8AA 1FD6A 4RCOA 4IDIA 3ZLZA 5D7GA 2QCZA 4JL9A 3QX1A 3URYA 2O6VA 1A70A 5CHWA 5IOIA 4XE0A 3NS8A 3WCQA 2RDHA 3CIRB 2KTRA 2N1VA 3ZUNA 3TEYA 2NR2A 4HJGE 2PTLA 1L0XB 4GDKB 4NJCA 4HCNB 4S0RA 1UBIA 3A33B 2LHDA 3HVZA 2IDYA 1RYJA 3QCAA 2K8HA 2RR9A 4WJNA 3BZDB 2PEAA 1YIWA 3APCA 3TBLD 2ZPNA 1FCLA 5L95C 1D5XC 3AI5A 4DXGA 2LD9A 4A20A 1YN3A 3J9CA 1VZ6A 1TS2A 4BKTA 4OZAA 3PRZA 2ASQA 3UI3A 3DVGY 1TY2A 3P4SB 2AQ2B 3TEWA 2KWVB 1WXVA 2BBCA 1PGBA 3WIMA 3FAHA 2YVCA 4HPPA 1TKEA 3Q69A 3O65B 2FNJB 4GDLB 4KVGB 4M0WB 3Q3NC 2ZCBA 2KTFA 2CJNA 3NVWA 2WXNA 1ACCA 5C3JB 2Z0DB 2MJDA 2W3RA 5H8YE 3JSVA 4RGOS 2BF8B 1XLQA 4XZ4A 5AZFA 1SIFA 1H8CA 3RNEC 3U4EG 4OW0A 1LFDA 3CMMB 1DOIA 3R8BA 1JROA 3EFUA 3A4SC 2LGDA 1JWAD 4AJYB 1RM6C 2V9HA 4W9GA 1TT5B 1PUTA 5G2NA 3VH3B 1LQBA 2MQJA 4HPMB 2LVPA 4DK5A 3AULA 1C76A 2LASA 4MJSA 4HPLB 4UDUC 3ZKJC 4KZ0A 1F1HA 3GZNI 3PT2B 3V05A 1SIJA 2PMVA 1WM3A 3AECB 1NYQA 4J6IA 4LJPB 3AEEB 2N7JA 2KLGA 4LJOB 3Q3MC 2KFKB 4BKSD 2FCSA 4O1NA 4MACA 1P7FA 2CHZA 4AOFA 4US9A 1J0GA 2K1FA 3VQIA 3VRAB 3H7SA 2BKRB 2BGFA 3R7QA 2LFIA 4IW0A 3ECIA 1WJ6A 1V1PA 1E8XA 4QAYA 2KDEB 4W9DA 2D5GA 3BY4B 3AEGB 1P7EA 4LTUA 3PLVA 2NCNA 2KN4A 4A55A 1TKYA 1F2RC 2A5UA 1P1AA 3W1SC 3VHTC 3ZO5B 3MJ5A 2AL3A 3FC4A 3AM9A 1ZGUB 2DZKA 1XT9B 2WDVB 1KTKA 3M62B 2MP2B 2QILA 2BWFA 1Z5SB 2KC1A 5J2RA 5IN7A 2KX3A 3U7ZA 2DNFA 3EA6A 3EECA 3NHEB 3WAPA 1T3QA 2Z8LA 2E3TA 2CKHB 2LRUA 3N1ZC 4ZDVA 2WNMA 3A9JA 2CHXA 3HK0A 2JZPA 5BO4B 4BBNC 3PTFC 1FRRA
chains in the Genus database with same CATH topology
4MM3A 3U7DA 4ZYNA 1SGHA 3L17A 4GIVA 3R66C 4X57B 3KUCB 4IG7B 2N7EA 3U8ZA 1WE6A 3A1QA 1WYWB 4GGQA 2C5LC 2AL6A 2O2VA 2N9PC 4FN2A 1WX9A 2K39A 2ZZPB 3EC8A 3SHQA 3MTNB 3RUIB 1ZKHA 4MEMA 3MHSD 4DHZB 2WYQA 3WA0A 2AEHA 3UIOB 1GC6A 2JZ3B 2MRPA 3V60A 4WJPA 2D3GA 1MG8A 4FJZA 2KFKA 2BYEA 4DHJD 2LVOA 4PYZA 2MLBA 3PPAA 3R3MA 1WZ3A 4I6PA 3UGBB 2G45B 1WXAA 3MJWA 4ZRJA 1J19A 3DBHI 3IG3A 3ALBA 2L05A 2O2VB 4NJ7A 1E8ZA 2IO1B 2DAJA 4CYEA 4NNJB 4TUUA 2JRIB 4MH0E 2PE9A 5IA7A 3A9KB 4NQLB 2Z59B 3PHXB 1C1YB 2ZEQA 2N9EB 4ANWA 4FADA 3Q3FA 2XK5A 1GNUA 2RSUA 3DPDA 3KUZA 4PYUA 3KW5B 2B3AA 1TTNA 2DX5B 2BPSA 4MSQB 2MA9B 1WF9A 1WJ4A 2NBWB 3VUWA 4K1RB 3ONSA 2NBVB 4PS7A 2I1KA 2L7RA 2DZIA 2ZNVC 3B1LX 3CSFA 2KO3A 2BYVE 3RCZA 1V6EA 4EZLA 2NPTB 4HK2A 2OOBB 4KSLC 3V6EB 2FIFA 5CTRC 1CMXB 2R2OA 3L10B 3AU5A 4EEWA 3OJ3A 1IYFA 2JPHA 2UYZB 1V81A 4HJKA 2CHWA 1ISNA 3QQ8B 1XD3B 3N3KB 4HDQA 3T9LA 2LVQA 2NBUA 2PE6B 1GG3A 2OJRA 2C7MB 4IM0A 4MGIE 1WIAA 4K7UA 1HE8A 4ANXA 4NJ6A 4EFOA 4JLCA 4FJVB 3EHVA 4NAWB 5JHAA 5JH5C 2M8SA 4OVVA 4EUTA 3DVNV 3ZRFA 4BBNF 2UWQA 3PSEB 5D2MB 2JT4B 1WMHB 4G50A 4W9JA 2GBRA 2K6DB 1EUVB 4DWFA 2KD0A 1K8RB 4K7SA 5JZEB 4GDKA 2IY0B 4G11A 3ZDTA 2QHOA 2L0TA 2MCNB 3PZDA 4EZKA 1G6JA 3WAMA 1OGWA 1EF5A 1P98A 4RM9A 3ZDMC 3ZNGC 2KK8A 3KUDB 1YX5B 3PLUA 4KDIC 4MDKE 2XBBC 4ASWC 3KYDD 4EKUA 3VVWB 2HD5B 2L8JA 4ICUA 4GXBA 2VRRB 4MGYE 2FUHB 3NOBA 4E3CA 2XK5B 4XX5A 3UQBA 3RD2A 2ZVOA 4JQWC 4W9IA 4PS3A 2M1MA 1RAXA 1V2YA 3DQVA 4IM3A 2BKFA 3UIPB 4HCPB 5FR6A 1EF1A 2C9WB 3L16A 3V6CB 2KJ6A 3WALA 4FLHA 3VH4B 2DENB 1V9JA 4HLEA 4FHKA 1Y8RC 2JVCA 1IPGA 3ZVVA 2L3ZA 2W9NA 1Q5WB 2FAZA 4GU2A 3QA8A 1PQSA 2MBBB 4ANVA 3B08A 5DPRA 4DDID 4GOCA 2D2QA 3DBSA 2N4FA 2KKCA 2CR5A 1E8YA 2LGXA 2LUEA 3R7RA 5J17A 1KLVA 1WGHA 2MP2A 3DOWA 3HM3A 4NY0A 4WAAA 1WR1A 4WWPA 5HKHA 3W1YA 4G0NB 1U4AA 4AWJA 1D3ZA 2D07B 2WWZA 5D6JB 4ZRIA 4B95A 4JGHB 2MBHA 1YQBA 2PPHA 1UELA 1UGMA 1E90A 1WE7A 4IC7B 2V1YA 3PHWB 3S2AA 1WM2A 2GMIC 2G4DB 2KANA 3APFA 3UINB 1VCBA 5EDSA 3H6NA 2K8CA 4PS8A 2CS4A 2ZVNA 1WJNA 4LDTD 5IAAC 3CF6E 5J18A 3PV1A 3OLMD 1UBQA 2YLMA 2KDFB 3ZTDA 5DPWA 2IY1B 3IFWB 3B0AA 3ML8A 3AXCA 3VFKA 4MGKE 1WX7A 3TJPA 1VD2A 3A4RA 4II2B 1WRDB 2LJ5A 4HXDA 4DBGA 3JW0X 4K7WA 2M17A 3SDLC 1P0RA 1TZ1A 3HM6X 2KDIA 1S3SG 4JIOU 4F7ZA 4NQKE 1H4RA 4W9LA 3RYTA 1IP9A 1T0YA 3H9DA 4GDLA 5KHQA 1Q0WB 3JVZX 4W9CA 5TR5A 2KTRB 2EKEC 2KXJA 2KMCA 3DCGA 4YL8A 3V61A 4LCDE 3QARA 1WZ0A 5C23A 3QHTA 2MBQA 4M8NA 5DPTA 1V5TA 2KQSA 2GBMA 3VAWA 1WGDA 3I3TB 4BKSA 3NY5A 1M94A 5DCNA 3C0RB 3ZLZA 1OEYJ 1F9JA 4HWIB 5D7GA 2L00B 2IZVB 3KYCD 4JL9A 3RZWC 2J7QB 2K25A 3QX1A 4MGZE 3K9OB 3TL5A 2KZRA 2O6VA 5AZGA 5CHWA 4GB9A 1GUAB 3NS8A 1E7UA 3PRPB 2FIDA 3WAOA 3M63B 1WGRA 5GMVA 5LXHA 4DHZE 1KM7A 2KTRA 2KVRA 2AWTA 4WJOA 2N1VA 3N30A 3A1QB 3ZUNA 2NR2A 4FA6A 4KDLB 4GDKB 4EOYA 4HCNB 3ZW3A 1UBIA 3A33B 3ML9A 4TQ0A 2MW5A 3M3JA 3VXWA 4KIKA 4KSKC 4OVUA 3VTWA 3WANA 4TKNA 2FCQA 2KHWB 3PREA 2JXXA 3QCAA 2NS5A 2K8HA 2RR9A 2RD0A 3A9JB 3PVLA 4MELA 4WJNA 5CHVC 2PEAA 4HVBA 3L13A 1YIWA 3X23A 3ZTCA 2KMAA 1RRBA 3APCA 3T8MA 3HHMA 1XQQA 3TBLD 3VUXA 2ZPNA 4KZCA 4W9EA 2LWPA 3KVFB 5CX3A 3Q3JA 1WMHA 2WX0A 4ANUA 2G4SA 1V5OA 5L95C 3AI5A 3PRMB 1KOTA 2LD9A 2ZNVB 3SD5A 1R4MI 3APDA 4A20A 5CHFA 2I1JA 2J0MA 1NDDA 4BKTA 1A5RA 1WR6E 1LXDA 3PRZA 3L0WB 2MX2A 3PS6A 1UD7A 1YD8U 2ASQA 2FCMA 3DVGY 4WQOB 2M0XA 3UF8A 3ZNZB 5D94A 3CSTA 4P7IA 2AYOB 4GSWA 1GJZA 1QZEA 2KWVB 1WXVA 3DBLI 2KNBA 2L76A 2KN5A 3VTUA 1RLFA 1R4NI 3DVGX 3AU4A 4ICVA 1ZW7A 3NZSA 2YVCA 3H1UA 3WIMA 2NPTA 1C3TA 2V3SA 1OQYA 3L54A 1S1QB 3QIJA 4ZRKA 2DZMA 3JSVB 1YX6B 4MSMB 2CU1A 3V62A 3O65B 4BOZB 3VDZA 5AZHA 3W1SA 3H7PA 