2KANA

Solution nmr structure of ubiquitin-like domain of arabidopsis thaliana protein at2g32350. northeast structural genomics consortium target ar3433a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
b'MGHHHHHHSHAAVRKIHVTVKFPSKQFTVEVDRTETVSSLKDKIHIVENTPIKRMQLYYSGIELADDYRNLNEYGITEFSEIVVFLKSINRAKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein ar3433a
publication title Solution NMR structure of ubiquitin-like domain of Arabidopsis thaliana protein At2g32350.
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 21
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2008-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kanA01
2CHWA 2JT4B 2KTRB 2A4ZA 1BT0A 2REXA 3VDZA 2AL6A 2EKEC 3EFUA 3QCAA 2G45B 3L08A 1WJ4A 4KVGB 4A3OA 1MG8A 1WI0A 3DBRI 3KW5B 4CO7A 2FUHB 3RZFA 2DZJA 1E90A 2LRWA 1GC6A 1RLFA 5AZFA 4FADA 4IW0A 1GJZA 1VCBA 3MTNB 3K9PB 3PLUA 3ZW3A 2DZIA 3CSTA 1WGHA 3I3TB 3PTFC 2C9WB 3V6CB 3W1SC 4GOCA 3A1QA 4EZJA 2K8CA 2Z0EB 4NJ6A 2IY0B 4W9EA 4J6IA 1KLVA 4W9LA 2A5UA 1E8WA 3SD5A 3WAMA 4K81A 2JRIB 2KJRA 3ECIA 4JL9A 4BKTA 2L7RA 2ZPYA 4TQ0A 3B08A 4MGYE 3OJ4B 1M94A 2N1WA 4WQOB 3VHTC 2L05A 2KTFA 2DAFA 3PPAA 4ZRIA 2CHZA 1YJ1A 4M0WB 2BYFA 1WZ3A 2CU1A 4I6PA 2FNJB 2PJHA 4MELA 2ZCBA 3A9KA 3JYUA 1EF1A 3PS6A 2JVCA 3BY4B 3U8ZA 1WXSA 1ZKHA 3UINB 2N7EA 4WJQA 3VUXA 1GNUA 4E3CA 3ONSA 3UF8A 1E7VA 2N9XA 2LASA 1EF5A 4WWNA 1WGGA 3KYDD 4KSLC 4NAWA 1GG3A 3PLVA 3ZTDA 3W1SA 3V62A 4FBJB 3BINA 4IC7B 3UQAA 2BYEA 2IYDB 1EUVB 3IVFA 3VQIA 2IO1B 4IUMB 3L16A 3PSEB 5DPWA 1D3ZA 4HVBA 2AWTA 3X23A 2KMAA 1U4AA 1OEYJ 2LGDA 2D3GA 2MBEA 4W9DA 1P3QU 3QA8A 3DPDA 4JGHB 3A4RA 1S3SG 4G50A 4KDLB 4KZCA 2G4DB 3PRMB 4FJYA 5G2NA 2NS5A 2KXJA 4DK5A 5KHQA 4A20A 3QARA 2RGFA 4B6WA 3IG3A 2M17A 1VD2A 4FHJA 2L0TA 3A9KB 2IY1B 3QJZA 4M8NA 2BPSA 4GIVA 2MP2A 1JRUA 3PT2B 5AZGA 4PS7A 3TCAA 3RD2A 4PYUA 3O65B 4BKSD 5CHFA 3WIMA 5E6OA 3R7RA 2L76A 4NAWB 4NJ7A 1C3TA 3SHQA 2M0XA 3H7SA 4K7WA 4JLCA 4XX5A 2QHOA 2NBWB 2HTHA 2ZVNA 4MH0E 3WA0A 2FIFA 