2FNJB 4GDLB 4XC2A 4KVGB 1KJTA 4M0WB 4BFRA 1LM8B 2ZCBA 2KTFA 4K81A 1SE9A 4AUQC 1EO6A 1OTRB 3ENEA 2DYBA 4FHJA 4FULA 2Z0DB 5E6OA 3ZNHB 2Z0EB 4II3B 3IVFA 2G3QB 2IO0B 2KX0A 1I42A 3JSVA 2BF8B 4XZ4A 2DAFA 5AZFA 4EZJA 3GOEA 2IYDB 1SIFA 3RT3B 1H8CA 2N1WA 1OEYA 2LGYA 4GMVA 3RZFA 2MWSB 4I6LB 1WX8A 4MJSB 5AEKB 3H7PB 1LFDA 2IBIB 3CMMB 1FXTB 4NPNA 4B9KA 3D32A 4IWPA 3EFUA 3A4SC 2D10A 2DHZA 4N9F4 2IO3B 2K8BA 3P2BA 1P9DU 5C1ZA 1E8WA 2HJ8A 2LGDA 2MBEA 4W9HA 1J8CA 4AJYB 2KQ7A 2KC2A 1UZXB 4W9GA 2DZJA 2DYOA 1V80A 5G2NA 4DDGD 3VH3B 2GBKA 2V4LA 1LQBA 2MQJA 2C60A 2EMTA 4HPMB 1AARA 2GBNA 2BYFA 2LVPA 3PGEA 1L2NA 2IO2B 1NI2A 4CHKA 2JF5A 3ZRCA 4DK5A 5DPSA 3AULA 1JRUA 3QK0A 3IHPC 2LASA 2LXAA 4MJSA 4TV3A 4IWQA 2HTHA 4HPLB 3ZKJC 4KZ0A 1NBFC 3QJZA 4GN1A 4IUMB 3TCAA 2ZCCA 4HDOA 4W9FA 3GZNI 3PT2B 3JYUA 2N7DA 3M95A 5JHBA 1E5WA 1WM3A 4W9KA 3DDCB 2Y5BB 4J6IA 2KWCA 4LJPB 2LXCA 4A3OA 2O6VD 2N9XA 2C7HA 4KV2A 2LI5A 3DBRI 2LRWA 4IWOA 2FCNA 2KLGA 4LJOB 2JWZA 2J0KA 3KH0A 1GC7A 3U30A 4F8CB 5L83A 2HE7A 1WI0A 2KFKB 2GBJA 4BKSD 2MBOA 1WXMA 1X1MA 2FCSA 2JZZA 2A4ZA 1WH3A 3K9PB 4IM2A 5LXIB 2CHZA 4AOFA 4URKA 5LLIA 2EMSA 3QWZB 3IBEA 1J0GA 2NVUI 2R2QA 2K1FA 3VQIA 3H7SA 2BKRB 2BGFA 2C7NB 4WJQA 3R7QA 2REXA 4IW0A 3ECIA 3BINA 1WJ6A 3OJ4B 4B6WA 4KIKB 2ZJDA 4LDTB 1E8XA 1P3QU 2KWUB 3SU8X 3ZNID 2ZPYA 1Q1OA 4I6NB 4RM8A 4DHJB 1WY8A 4E74A 2KDEB 3N32A 4W9DA 2D11A 4CO7A 3BY4B 2KLCA 1WFYA 3VUYA 1WJUA 2KOXA 2LZ6A 3PLVA 2NCNA 3X0WA 3DVNU 2XEWA 1BT0A 4WWOA 4FBJB 3OAWA 1V86A 2O6VB 3QAQA 2JRHA 1WXSA 2A5UA 1Z2MA 1P1AA 3HIZA 3W1SC 2KJRA 4TQ1A 3VHTC 3ZO5B 3NZUA 1TGZB 2BWES 2AL3A 2JY6A 1TBEA 1ZGUB 2DZKA 1XT9B 2KDBA 2WX1A 4F1SA 2L0FA 2MSED 4RMAA 4M8MA 4NAWA 5G55A 4BOSC 2WDTB 4FJYA 2RPQA 4AJWA 2M4NA 3QC8B 1YJ1A 3M62B 2MP2B 3A9KA 5E6PA 2BWFA 2KFJA 3LJ3A 1Z5SB 3ZIMA 5E6NA 1I35A 1L7YA 2JUOA 2KC1A 4BKGA 5J2RA 2KJHB 1WGYA 2KX3A 2PJHA 3L08A 1E7VA 1UH6A 2GOWA 1WGGA 3TMPB 4G3XB 2K6QA 4E71A 3EECA 3NHEB 2DYMA 2RGFA 1V49A 3WAPA 4DXAB 4A3PA 4BVUC 3VTVA 3UQAA 3PTFC 2J0JA 2CKHB 1RFAA 2LRUA 4WWNA 3RULA 4ZDVA 3A9JA 4AP4C 2CHXA 3HK0A 5BO4B 5KHOA 4BBNC 3LDZE 3TIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MM3 A;  3U7D A;  4ZYN A;  1SGH A;  3L17 A;  4GIV A;  3R66 C;  4X57 B;  3KUC B;  4IG7 B;  2N7E A;  3U8Z A;  1WE6 A;  3A1Q A;  1WYW B;  4GGQ A;  2C5L C;  2AL6 A;  2O2V A;  2N9P C;  4FN2 A;  1WX9 A;  2K39 A;  2ZZP B;  3EC8 A;  3SHQ A;  3MTN B;  3RUI B;  1ZKH A;  4MEM A;  3MHS D;  4DHZ B;  2WYQ A;  3WA0 A;  2AEH A;  3UIO B;  1GC6 A;  2JZ3 B;  2MRP A;  3V60 A;  4WJP A;  2D3G A;  1MG8 A;  4FJZ A;  2KFK A;  2BYE A;  4DHJ D;  2LVO A;  4PYZ A;  2MLB A;  3PPA A;  3R3M A;  1WZ3 A;  4I6P A;  3UGB B;  2G45 B;  1WXA A;  3MJW A;  4ZRJ A;  1J19 A;  3DBH I;  3IG3 A;  3ALB A;  2L05 A;  2O2V B;  4NJ7 A;  1E8Z A;  2IO1 B;  2DAJ A;  4CYE A;  4NNJ B;  4TUU A;  2JRI B;  4MH0 E;  2PE9 A;  5IA7 A;  3A9K B;  4NQL B;  2Z59 B;  3PHX B;  1C1Y B;  2ZEQ A;  2N9E B;  4ANW A;  4FAD A;  3Q3F A;  2XK5 A;  1GNU A;  2RSU A;  3DPD A;  3KUZ A;  4PYU A;  3KW5 B;  2B3A A;  1TTN A;  2DX5 B;  2BPS A;  4MSQ B;  2MA9 B;  1WF9 A;  1WJ4 A;  2NBW B;  3VUW A;  4K1R B;  3ONS A;  2NBV B;  4PS7 A;  2I1K A;  2L7R A;  2DZI A;  2ZNV C;  3B1L X;  3CSF A;  2KO3 A;  2BYV E;  3RCZ A;  1V6E A;  4EZL A;  2NPT B;  4HK2 A;  2OOB B;  4KSL C;  3V6E B;  2FIF A;  5CTR C;  1CMX B;  2R2O A;  3L10 B;  3AU5 A;  4EEW A;  3OJ3 A;  1IYF A;  2JPH A;  2UYZ B;  1V81 A;  4HJK A;  2CHW A;  1ISN A;  3QQ8 B;  1XD3 B;  3N3K B;  4HDQ A;  3T9L A;  2LVQ A;  2NBU A;  2PE6 B;  1GG3 A;  2OJR A;  2C7M B;  4IM0 A;  4MGI E;  1WIA A;  4K7U A;  1HE8 A;  4ANX A;  4NJ6 A;  4EFO A;  4JLC A;  4FJV B;  3EHV A;  4NAW B;  5JHA A;  5JH5 C;  2M8S A;  4OVV A;  4EUT A;  3DVN V;  3ZRF A;  4BBN F;  2UWQ A;  3PSE B;  5D2M B;  2JT4 B;  1WMH B;  4G50 A;  4W9J A;  2GBR A;  2K6D B;  1EUV B;  4DWF A;  2KD0 A;  1K8R B;  4K7S A;  5JZE B;  4GDK A;  2IY0 B;  4G11 A;  3ZDT A;  2QHO A;  2L0T A;  2MCN B;  3PZD A;  4EZK A;  1G6J A;  3WAM A;  1OGW A;  1EF5 A;  1P98 A;  4RM9 A;  3ZDM C;  3ZNG C;  2KK8 A;  3KUD B;  1YX5 B;  3PLU A;  4KDI C;  4MDK E;  2XBB C;  4ASW C;  3KYD D;  4EKU A;  3VVW B;  2HD5 B;  2L8J A;  4ICU A;  4GXB A;  2VRR B;  4MGY E;  2FUH B;  3NOB A;  4E3C A;  2XK5 B;  4XX5 A;  3UQB A;  3RD2 A;  2ZVO A;  4JQW C;  4W9I A;  4PS3 A;  2M1M A;  1RAX A;  1V2Y A;  3DQV A;  4IM3 A;  2BKF A;  3UIP B;  4HCP B;  5FR6 A;  1EF1 A;  2C9W B;  3L16 A;  3V6C B;  2KJ6 A;  3WAL A;  4FLH A;  3VH4 B;  2DEN B;  1V9J A;  4HLE A;  4FHK A;  1Y8R C;  2JVC A;  1IPG A;  3ZVV A;  2L3Z A;  2W9N A;  1Q5W B;  2FAZ A;  4GU2 A;  3QA8 A;  1PQS A;  2MBB B;  4ANV A;  3B08 A;  5DPR A;  4DDI D;  4GOC A;  2D2Q A;  3DBS A;  2N4F A;  2KKC A;  2CR5 A;  1E8Y A;  2LGX A;  2LUE A;  3R7R A;  5J17 A;  1KLV A;  1WGH A;  2MP2 A;  3DOW A;  3HM3 A;  4NY0 A;  4WAA A;  1WR1 A;  4WWP A;  5HKH A;  3W1Y A;  4G0N B;  1U4A A;  4AWJ A;  1D3Z A;  2D07 B;  2WWZ A;  5D6J B;  4ZRI A;  4B95 A;  4JGH B;  2MBH A;  1YQB A;  2PPH A;  1UEL A;  1UGM A;  1E90 A;  1WE7 A;  4IC7 B;  2V1Y A;  3PHW B;  3S2A A;  1WM2 A;  2GMI C;  2G4D B;  2KAN A;  3APF A;  3UIN B;  1VCB A;  5EDS A;  3H6N A;  2K8C A;  4PS8 A;  2CS4 A;  2ZVN A;  1WJN A;  4LDT D;  5IAA C;  3CF6 E;  5J18 A;  3PV1 A;  3OLM D;  1UBQ A;  2YLM A;  2KDF B;  3ZTD A;  5DPW A;  2IY1 B;  3IFW B;  3B0A A;  3ML8 A;  3AXC A;  3VFK A;  4MGK E;  1WX7 A;  3TJP A;  1VD2 A;  3A4R A;  4II2 B;  1WRD B;  2LJ5 A;  4HXD A;  4DBG A;  3JW0 X;  4K7W A;  2M17 A;  3SDL C;  1P0R A;  1TZ1 A;  3HM6 X;  2KDI A;  1S3S G;  4JIO U;  4F7Z A;  4NQK E;  1H4R A;  4W9L A;  3RYT A;  1IP9 A;  1T0Y A;  3H9D A;  4GDL A;  5KHQ A;  1Q0W B;  3JVZ X;  4W9C A;  5TR5 A;  2KTR B;  2EKE C;  2KXJ A;  2KMC A;  3DCG A;  4YL8 A;  3V61 A;  4LCD E;  3QAR A;  1WZ0 A;  5C23 A;  3QHT A;  2MBQ A;  4M8N A;  5DPT A;  1V5T A;  2KQS A;  2GBM A;  3VAW A;  1WGD A;  3I3T B;  4BKS A;  3NY5 A;  1M94 A;  5DCN A;  3C0R B;  3ZLZ A;  1OEY J;  1F9J A;  4HWI B;  5D7G A;  2L00 B;  2IZV B;  3KYC D;  4JL9 A;  3RZW C;  2J7Q B;  2K25 A;  3QX1 A;  4MGZ E;  3K9O B;  3TL5 A;  2KZR A;  2O6V A;  5AZG A;  5CHW A;  4GB9 A;  1GUA B;  3NS8 A;  1E7U A;  3PRP B;  2FID A;  3WAO A;  3M63 B;  1WGR A;  5GMV A;  5LXH A;  4DHZ E;  1KM7 A;  2KTR A;  2KVR A;  2AWT A;  4WJO A;  2N1V A;  3N30 A;  3A1Q B;  3ZUN A;  2NR2 A;  4FA6 A;  4KDL B;  4GDK B;  4EOY A;  4HCN B;  3ZW3 A;  1UBI A;  3A33 B;  3ML9 A;  4TQ0 A;  2MW5 A;  3M3J A;  3VXW A;  4KIK A;  4KSK C;  4OVU A;  3VTW A;  3WAN A;  4TKN A;  2FCQ A;  2KHW B;  3PRE A;  2JXX A;  3QCA A;  2NS5 A;  2K8H A;  2RR9 A;  2RD0 A;  3A9J B;  3PVL A;  4MEL A;  4WJN A;  5CHV C;  2PEA A;  4HVB A;  3L13 A;  1YIW A;  3X23 A;  3ZTC A;  2KMA A;  1RRB A;  3APC A;  3T8M A;  3HHM A;  1XQQ A;  3TBL D;  3VUX A;  2ZPN A;  4KZC A;  4W9E A;  2LWP A;  3KVF B;  5CX3 A;  3Q3J A;  1WMH A;  2WX0 A;  4ANU A;  2G4S A;  1V5O A;  5L95 C;  3AI5 A;  3PRM B;  1KOT A;  2LD9 A;  2ZNV B;  3SD5 A;  1R4M I;  3APD A;  4A20 A;  5CHF A;  2I1J A;  2J0M A;  1NDD A;  4BKT A;  1A5R A;  1WR6 E;  1LXD A;  3PRZ A;  3L0W B;  2MX2 A;  3PS6 A;  1UD7 A;  1YD8 U;  2ASQ A;  2FCM A;  3DVG Y;  4WQO B;  2M0X A;  3UF8 A;  3ZNZ B;  5D94 A;  3CST A;  4P7I A;  2AYO B;  4GSW A;  1GJZ A;  1QZE A;  2KWV B;  1WXV A;  3DBL I;  2KNB A;  2L76 A;  2KN5 A;  3VTU A;  1RLF A;  1R4N I;  3DVG X;  3AU4 A;  4ICV A;  1ZW7 A;  3NZS A;  2YVC A;  3H1U A;  3WIM A;  2NPT A;  1C3T A;  2V3S A;  1OQY A;  3L54 A;  1S1Q B;  3QIJ A;  4ZRK A;  2DZM A;  3JSV B;  1YX6 B;  4MSM B;  2CU1 A;  3V62 A;  3O65 B;  4BOZ B;  3VDZ A;  5AZH A;  3W1S A;  3H7P A;  2FNJ B;  4GDL B;  4XC2 A;  4KVG B;  1KJT A;  4M0W B;  4BFR A;  1LM8 B;  2ZCB A;  2KTF A;  4K81 A;  1SE9 A;  4AUQ C;  1EO6 A;  1OTR B;  3ENE A;  2DYB A;  4FHJ A;  4FUL A;  2Z0D B;  5E6O A;  3ZNH B;  2Z0E B;  4II3 B;  3IVF A;  2G3Q B;  2IO0 B;  2KX0 A;  1I42 A;  3JSV A;  2BF8 B;  4XZ4 A;  2DAF A;  5AZF A;  4EZJ A;  3GOE A;  2IYD B;  1SIF A;  3RT3 B;  1H8C A;  2N1W A;  1OEY A;  2LGY A;  4GMV A;  3RZF A;  2MWS B;  4I6L B;  1WX8 A;  4MJS B;  5AEK B;  3H7P B;  1LFD A;  2IBI B;  3CMM B;  1FXT B;  4NPN A;  4B9K A;  3D32 A;  4IWP A;  3EFU A;  3A4S C;  2D10 A;  2DHZ A;  4N9F 4;  2IO3 B;  2K8B A;  3P2B A;  1P9D U;  5C1Z A;  1E8W A;  2HJ8 A;  2LGD A;  2MBE A;  4W9H A;  1J8C A;  4AJY B;  2KQ7 A;  2KC2 A;  1UZX B;  4W9G A;  2DZJ A;  2DYO A;  1V80 A;  5G2N A;  4DDG D;  3VH3 B;  2GBK A;  2V4L A;  1LQB A;  2MQJ A;  2C60 A;  2EMT A;  4HPM B;  1AAR A;  2GBN A;  2BYF A;  2LVP A;  3PGE A;  1L2N A;  2IO2 B;  1NI2 A;  4CHK A;  2JF5 A;  3ZRC A;  4DK5 A;  5DPS A;  3AUL A;  1JRU A;  3QK0 A;  3IHP C;  2LAS A;  2LXA A;  4MJS A;  4TV3 A;  4IWQ A;  2HTH A;  4HPL B;  3ZKJ C;  4KZ0 A;  1NBF C;  3QJZ A;  4GN1 A;  4IUM B;  3TCA A;  2ZCC A;  4HDO A;  4W9F A;  3GZN I;  3PT2 B;  3JYU A;  2N7D A;  3M95 A;  5JHB A;  1E5W A;  1WM3 A;  4W9K A;  3DDC B;  2Y5B B;  4J6I A;  2KWC A;  4LJP B;  2LXC A;  4A3O A;  2O6V D;  2N9X A;  2C7H A;  4KV2 A;  2LI5 A;  3DBR I;  2LRW A;  4IWO A;  2FCN A;  2KLG A;  4LJO B;  2JWZ A;  2J0K A;  3KH0 A;  1GC7 A;  3U30 A;  4F8C B;  5L83 A;  2HE7 A;  1WI0 A;  2KFK B;  2GBJ A;  4BKS D;  2MBO A;  1WXM A;  1X1M A;  2FCS A;  2JZZ A;  2A4Z A;  1WH3 A;  3K9P B;  4IM2 A;  5LXI B;  2CHZ A;  4AOF A;  4URK A;  5LLI A;  2EMS A;  3QWZ B;  3IBE A;  1J0G A;  2NVU I;  2R2Q A;  2K1F A;  3VQI A;  3H7S A;  2BKR B;  2BGF A;  2C7N B;  4WJQ A;  3R7Q A;  2REX A;  4IW0 A;  3ECI A;  3BIN A;  1WJ6 A;  3OJ4 B;  4B6W A;  4KIK B;  2ZJD A;  4LDT B;  1E8X A;  1P3Q U;  2KWU B;  3SU8 X;  3ZNI D;  2ZPY A;  1Q1O A;  4I6N B;  4RM8 A;  4DHJ B;  1WY8 A;  4E74 A;  2KDE B;  3N32 A;  4W9D A;  2D11 A;  4CO7 A;  3BY4 B;  2KLC A;  1WFY A;  3VUY A;  1WJU A;  2KOX A;  2LZ6 A;  3PLV A;  2NCN A;  3X0W A;  3DVN U;  2XEW A;  1BT0 A;  4WWO A;  4FBJ B;  3OAW A;  1V86 A;  2O6V B;  3QAQ A;  2JRH A;  1WXS A;  2A5U A;  1Z2M A;  1P1A A;  3HIZ A;  3W1S C;  2KJR A;  4TQ1 A;  3VHT C;  3ZO5 B;  3NZU A;  1TGZ B;  2BWE S;  2AL3 A;  2JY6 A;  1TBE A;  1ZGU B;  2DZK A;  1XT9 B;  2KDB A;  2WX1 A;  4F1S A;  2L0F A;  2MSE D;  4RMA A;  4M8M A;  4NAW A;  5G55 A;  4BOS C;  2WDT B;  4FJY A;  2RPQ A;  4AJW A;  2M4N A;  3QC8 B;  1YJ1 A;  3M62 B;  2MP2 B;  3A9K A;  5E6P A;  2BWF A;  2KFJ A;  3LJ3 A;  1Z5S B;  3ZIM A;  5E6N A;  1I35 A;  1L7Y A;  2JUO A;  2KC1 A;  4BKG A;  5J2R A;  2KJH B;  1WGY A;  2KX3 A;  2PJH A;  3L08 A;  1E7V A;  1UH6 A;  2GOW A;  1WGG A;  3TMP B;  4G3X B;  2K6Q A;  4E71 A;  3EEC A;  3NHE B;  2DYM A;  2RGF A;  1V49 A;  3WAP A;  4DXA B;  4A3P A;  4BVU C;  3VTV A;  3UQA A;  3PTF C;  2J0J A;  2CKH B;  1RFA A;  2LRU A;  4WWN A;  3RUL A;  4ZDV A;  3A9J A;  4AP4 C;  2CHX A;  3HK0 A;  5BO4 B;  5KHO A;  4BBN C;  3LDZ E;  3TIX A; 