3AULA 1Z5SB 1V5TA 2LVQA 3DBSA 3ZNZB 3H7PA 4KIKA 3SU8X 4LDTB 3PHXB 2LVPA 3TMPB 4W9KA 1E5WA 2G4SA 5IA7A 5L83A 3U30A 2KZRA 2BF8B 4GDKA 1YX6B 4ZRJA 4DDGD 1OTRB 2KWUB 3JVZX 2ZEQA 1WGDA 2DYMA 1IYFA 3IHPC 4JIOU 3R7QA 2IBIB 2MW5A 3RULA 3C0RB 4NQKE 4URKA 2IZVB 2JWZA 2DX5B 4FJZA 2YVCA 2IO3B 4BVUC 4HLEA 1E8ZA 4TQ1A 1WZ0A 3B0AA 1P1AA 2ASQA 2LZ6A 2MX2A 4AOFA 3P2BA 4EEWA 2BYVE 3VH4B 4X57B 2NBUA 4ANWA 4HDOA 2PE9A 3ZDTA 3TL5A 1P0RA 1TTNA 3MHSD 4HXDA 4MGIE 1FXTB 2FAZA 4HDQA 4NPNA 5G55A 1NDDA 3ZKJC 3PRPB 2KWVB 2JXXA 3IFWB 4IWOA 3UIOB 5CHVC 1SIFA 2ZJDA 3HM3A 3KUZA 2KO3A 2BKFA 2KDFB 3M95A 3RUIB 2XEWA 2LUEA 3VAWA 1IPGA 2K1FA 1K8RB 3U7DA 4CHKA 4DXAB 2ZPNA 5EDSA 4FA6A 3H7PB 2OOBB 3RYTA 3NHEB 4KIKB 4FN2A 1OGWA 2KKCA 3LDZE 2DAJA 3VTVA 4ANXA 4GDKB 3RZWC 2DENB 3DDCB 2JY6A 2KFJA 2NBVB 3VTUA 4W9JA 1S1QB 1WX9A 2D10A 3VH3B 3VVWB 2AYOB 2CKHB 2LRUA 3OJ3A 4IM0A 3VTWA 4WWOA 3KH0A 2LD9A 1WF9A 2KDIA 2KQ7A 4WWPA 2R2QA 4DHZB 3AI5A 4W9GA 2LWPA 5HKHA 1WIAA 2BKRB 2JZZA 2KWCA 3V6EB 4GGQA 2NR2A 4GDLA 2LJ5A 3S2AA 3L13A 2G3QB 4MDKE 4DHZE 2JZ3B 2MLBA 4ZRKA 2K39A 2LI5A 1ZW7A 1LM8B 2C7NB 1WXMA 2PPHA 3H9DA 4LDTD 3A33B 2FCMA 4FHKA 5GMVA 2KFKA 3N3KB 4BBNF 4TKNA 5LXHA 1R4MI 2V3SA 3QC8B 2FCSA 3OLMD 2KJHB 2GBNA 1NBFC 2DZMA 1KM7A 2PE6B 5LLIA 2MBQA 2KLGA 5AZHA 2KQSA 1V9JA 3GOEA 3K9OB 2GBRA 4IWPA 4JQWC 3W1YA 4A3PA 4DBGA 3APDA 2BWES 1UGMA 4HCPB 2MQJA 4AJYB 1V49A 3Q3FA 3KUCB 3JSVA 2GMIC 5C23A 2DYBA 3QAQA 3M62B 1H4RA 5D94A 4GDLB 2W9NA 2MA9B 4WJOA 3RT3B 2LGYA 4EUTA 1YD8U 2MBOA 1IP9A 2MCNB 3ENEA 1YIWA 2NVUI 2C7HA 2J0KA 2XBBC 3PHWB 2AEHA 3Q3JA 5JZEB 2IO2B 3DOWA 5LXIB 1A5RA 4TUUA 5DPRA 1F9JA 1Q0WB 4PS3A 3RCZA 2K6QA 1SGHA 4FULA 3WALA 4I6NB 2KFKB 5D2MB 4IM3A 5JHAA 3DBLI 1RAXA 4IWQA 4F7ZA 1QZEA 2HE7A 3PV1A 2LXAA 2D2QA 4EKUA 4HJKA 3A4SC 3L0WB 2I1JA 2HD5B 3M3JA 3DVNU 1WFYA 1OQYA 3HK0A 3M63B 1UBQA 3JW0X 4OVUA 1V80A 1R4NI 2KC2A 3ZNGC 1LQBA 3ZIMA 2ZZPB 2MBHA 1T0YA 2KD0A 4KV2A 3QHTA 2WX0A 3JSVB 4MJSA 5AEKB 2L0FA 2XK5A 4BFRA 4MM3A 1KOTA 3L10B 4IG7B 2V1YA 