#chains in the Genus database with same CATH topology
 2IGD A;  4KGR A;  1UWM A;  3KUC B;  2WXH A;  1N63 A;  3U8Z A;  4GGQ A;  1J7A A;  2YEP B;  1ZXI A;  3SHQ A;  3RUI B;  2FE8 A;  4DHZ B;  1EWC A;  3V60 A;  1PFD A;  2KFK A;  2BYE A;  4PYZ A;  3UGB B;  3ZXV A;  1NEN B;  3DBH I;  3IG3 A;  2G9H D;  2IO1 B;  4CYE A;  4TUU A;  2JRI B;  4NQL B;  2JU6 X;  2RSU A;  2H89 B;  3DPD A;  1TTN A;  2DX5 B;  4MSQ B;  4REZ A;  2J4X A;  1I4R A;  2V4I B;  2NBV B;  2L7R A;  3VR8 B;  1F0Z A;  4HK2 A;  2K3U A;  2OOB B;  2R2O A;  2HTM E;  3L10 B;  2JPH A;  1V81 A;  3QQ8 B;  2AQ1 B;  5MPO A;  3Q8E A;  5BMI A;  2OJR A;  2K0P A;  4ANX A;  4EFO A;  5JH5 C;  2WXJ A;  3RMK C;  4BBN F;  5G5G A;  3AED B;  2HDE A;  4G50 A;  4W9J A;  2GBR A;  1DYQ A;  4US8 A;  5JZE B;  1OQR A;  4XYC A;  4GDK A;  4L23 A;  2ON8 A;  2MCN B;  5JXV A;  1G6J A;  3ZNG C;  2KK8 A;  3BVM A;  1Q10 A;  4BZA A;  3KYD D;  4EKU A;  4ICU A;  5EE1 A;  4K3C A;  2FUH B;  3NOB A;  4XX5 A;  3RD2 A;  4JQW C;  4PS3 A;  2M1M A;  3DQV A;  2BKF A;  1EF1 A;  1QF6 A;  1HA5 A;  2DEN B;  3EUB 2;  4HLE A;  2JVC A;  1WRI A;  4IKG A;  1IPG A;  3ZVV A;  2W9N A;  4YSZ B;  4S17 A;  3QA8 A;  3W5V B;  4ANV A;  3B08 A;  5DPR A;  4DDI D;  1MPE A;  1E8Y A;  5J17 A;  1KLV A;  4WAA A;  4WWP A;  1WR1 A;  5HKH A;  1CZP A;  4AWJ A;  3NVV A;  1D3Z A;  2D3B A;  4JGH B;  1JQ4 A;  3SFE B;  4M01 A;  1QOG A;  2VZK D;  2GMI C;  3APF A;  3UIN B;  3H6N A;  2ZVN A;  1WJN A;  4C4V A;  1UBQ A;  3TEZ A;  1BUI C;  3VFK A;  4MGK E;  1SE2 A;  1VD2 A;  1FFU A;  1C4C A;  4YSY B;  1D5Z C;  2WGS A;  2LJ5 A;  5IO9 A;  3DHG C;  1PGA A;  3JW0 X;  2M0A A;  1S3S G;  4W9L A;  3RYT A;  4C7Z A;  1JRP A;  4JWU C;  3V61 A;  1WZ0 A;  1XLP A;  1V5T A;  1GB4 A;  1I4P A;  1WGD A;  5T8I A;  3CWI A;  1M94 A;  3FIL B;  1HQR D;  5DCN A;  1OEY J;  4HWI B;  2L00 B;  3RZW C;  2J7Q B;  4MGZ E;  3VR9 B;  2KZR A;  1DGJ A;  4GB9 A;  1GUA B;  1E7U A;  3PRP B;  2FID A;  1L5P A;  3WAO A;  1WGK A;  3TEX A;  2KVR A;  2AWT A;  2QEJ C;  3N30 A;  4KDL B;  3ZW3 A;  1C77 A;  2MW5 A;  3M3J A;  4KIK A;  3WAN A;  4TKN A;  2TSS A;  2NS5 A;  4HVB A;  3PVL A;  3A9J B;  4MEL A;  1SF0 A;  3L13 A;  3HHM A;  1EM7 A;  1D5M C;  1ZXH A;  4OVZ A;  5CX3 A;  2V3N A;  3Q3J A;  2PLP A;  2QIE B;  3SD5 A;  2J0M A;  1NDD A;  2I1J A;  4P16 A;  1A5R A;  4YXD B;  1LXD A;  1KLU D;  4J3O D;  1UD7 A;  3T3N A;  1T0S C;  3ZNZ B;  2N0S B;  5D94 A;  4ACF A;  2Q5W D;  3SEB A;  4P7I A;  1TIF A;  3PO0 A;  3AEA B;  1C4A A;  1QZE A;  1KFY B;  1EWY C;  2KN5 A;  1R4N I;  4ICV A;  4D2K A;  2V3S A;  4ZRK A;  1F52 A;  1YX6 B;  2QMT A;  4LNN A;  2CU1 A;  3V62 A;  1VZ8 A;  3AV8 A;  1I4Q A;  1KJT A;  2LEK A;  1CQV A;  2RMM A;  1WXQ A;  1JML A;  1LM8 B;  2LGI A;  1FNV A;  3GB1 A;  1EO6 A;  3I5J C;  1PYW D;  4FHJ A;  4FUL A;  1L4Z B;  3KWV A;  1AYF A;  4P1B C;  4II3 B;  2WXK A;  1OQQ A;  3IVF A;  1I42 A;  2NMQ A;  1L6U A;  4EZJ A;  2RDB C;  3Q8F A;  4RF0 A;  2N1W A;  2JYE A;  3PZ8 A;  2BT6 A;  2WU2 B;  3RZF A;  2WXP A;  1N6Z A;  1ZOY B;  4MJS B;  3H7P B;  1FXT B;  4NPN A;  4ARI A;  1QOB A;  2DHZ A;  2HJ8 A;  2MBE A;  1J8C A;  2KQ7 A;  2FUG 1;  3AMZ A;  2AX5 A;  1V1O A;  1F2R I;  4DDG D;  2GBK A;  3I57 A;  4OHJ A;  1E10 A;  2INN E;  1L2N A;  2X8X X;  2IO2 B;  1NI2 A;  3HVD A;  5DPS A;  1JRU A;  2LXA A;  1T0R C;  2ZW1 A;  4TV3 A;  1XLN A;  1NBF C;  3QJZ A;  1JW9 D;  4GN1 A;  3TCA A;  3M95 A;  1HEZ E;  1E5W A;  5JHB A;  3KQ4 A;  3DDC B;  1ZDV A;  2O6V D;  5FK9 C;  3KH0 A;  1SE3 A;  1WSP A;  3AN1 A;  1WI0 A;  2BB5 A;  2GBJ A;  4K3B A;  2W82 A;  1X1M A;  2JZZ A;  3MHZ A;  2A4Z A;  1SEB D;  4IM2 A;  1D6E C;  4URK A;  5LLI A;  2EMS A;  2NVU I;  2R2Q A;  2IJ0 A;  4HRS A;  4HKZ E;  3BIN A;  2K22 A;  4KIK B;  3SU8 X;  4RM8 A;  1WY8 A;  4CO7 A;  1B1Z A;  1WFY A;  2EEL A;  4RFB A;  3VUY A;  2LZ6 A;  2XEW A;  1BT0 A;  2LUM A;  4ZRP A;  4C4V B;  5EE0 A;  3AE2 B;  2JRH A;  2RDG A;  2KDM A;  3HIZ A;  4TQ1 A;  1J7B A;  2BWE S;  4RGM A;  2DWQ A;  2KDB A;  1K50 A;  2MSE D;  3C8Y A;  3BK2 A;  4FJY A;  2RPQ A;  3ETR A;  1SJE D;  3QC8 B;  3NVY A;  2KWD A;  5E6J A;  3A9K A;  3LJ3 A;  3ZIM A;  1L7Y A;  2JUO A;  1WGY A;  2PJH A;  1E7V A;  2GOW A;  3TMP B;  4G3X B;  4WWM A;  4E71 A;  3Q8C A;  3UQA A;  4KKI A;  3RUL A;  4LNF A;  2ICI A;  1DOX A;  3LDZ E;  3RN9 C;  3TIX A;  4MM3 A;  4X57 B;  4IG7 B;  2N7E A;  2SEB D;  5TSS A;  2C5L C;  2AL6 A;  2N9P C;  2K39 A;  2ZZP B;  3EC8 A;  1N62 A;  3MTN B;  4KKJ A;  4ZRQ A;  4MEM A;  4OZC A;  1VJK A;  1XCQ L;  1HTO A;  1OFF A;  1GC6 A;  2JZ3 B;  3UIO B;  1T5X D;  2MLB A;  4I6P A;  2G45 B;  1WXA A;  3MJW A;  2O2V B;  3AE8 B;  3H8H A;  1E8Z A;  2PVG C;  5IA7 A;  5GXG B;  3PHX B;  2KAJ A;  5BYR A;  2N9E B;  4FAD A;  2MHJ A;  1N61 A;  2XK5 A;  4ZHO A;  1YJI A;  3Q6B A;  1SSN A;  1ZPS A;  2MA9 B;  4JX1 C;  1WJ4 A;  4K1R B;  1XXG A;  2GRI A;  2Y5C A;  3RCZ A;  5BYQ A;  4HKQ A;  5CTR C;  1CMX B;  4EEW A;  3OJ3 A;  1IYF A;  2CHW A;  1XD3 B;  4HDQ A;  1C9F A;  2VH2 A;  2LVQ A;  2MEK A;  2NBU A;  2WS3 B;  1GG3 A;  4MGI E;  4K7U A;  4NJ6 A;  1JWM D;  3EHV A;  1L6V A;  4C7Y A;  2IND C;  2N9L A;  3IAM 1;  1XO3 A;  1WMH B;  4BAX A;  2JYT A;  4TSS A;  2K6D B;  4LNO A;  4LNI A;  4K7S A;  2BW2 A;  2WXI A;  3RI7 C;  2L0T A;  1EU4 A;  3PZD A;  2J53 A;  3WAM A;  2QC8 A;  1OGW A;  1EF5 A;  4RM9 A;  4XWW A;  3KUD B;  3DWG C;  3VVW B;  4GXB A;  4MGY E;  2INP E;  4C80 A;  3UQB A;  4W9I A;  4HCP B;  1JWU D;  2PVO D;  2HJ1 A;  1V9J A;  4FHK A;  4AS1 A;  2FAZ A;  3HRD D;  5H92 C;  2INC C;  1KF6 B;  2LUE A;  2RPV A;  2MP2 A;  4NY0 A;  4G0N B;  2BYT A;  4ZRI A;  1WE7 A;  2V1Y A;  3S2A A;  4RF1 A;  1VCB A;  1SBB B;  2K8C A;  4XGA B;  4PS8 A;  2CS4 A;  1QLB B;  1MHX A;  4ARC A;  5IAA C;  3PV1 A;  1V8C A;  3OLM D;  3ZTD A;  1YN4 A;  5DPW A;  2IY1 B;  3B9J A;  3B0A A;  3ML8 A;  4LLG M;  2W54 A;  2JX5 A;  3AXC A;  3TJP A;  3ZJU A;  1WRD B;  4K7W A;  3P63 A;  3SDL C;  1TZ1 A;  3H9D A;  4GDL A;  5TR5 A;  2EKE C;  2KQ4 X;  2L83 A;  4WAF A;  3DCG A;  3FIL A;  3AE7 B;  2K9X A;  3QAR A;  5C23 A;  3QHT A;  4M8N A;  2KQS A;  4CQN A;  3VAW A;  3I3T B;  2JWU A;  3NY5 A;  2SAK A;  1TKG A;  3C0R B;  1F9J A;  1I4G A;  2IZV B;  3KYC D;  2WXR A;  1MFW A;  2IGH A;  5AZG A;  4LNK A;  3M63 B;  5GMV A;  4JE3 B;  5LXH A;  4DHZ E;  4WJO A;  4FA6 A;  3A1Q B;  4EOY A;  3E9S A;  4TQ0 A;  3VXW A;  4OVU A;  3PRE A;  3VRB B;  2JXX A;  2NTS A;  5CHV C;  2DBY A;  2VH1 A;  1K51 A;  1RRB A;  2WXF A;  1XQQ A;  3MP9 A;  4C56 C;  4YT0 B;  3VUX A;  4KZC A;  4W9E A;  2LWP A;  3KVF B;  4ZOH C;  1WMH A;  2L52 A;  1WWT A;  3PRM B;  4P6V F;  3N1X C;  5CHF A;  1UGJ A;  1WR6 E;  3L0W B;  1UNS A;  2M0X A;  1GPX A;  1TZO A;  1JWS D;  3NS1 A;  1GJZ A;  3DBL I;  1FXI A;  1F77 A;  2KNB A;  1E0Z A;  1RLF A;  1ZW7 A;  2R61 A;  2NPT A;  3IT4 B;  3GS2 A;  1OQY A;  2PW9 A;  1S1Q B;  3L54 A;  3QIJ A;  1SJH D;  5I4D A;  2DZM A;  4BOZ B;  3H7P A;  3MC9 A;  5HG2 A;  4BFR A;  1IUE A;  1SE9 A;  4AUQ C;  1OTR B;  3ENE A;  1XF5 L;  2DYB A;  3W9C B;  1FPY A;  5E6O A;  3ZNH B;  2Z0E B;  1TS3 A;  4DQO C;  1KRH A;  2G3Q B;  2KX0 A;  2BS3 B;  2IYD B;  3RT3 B;  3AH7 A;  1JWB D;  1WX8 A;  2IBI B;  4B9K A;  4IWP A;  3IAS 1;  2D10 A;  4N9F 4;  3B2F A;  4R3D A;  5D3I B;  2GLS A;  2IO3 B;  2K8B A;  3P2B A;  5C1Z A;  3NUH B;  5D3D A;  2DZJ A;  2DYO A;  2MJE A;  2V4L A;  2D3C A;  1AAR A;  2BYF A;  2V3P A;  4WUR A;  3TSS A;  5AUI A;  4CHK A;  3OG5 A;  2JF5 A;  2X38 A;  3IHP C;  3U2S C;  4W9F A;  2WXL A;  1VZ7 A;  3JYU A;  2QDF A;  2QSD A;  2LXC A;  3AE6 B;  2QJL A;  2C7H A;  3DBR I;  1L0Y B;  2FCN A;  2JWZ A;  1GC7 A;  4P1C C;  5HI1 A;  2HE7 A;  2MBO A;  2WXM A;  3C19 A;  4KGT A;  4YTN B;  1WH3 A;  3K9P B;  3P4R B;  3QWZ B;  3IBE A;  3MC8 A;  4YWG G;  3Q3O C;  4WJQ A;  2REX A;  3RNA C;  4B6W A;  2ZJD A;  4LDT B;  2KWU B;  2EKI A;  5AUK A;  1Q1O A;  4E74 A;  1CJE A;  3N32 A;  2KMM A;  1STE A;  4B0M A;  2J52 A;  2KLC A;  2DLB A;  2KOX A;  3X0W A;  3DVN U;  4WWO A;  5IKC M;  4XDC A;  1FXA A;  3BVG A;  1SE4 A;  2O6V B;  3SR6 A;  3BVZ A;  3QAQ A;  1Z2M A;  1PGX A;  1YOV B;  4TMA B;  3NZU A;  1TGZ B;  2JY6 A;  3BYT B;  3RPF C;  3AE1 B;  4NAW A;  2LGS A;  2KVZ A;  1GB1 A;  2WDT B;  3BWU D;  4LK0 M;  2M4N A;  1UWX A;  4L2Y A;  5HFY A;  5E6P A;  2KFJ A;  2KAC A;  3LB8 C;  1TJE A;  3DBH B;  2MH7 A;  1UH6 A;  2D3A A;  2K6Q A;  3P4P B;  2DYM A;  2RGF A;  1V49 A;  4A3P A;  3AE4 B;  5IP4 D;  1N60 A;  1SB3 C;  1BXT A;  5KHO A;  4ZYN A;  3L17 A;  3R66 C;  5FR3 A;  1WYW B;  3NZ3 A;  3ABV B;  4KX6 B;  1DOY A;  1QOA A;  1WX9 A;  3GZN B;  4B0E A;  2LHE A;  2M19 A;  1ZKH A;  3RNG C;  4WIP A;  2B76 B;  2D3G A;  3PPA A;  3R3M A;  1WZ3 A;  1J19 A;  3MC0 B;  3ALB A;  2BTE A;  4NJ7 A;  2DAJ A;  4NZL B;  4MH0 E;  1IBX B;  2PE9 A;  3A9K B;  4ANW A;  1C1Y B;  4XDD A;  2JSV X;  2BS4 B;  4PYU A;  1YN5 A;  2MJ3 A;  3KW5 B;  2NBW B;  1WF9 A;  3VUW A;  4C00 A;  2DZI A;  3B1L X;  2KO3 A;  1SXT A;  1V6E A;  4YSX B;  1R7S A;  4Q2J A;  1N5X A;  2UYZ B;  4HJK A;  4ITK A;  1ISN A;  2L32 A;  4KGS A;  3T9L A;  2C7M B;  2E6X A;  1WIA A;  1HE8 A;  1FNW A;  4JLC A;  4FJV B;  4NAW B;  5JHA A;  2M8S A;  4OVV A;  4EUT A;  3DVN V;  3ZRF A;  3N20 C;  2LMC A;  1JAL A;  1EUV B;  4DWF A;  2KD0 A;  3ZGZ A;  5C2T B;  1NVI D;  4H2A A;  1UUP A;  1M4V A;  3EFC A;  3LXF A;  1ESF A;  1PDX A;  2WP9 B;  3PLU A;  1YX5 B;  4MDK E;  2XBB C;  2OED A;  2HD5 B;  3RNC C;  3U52 E;  2VRR B;  3DHH C;  2J42 A;  2XK5 B;  3MFG A;  1RAX A;  1V2Y A;  2JQR B;  4IM3 A;  3L16 A;  2KJ6 A;  3WAL A;  4FLH A;  1Q5W B;  1RFK A;  1PQS A;  4MH8 A;  1T6B X;  2PIA A;  3R7R A;  1KLG D;  1WGH A;  1U4A A;  2WWZ A;  1YQB A;  2PPH A;  3Q2A C;  1UGM A;  1E90 A;  4IC7 B;  1HZ5 A;  1WM2 A;  3P42 A;  2G4D B;  2KYW A;  3BII D;  4LDT D;  3CF6 E;  5J18 A;  3RFZ B;  2YLM A;  4AQ7 A;  1FEH A;  4RH6 A;  2ACZ B;  4II2 B;  4DBG A;  3HM6 X;  4JIO U;  1H4R A;  3AEF B;  5KHQ A;  1YMH E;  3JVZ X;  4W9C A;  2KMC A;  1IGD A;  5FKA C;  4PT5 A;  4LCD E;  1MG4 A;  2WXG A;  1K52 A;  2VZK B;  5HHD G;  2FBW B;  2NTT A;  4MM3 B;  3DBL B;  4ZYS A;  1QKZ A;  1ZP0 B;  1NI3 A;  3TL5 A;  1QQR A;  3R2T A;  2K25 A;  3K9O B;  1TY0 A;  1ZE3 D;  4N58 A;  4M0W A;  2WXO A;  1WGR A;  3ZJV A;  1KM7 A;  4A6Q A;  2OJW A;  3W2D A;  3P4Q B;  3ML9 A;  1E6E B;  2I38 A;  4KSK C;  2W55 A;  3VTW A;  3W5U B;  5BMH A;  4RGT A;  2FCQ A;  2KHW B;  3AE5 B;  2RD0 A;  2V0G A;  2G1E A;  2JXT A;  3X23 A;  3ZTC A;  1HZ6 A;  2KMA A;  3LYY A;  3NG0 A;  3T8M A;  4ANU A;  2WX0 A;  3KWL A;  1ZUD 2;  2G4S A;  1V5O A;  1KOT A;  2ZNV B;  1R4M I;  3APD A;  1RWS A;  2CJO A;  2MX2 A;  1FRD A;  3PS6 A;  1YD8 U;  2FCM A;  4WQO B;  1D4B A;  3UF8 A;  3CST A;  2BQQ A;  2AYO B;  2IPK D;  1I7H A;  4GSW A;  1EU3 A;  2L76 A;  3VTU A;  3DVG X;  3AU4 A;  3NZS A;  3H1U A;  1C3T A;  3JSV B;  4MSM B;  3VDZ A;  3AEB B;  5AZH A;  3W1S A;  4XC2 A;  1V97 A;  4K81 A;  2WDQ B;  3IXS A;  1VLB A;  1QOF A;  3V3X A;  1FM0 D;  3TUO A;  2XNA C;  1XCT L;  4WQM A;  4PK1 A;  2IO0 B;  3KLS X;  2DAF A;  3AB5 A;  3GOE A;  2Y3A A;  1OEY A;  2LGY A;  4GMV A;  2MWS B;  3Q8B A;  4I6L B;  5AEK B;  5BYS A;  3BK1 A;  1C4P A;  3D32 A;  1T0Q C;  4OZB A;  2M56 B;  1P9D U;  1E8W A;  2GI9 A;  3RNB C;  4W9H A;  4YTM B;  2KC2 A;  1UZX B;  1V80 A;  4RGN A;  2WQY B;  2C60 A;  3ZYY X;  1ZDX A;  2EMT A;  2GBN A;  3E56 A;  3PGE A;  1NYR A;  3ZRC A;  3QK0 A;  3DBR B;  4IWQ A;  2HTH A;  3T3O A;  4IUM B;  2ZCC A;  4HDO A;  3NRZ A;  2N7D A;  1QIL A;  4W9K A;  2Y5B B;  2W3S A;  2KWC A;  1MHH E;  4A3O A;  2N9X A;  1FMA D;  4KV2 A;  2LI5 A;  4IWO A;  2LRW A;  1FO4 A;  2LJI A;  2J0K A;  1FCC C;  4F8C B;  3U30 A;  5L83 A;  4A90 A;  3EGR A;  1IBX A;  1WXM A;  4USA A;  5LXI B;  3ZQ4 A;  2IGG A;  1ENF A;  2OHF A;  2WXQ A;  1XEE A;  2C7N B;  1B9R A;  1K53 A;  1I4X A;  5LNK 1;  3OJ4 B;  1HTQ A;  2BB6 A;  2I2Y A;  1P3Q U;  3ZNI D;  2ZPY A;  4I6N B;  4DHJ B;  5BMG A;  2BVC A;  1TS5 A;  2BS2 B;  2H88 B;  2D11 A;  1WJU A;  4FBJ B;  3OAW A;  3I9V 1;  4L1B A;  1LGR A;  1UF0 A;  1V86 A;  1WXS A;  2KJR A;  1L4D B;  3B2G A;  1TBE A;  2WX1 A;  4F1S A;  2L0F A;  4RMA A;  4M8M A;  3SFD B;  4ZHP A;  5G55 A;  4BOS C;  4AJW A;  3GP7 A;  1YJ1 A;  4HRO A;  1GOZ A;  1I35 A;  5E6N A;  4BKG A;  2KJH B;  1ET6 A;  2WDR B;  3L08 A;  1WGG A;  1MVK A;  1CK1 A;  1AW7 A;  1FNU A;  1QT9 A;  3ZJT A;  1AWD A;  4DXA B;  4BVU C;  3VTV A;  2J0J A;  2YEP F;  4WWN A;  1RFA A;  3L4P A;  3I63 C;  4AP4 C;  1VRA B;  3U7D A;  1SGH A;  4GIV A;  3NJT A;  5EE3 A;  1FFV A;  1WE6 A;  3A1Q A;  2O2V A;  2KT7 A;  3DHI C;  4FN2 A;  2PKO A;  1C79 A;  1IGC A;  3MHS D;  2WYQ A;  4M00 A;  3WA0 A;  1MJD A;  2AEH A;  2MRP A;  1KH0 A;  1VR9 A;  4WJP A;  3N9Y C;  1MG8 A;  4FJZ A;  4DHJ D;  2LVO A;  2WHI A;  1L0V B;  2ONQ A;  4ZRJ A;  1LO5 D;  2AQ3 B;  2L05 A;  3GE8 C;  3OWE B;  4N6E B;  4NNJ B;  2Z59 B;  2ZEQ A;  1Y56 A;  1FIQ A;  3PZ7 A;  3Q3F A;  1YNT E;  1E9M A;  1GNU A;  3FKY A;  3KUZ A;  2B3A A;  2WU5 B;  2BPS A;  1XLO A;  3ONS A;  4PS7 A;  2K5P A;  2I1K A;  1TS4 A;  2ZNV C;  3CSF A;  1ROE A;  2BYV E;  4EZL A;  1YJJ A;  2NPT B;  3AE9 B;  4KSL C;  3V6E B;  2FIF A;  3AU5 A;  3AE3 B;  3N3K B;  4A9A A;  2PE6 B;  5G5H A;  3HUI A;  4IM0 A;  1VDV A;  1C78 A;  1J7C A;  1JCK B;  4FXC A;  3GE3 C;  2UWQ A;  2WLB A;  4EE2 A;  3PSE B;  5D2M B;  3IT6 B;  2JT4 B;  1GAQ B;  4M02 A;  1R4N B;  1K8R B;  2IY0 B;  4G11 A;  3ZDT A;  2QHO A;  4EZK A;  1BML C;  2XN9 C;  2N9K A;  1P98 A;  1TYG B;  3ZDM C;  4NAM A;  4KDI C;  4ASW C;  3O13 A;  4A8X C;  2L8J A;  4E3C A;  1R4M B;  2ZVO A;  4GLS C;  3DWM A;  3UIP B;  5FR6 A;  1HXY D;  3RNF C;  2C9W B;  3V6C B;  3BYY B;  3VH4 B;  4JPS A;  1Y8R C;  2L1A A;  3NVZ A;  4WH4 A;  2L3Z A;  1YQ3 B;  4JWS C;  1YQ4 B;  1I4H A;  2UU7 A;  4GU2 A;  2MBB B;  4GOC A;  2D2Q A;  2GB1 A;  3DBS A;  3R2I A;  2N4F A;  1ET9 A;  2CR5 A;  2KKC A;  2LGX A;  3DOW A;  3HM3 A;  3W1Y A;  1MI0 A;  2D07 B;  5D6J B;  4B95 A;  2MBH A;  3P1M A;  4N59 A;  1UEL A;  3PHW B;  3Q14 C;  2KAN A;  4XWT A;  5EDS A;  2KDF B;  3ZXR A;  4MT5 A;  4YTP B;  4DXF A;  4HEA 1;  3IFW B;  1WX7 A;  3A4R A;  2ZW0 A;  4HXD A;  1NEK B;  2M17 A;  1P0R A;  3N1Y C;  2KDI A;  4F7Z A;  4NQK E;  1IP9 A;  1V1P B;  1T0Y A;  1Q0W B;  2KTR B;  2CU3 A;  2KXJ A;  1WYG A;  4RNA A;  2Y5P A;  4YL8 A;  4IOI E;  1AN8 A;  1E7P B;  2MBQ A;  5DPT A;  5EE9 A;  1N5W A;  2GBM A;  4BKS A;  3Q8A A;  1FD6 A;  4RCO A;  4IDI A;  3ZLZ A;  5D7G A;  2QCZ A;  4JL9 A;  3QX1 A;  3URY A;  2O6V A;  1A70 A;  5CHW A;  5IOI A;  4XE0 A;  3NS8 A;  3WCQ A;  2RDH A;  3CIR B;  2KTR A;  2N1V A;  3ZUN A;  3TEY A;  2NR2 A;  4HJG E;  2PTL A;  1L0X B;  4GDK B;  4NJC A;  4HCN B;  4S0R A;  1UBI A;  3A33 B;  2LHD A;  3HVZ A;  2IDY A;  1RYJ A;  3QCA A;  2K8H A;  2RR9 A;  4WJN A;  3BZD B;  2PEA A;  1YIW A;  3APC A;  3TBL D;  2ZPN A;  1FCL A;  5L95 C;  1D5X C;  3AI5 A;  4DXG A;  2LD9 A;  4A20 A;  1YN3 A;  3J9C A;  1VZ6 A;  1TS2 A;  4BKT A;  4OZA A;  3PRZ A;  2ASQ A;  3UI3 A;  3DVG Y;  1TY2 A;  3P4S B;  2AQ2 B;  3TEW A;  2KWV B;  1WXV A;  2BBC A;  1PGB A;  3WIM A;  3FAH A;  2YVC A;  4HPP A;  1TKE A;  3Q69 A;  3O65 B;  2FNJ B;  4GDL B;  4KVG B;  4M0W B;  3Q3N C;  2ZCB A;  2KTF A;  2CJN A;  3NVW A;  2WXN A;  1ACC A;  5C3J B;  2Z0D B;  2MJD A;  2W3R A;  5H8Y E;  3JSV A;  4RGO S;  2BF8 B;  1XLQ A;  4XZ4 A;  5AZF A;  1SIF A;  1H8C A;  3RNE C;  3U4E G;  4OW0 A;  1LFD A;  3CMM B;  1DOI A;  3R8B A;  1JRO A;  3EFU A;  3A4S C;  2LGD A;  1JWA D;  4AJY B;  1RM6 C;  2V9H A;  4W9G A;  1TT5 B;  1PUT A;  5G2N A;  3VH3 B;  1LQB A;  2MQJ A;  4HPM B;  2LVP A;  4DK5 A;  3AUL A;  1C76 A;  2LAS A;  4MJS A;  4HPL B;  4UDU C;  3ZKJ C;  4KZ0 A;  1F1H A;  3GZN I;  3PT2 B;  3V05 A;  1SIJ A;  2PMV A;  1WM3 A;  3AEC B;  1NYQ A;  4J6I A;  4LJP B;  3AEE B;  2N7J A;  2KLG A;  4LJO B;  3Q3M C;  2KFK B;  4BKS D;  2FCS A;  4O1N A;  4MAC A;  1P7F A;  2CHZ A;  4AOF A;  4US9 A;  1J0G A;  2K1F A;  3VQI A;  3VRA B;  3H7S A;  2BKR B;  2BGF A;  3R7Q A;  2LFI A;  4IW0 A;  3ECI A;  1WJ6 A;  1V1P A;  1E8X A;  4QAY A;  2KDE B;  4W9D A;  2D5G A;  3BY4 B;  3AEG B;  1P7E A;  4LTU A;  3PLV A;  2NCN A;  2KN4 A;  4A55 A;  1TKY A;  1F2R C;  2A5U A;  1P1A A;  3W1S C;  3VHT C;  3ZO5 B;  3MJ5 A;  2AL3 A;  3FC4 A;  3AM9 A;  1ZGU B;  2DZK A;  1XT9 B;  2WDV B;  1KTK A;  3M62 B;  2MP2 B;  2QIL A;  2BWF A;  1Z5S B;  2KC1 A;  5J2R A;  5IN7 A;  2KX3 A;  3U7Z A;  2DNF A;  3EA6 A;  3EEC A;  3NHE B;  3WAP A;  1T3Q A;  2Z8L A;  2E3T A;  2CKH B;  2LRU A;  3N1Z C;  4ZDV A;  2WNM A;  3A9J A;  2CHX A;  3HK0 A;  2JZP A;  5BO4 B;  4BBN C;  3PTF C;  1FRR A; 
#chains in the Genus database with same CATH homology
 4MM3 A;  3U7D A;  4ZYN A;  1SGH A;  3L17 A;  4GIV A;  3R66 C;  4X57 B;  3KUC B;  4IG7 B;  2N7E A;  3U8Z A;  1WE6 A;  3A1Q A;  1WYW B;  4GGQ A;  2C5L C;  2AL6 A;  2O2V A;  2N9P C;  4FN2 A;  1WX9 A;  2K39 A;  2ZZP B;  3EC8 A;  3SHQ A;  3MTN B;  3RUI B;  1ZKH A;  4MEM A;  3MHS D;  4DHZ B;  2WYQ A;  3WA0 A;  2AEH A;  3UIO B;  1GC6 A;  2JZ3 B;  2MRP A;  3V60 A;  4WJP A;  2D3G A;  1MG8 A;  4FJZ A;  2KFK A;  2BYE A;  4DHJ D;  2LVO A;  4PYZ A;  2MLB A;  3PPA A;  3R3M A;  1WZ3 A;  4I6P A;  3UGB B;  2G45 B;  1WXA A;  3MJW A;  4ZRJ A;  1J19 A;  3DBH I;  3IG3 A;  3ALB A;  2L05 A;  2O2V B;  4NJ7 A;  1E8Z A;  2IO1 B;  2DAJ A;  4CYE A;  4NNJ B;  4TUU A;  2JRI B;  4MH0 E;  2PE9 A;  5IA7 A;  3A9K B;  4NQL B;  2Z59 B;  3PHX B;  1C1Y B;  2ZEQ A;  2N9E B;  4ANW A;  4FAD A;  3Q3F A;  2XK5 A;  1GNU A;  2RSU A;  3DPD A;  3KUZ A;  4PYU A;  3KW5 B;  2B3A A;  1TTN A;  2DX5 B;  2BPS A;  4MSQ B;  2MA9 B;  1WF9 A;  1WJ4 A;  2NBW B;  3VUW A;  4K1R B;  3ONS A;  2NBV B;  4PS7 A;  2I1K A;  2L7R A;  2DZI A;  2ZNV C;  3B1L X;  3CSF A;  2KO3 A;  2BYV E;  3RCZ A;  1V6E A;  4EZL A;  2NPT B;  4HK2 A;  2OOB B;  4KSL C;  3V6E B;  2FIF A;  5CTR C;  1CMX B;  2R2O A;  3L10 B;  3AU5 A;  4EEW A;  3OJ3 A;  1IYF A;  2JPH A;  2UYZ B;  1V81 A;  4HJK A;  2CHW A;  1ISN A;  3QQ8 B;  1XD3 B;  3N3K B;  4HDQ A;  3T9L A;  2LVQ A;  2NBU A;  2PE6 B;  1GG3 A;  2OJR A;  2C7M B;  4IM0 A;  4MGI E;  1WIA A;  4K7U A;  1HE8 A;  4ANX A;  4NJ6 A;  4EFO A;  4JLC A;  4FJV B;  3EHV A;  4NAW B;  5JHA A;  5JH5 C;  2M8S A;  4OVV A;  4EUT A;  3DVN V;  3ZRF A;  4BBN F;  2UWQ A;  3PSE B;  5D2M B;  2JT4 B;  1WMH B;  4G50 A;  4W9J A;  2GBR A;  2K6D B;  1EUV B;  4DWF A;  2KD0 A;  1K8R B;  4K7S A;  5JZE B;  4GDK A;  2IY0 B;  4G11 A;  3ZDT A;  2QHO A;  2L0T A;  2MCN B;  3PZD A;  4EZK A;  1G6J A;  3WAM A;  1OGW A;  1EF5 A;  1P98 A;  4RM9 A;  3ZDM C;  3ZNG C;  2KK8 A;  3KUD B;  1YX5 B;  3PLU A;  4KDI C;  4MDK E;  2XBB C;  4ASW C;  3KYD D;  4EKU A;  3VVW B;  2HD5 B;  2L8J A;  4ICU A;  4GXB A;  2VRR B;  4MGY E;  2FUH B;  3NOB A;  4E3C A;  2XK5 B;  4XX5 A;  3UQB A;  3RD2 A;  2ZVO A;  4JQW C;  4W9I A;  4PS3 A;  2M1M A;  1RAX A;  1V2Y A;  3DQV A;  4IM3 A;  2BKF A;  3UIP B;  4HCP B;  5FR6 A;  1EF1 A;  2C9W B;  3L16 A;  3V6C B;  2KJ6 A;  3WAL A;  4FLH A;  3VH4 B;  2DEN B;  1V9J A;  4HLE A;  4FHK A;  1Y8R C;  2JVC A;  1IPG A;  3ZVV A;  2L3Z A;  2W9N A;  1Q5W B;  2FAZ A;  4GU2 A;  3QA8 A;  1PQS A;  2MBB B;  4ANV A;  3B08 A;  5DPR A;  4DDI D;  4GOC A;  2D2Q A;  3DBS A;  2N4F A;  2KKC A;  2CR5 A;  1E8Y A;  2LGX A;  2LUE A;  3R7R A;  5J17 A;  1KLV A;  1WGH A;  2MP2 A;  3DOW A;  3HM3 A;  4NY0 A;  4WAA A;  1WR1 A;  4WWP A;  5HKH A;  3W1Y A;  4G0N B;  1U4A A;  4AWJ A;  1D3Z A;  2D07 B;  2WWZ A;  5D6J B;  4ZRI A;  4B95 A;  4JGH B;  2MBH A;  1YQB A;  2PPH A;  1UEL A;  1UGM A;  1E90 A;  1WE7 A;  4IC7 B;  2V1Y A;  3PHW B;  3S2A A;  1WM2 A;  2GMI C;  2G4D B;  2KAN A;  3APF A;  3UIN B;  1VCB A;  5EDS A;  3H6N A;  2K8C A;  4PS8 A;  2CS4 A;  2ZVN A;  1WJN A;  4LDT D;  5IAA C;  3CF6 E;  5J18 A;  3PV1 A;  3OLM D;  1UBQ A;  2YLM A;  2KDF B;  3ZTD A;  5DPW A;  2IY1 B;  3IFW B;  3B0A A;  3ML8 A;  3AXC A;  3VFK A;  4MGK E;  1WX7 A;  3TJP A;  1VD2 A;  3A4R A;  4II2 B;  1WRD B;  2LJ5 A;  4HXD A;  4DBG A;  3JW0 X;  4K7W A;  2M17 A;  3SDL C;  1P0R A;  1TZ1 A;  3HM6 X;  2KDI A;  1S3S G;  4JIO U;  4F7Z A;  4NQK E;  1H4R A;  4W9L A;  3RYT A;  1IP9 A;  1T0Y A;  3H9D A;  4GDL A;  5KHQ A;  1Q0W B;  3JVZ X;  4W9C A;  5TR5 A;  2KTR B;  2EKE C;  2KXJ A;  2KMC A;  3DCG A;  4YL8 A;  3V61 A;  4LCD E;  3QAR A;  1WZ0 A;  5C23 A;  3QHT A;  2MBQ A;  4M8N A;  5DPT A;  1V5T A;  2KQS A;  2GBM A;  3VAW A;  1WGD A;  3I3T B;  4BKS A;  3NY5 A;  1M94 A;  5DCN A;  3C0R B;  3ZLZ A;  1OEY J;  1F9J A;  4HWI B;  5D7G A;  2L00 B;  2IZV B;  3KYC D;  4JL9 A;  3RZW C;  2J7Q B;  2K25 A;  3QX1 A;  4MGZ E;  3K9O B;  3TL5 A;  2KZR A;  2O6V A;  5AZG A;  5CHW A;  4GB9 A;  1GUA B;  3NS8 A;  1E7U A;  3PRP B;  2FID A;  3WAO A;  3M63 B;  1WGR A;  5GMV A;  5LXH A;  4DHZ E;  1KM7 A;  2KTR A;  2KVR A;  2AWT A;  4WJO A;  2N1V A;  3N30 A;  3A1Q B;  3ZUN A;  2NR2 A;  4FA6 A;  4KDL B;  4GDK B;  4EOY A;  4HCN B;  3ZW3 A;  1UBI A;  3A33 B;  3ML9 A;  4TQ0 A;  2MW5 A;  3M3J A;  3VXW A;  4KIK A;  4KSK C;  4OVU A;  3VTW A;  3WAN A;  4TKN A;  2FCQ A;  2KHW B;  3PRE A;  2JXX A;  3QCA A;  2NS5 A;  2K8H A;  2RR9 A;  2RD0 A;  3A9J B;  3PVL A;  4MEL A;  4WJN A;  5CHV C;  2PEA A;  4HVB A;  3L13 A;  1YIW A;  3X23 A;  3ZTC A;  2KMA A;  1RRB A;  3APC A;  3T8M A;  3HHM A;  1XQQ A;  3TBL D;  3VUX A;  2ZPN A;  4KZC A;  4W9E A;  2LWP A;  3KVF B;  5CX3 A;  3Q3J A;  1WMH A;  2WX0 A;  4ANU A;  2G4S A;  1V5O A;  5L95 C;  3AI5 A;  3PRM B;  1KOT A;  2LD9 A;  2ZNV B;  3SD5 A;  1R4M I;  3APD A;  4A20 A;  5CHF A;  2I1J A;  2J0M A;  1NDD A;  4BKT A;  1A5R A;  1WR6 E;  1LXD A;  3PRZ A;  3L0W B;  2MX2 A;  3PS6 A;  1UD7 A;  1YD8 U;  2ASQ A;  2FCM A;  3DVG Y;  4WQO B;  2M0X A;  3UF8 A;  3ZNZ B;  5D94 A;  3CST A;  4P7I A;  2AYO B;  4GSW A;  1GJZ A;  1QZE A;  2KWV B;  1WXV A;  3DBL I;  2KNB A;  2L76 A;  2KN5 A;  3VTU A;  1RLF A;  1R4N I;  3DVG X;  3AU4 A;  4ICV A;  1ZW7 A;  3NZS A;  2YVC A;  3H1U A;  3WIM A;  2NPT A;  1C3T A;  2V3S A;  1OQY A;  3L54 A;  1S1Q B;  3QIJ A;  4ZRK A;  2DZM A;  3JSV B;  1YX6 B;  4MSM B;  2CU1 A;  3V62 A;  3O65 B;  4BOZ B;  3VDZ A;  5AZH A;  3W1S A;  3H7P A;  2FNJ B;  4GDL B;  4XC2 A;  4KVG B;  1KJT A;  4M0W B;  4BFR A;  1LM8 B;  2ZCB A;  2KTF A;  4K81 A;  1SE9 A;  4AUQ C;  1EO6 A;  1OTR B;  3ENE A;  2DYB A;  4FHJ A;  4FUL A;  2Z0D B;  5E6O A;  3ZNH B;  2Z0E B;  4II3 B;  3IVF A;  2G3Q B;  2IO0 B;  2KX0 A;  1I42 A;  3JSV A;  2BF8 B;  4XZ4 A;  2DAF A;  5AZF A;  4EZJ A;  3GOE A;  2IYD B;  1SIF A;  3RT3 B;  1H8C A;  2N1W A;  1OEY A;  2LGY A;  4GMV A;  3RZF A;  2MWS B;  4I6L B;  1WX8 A;  4MJS B;  5AEK B;  3H7P B;  1LFD A;  2IBI B;  3CMM B;  1FXT B;  4NPN A;  4B9K A;  3D32 A;  4IWP A;  3EFU A;  3A4S C;  2D10 A;  2DHZ A;  4N9F 4;  2IO3 B;  2K8B A;  3P2B A;  1P9D U;  5C1Z A;  1E8W A;  2HJ8 A;  2LGD A;  2MBE A;  4W9H A;  1J8C A;  4AJY B;  2KQ7 A;  2KC2 A;  1UZX B;  4W9G A;  2DZJ A;  2DYO A;  1V80 A;  5G2N A;  4DDG D;  3VH3 B;  2GBK A;  2V4L A;  1LQB A;  2MQJ A;  2C60 A;  2EMT A;  4HPM B;  1AAR A;  2GBN A;  2BYF A;  2LVP A;  3PGE A;  1L2N A;  2IO2 B;  1NI2 A;  4CHK A;  2JF5 A;  3ZRC A;  4DK5 A;  5DPS A;  3AUL A;  1JRU A;  3QK0 A;  3IHP C;  2LAS A;  2LXA A;  4MJS A;  4TV3 A;  4IWQ A;  2HTH A;  4HPL B;  3ZKJ C;  4KZ0 A;  1NBF C;  3QJZ A;  4GN1 A;  4IUM B;  3TCA A;  2ZCC A;  4HDO A;  4W9F A;  3GZN I;  3PT2 B;  3JYU A;  2N7D A;  3M95 A;  5JHB A;  1E5W A;  1WM3 A;  4W9K A;  3DDC B;  2Y5B B;  4J6I A;  2KWC A;  4LJP B;  2LXC A;  4A3O A;  2O6V D;  2N9X A;  2C7H A;  4KV2 A;  2LI5 A;  3DBR I;  2LRW A;  4IWO A;  2FCN A;  2KLG A;  4LJO B;  2JWZ A;  2J0K A;  3KH0 A;  1GC7 A;  3U30 A;  4F8C B;  5L83 A;  2HE7 A;  1WI0 A;  2KFK B;  2GBJ A;  4BKS D;  2MBO A;  1WXM A;  1X1M A;  2FCS A;  2JZZ A;  2A4Z A;  1WH3 A;  3K9P B;  4IM2 A;  5LXI B;  2CHZ A;  4AOF A;  4URK A;  5LLI A;  2EMS A;  3QWZ B;  3IBE A;  1J0G A;  2NVU I;  2R2Q A;  2K1F A;  3VQI A;  3H7S A;  2BKR B;  2BGF A;  2C7N B;  4WJQ A;  3R7Q A;  2REX A;  4IW0 A;  3ECI A;  3BIN A;  1WJ6 A;  3OJ4 B;  4B6W A;  4KIK B;  2ZJD A;  4LDT B;  1E8X A;  1P3Q U;  2KWU B;  3SU8 X;  3ZNI D;  2ZPY A;  1Q1O A;  4I6N B;  4RM8 A;  4DHJ B;  1WY8 A;  4E74 A;  2KDE B;  3N32 A;  4W9D A;  2D11 A;  4CO7 A;  3BY4 B;  2KLC A;  1WFY A;  3VUY A;  1WJU A;  2KOX A;  2LZ6 A;  3PLV A;  2NCN A;  3X0W A;  3DVN U;  2XEW A;  1BT0 A;  4WWO A;  4FBJ B;  3OAW A;  1V86 A;  2O6V B;  3QAQ A;  2JRH A;  1WXS A;  2A5U A;  1Z2M A;  1P1A A;  3HIZ A;  3W1S C;  2KJR A;  4TQ1 A;  3VHT C;  3ZO5 B;  3NZU A;  1TGZ B;  2BWE S;  2AL3 A;  2JY6 A;  1TBE A;  1ZGU B;  2DZK A;  1XT9 B;  2KDB A;  2WX1 A;  4F1S A;  2L0F A;  2MSE D;  4RMA A;  4M8M A;  4NAW A;  5G55 A;  4BOS C;  2WDT B;  4FJY A;  2RPQ A;  4AJW A;  2M4N A;  3QC8 B;  1YJ1 A;  3M62 B;  2MP2 B;  3A9K A;  5E6P A;  2BWF A;  2KFJ A;  3LJ3 A;  1Z5S B;  3ZIM A;  5E6N A;  1I35 A;  1L7Y A;  2JUO A;  2KC1 A;  4BKG A;  5J2R A;  2KJH B;  1WGY A;  2KX3 A;  2PJH A;  3L08 A;  1E7V A;  1UH6 A;  2GOW A;  1WGG A;  3TMP B;  4G3X B;  2K6Q A;  4E71 A;  3EEC A;  3NHE B;  2DYM A;  2RGF A;  1V49 A;  3WAP A;  4DXA B;  4A3P A;  4BVU C;  3VTV A;  3UQA A;  3PTF C;  2J0J A;  2CKH B;  1RFA A;  2LRU A;  4WWN A;  3RUL A;  4ZDV A;  3A9J A;  4AP4 C;  2CHX A;  3HK0 A;  5BO4 B;  5KHO A;  4BBN C;  3LDZ E;  3TIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...