4DDID 1E8XA 3AXCA 5E6NA 2GBMA 2YLMA 2M8SA 2UWQA 2GBJA 3AU5A 3HIZA 3DVNV 4HPMB 2M1MA 3L54A 3V60A 1NI2A 2RSUA 4GN1A 1WGRA 2DZKA 4KDIC 5IAAC 1I35A 1V5OA 2EMSA 2LVOA 3DVGX 1UD7A 1RFAA 3PZDA 1H8CA 2RPQA 4AP4C 4KSKC 2EMTA 1CMXB 1L7YA 2MRPA 2BWFA 4EZLA 2VRRB 3ZRFA 5BO4B 3R3MA 2KX3A 1V6EA 2MSED 1EO6A 3ZO5B 1WXVA 1Q1OA 1Q5WB 1OEYA 3PREA 4W9IA 3TBLD 5D7GA 2Z59B 2KLCA 3HM6X 2N9PC 2Z0DB 2GOWA 3ML9A 4AJWA 3N30A 2KJ6A 2PEAA 1WX8A 2ZNVC 4MJSB 1LFDA 5CX3A 4I6LB 2XK5B 3NY5A 1TZ1A 3ZUNA 2N1VA 3B1LX 2B3AA 2KVRA 2K8BA 3L17A 1WM2A 1V86A 3EC8A 3LJ3A 4WJPA 2JF5A 2WX1A 3EECA 4DHJB 4N9F4 3D32A 2O6VA 4YL8A 3VUYA 1XT9B 4BKGA 1I42A 1LXDA 1TGZB 1WJ6A 2KHWB 2JUOA 2KNBA 4HWIB 2UYZB 4W9HA 3SDLC 2KMCA 2ZCCA 3NS8A 4K1RB 4DWFA 2RD0A 4RMAA 3A9JA 3KVFB 1WR1A 3PGEA 5JH5C 4AWJA 2DYOA 1WE7A 2ZVOA 3ZTCA 5L95C 2J7QB 3H6NA 3UGBB 2FIDA 1KJTA 4IM2A 1Y8RC 1E7UA 3QK0A 4TV3A 5J18A 4ANUA 4GB9A 1WMHA 3ZNHB 2CS4A 4CYEA 2JRHA 4MSMB 4NY0A 3DBHI 4EOYA 1GUAB 2K6DB 4P7IA 4ZDVA 1UBIA 3QWZB 2NCNA 4G3XB 3TJPA 3PVLA 1RRBA 2JPHA 4RM8A 3TIXA 4XZ4A 1PQSA 2C5LC 2L8JA 3PRZA 2IO0B 4WJNA 3VFKA 2KN5A 3H1UA 4MEMA 4ICUA 1WM3A 2AL3A 4EZKA 2KOXA 3ZNID 4LJPB 1G6JA 2RR9A 4K7SA 4W9FA 4OVVA 1GC7A 2KDBA 2FCQA 1YQBA 3ZLZA 1X1MA 4HCNB 1WYWB 1XD3B 4ASWC 2HJ8A 2KX0A 4WAAA 2O6VB 1P98A 3DVGY 1WGYA 4M8MA 1ISNA 3APCA 1WJNA 3WANA 3UIPB 1HE8A 4BBNC 2D11A 3KUDB 4B9KA 2WDTB 3A1QB 3A9JB 4G11A 5E6PA 5FR6A 2MWSB 3T9LA 3T8MA 3UQBA 2CR5A 3ZDMC 4PYZA 3WAOA 1J8CA 2R2OA 2L3ZA 1C1YB 2KANA 3DQVA 2MBBB 3AU4A 4GU2A 4F1SA 2LXCA 2I1KA 3NOBA 3KYCD 2O2VA 1XQQA 5JHBA 5DPTA 1WMHB 4K7UA 4W9CA 2V4LA 2Y5BB 1WJUA 2J0MA 2ZNVB 4GMVA 3DCGA 5DPSA 2KDEB 5D6JB 2J0JA 4KZ0A 1WRDB 1UH6A 1WE6A 4XC2A 4GXBA 5J2RA 4AUQC 3HHMA 4E71A 3VXWA 4DHJD 2CHXA 3APFA 1V81A 4ZYNA 5CTRC 2BGFA 1J19A 1WR6E 2NPTA 4II2B 2C7MB 2KTRA 1L2NA 4LJOB 4BOSC 1AARA 3R66C 1WH3A 4MSQB 3QIJA 1YX5B 4G0NB 4GSWA 4MGKE 2M4NA 3CSFA 2KC1A 3MJWA 4F8CB 4HK2A 5CHWA 4BKSA 2WWZA 4NQLB 1UZXB 1ZGUB 4EFOA 1E8YA 1V2YA 3OAWA 4LCDE 4MGZE 4FJVB 4B95A 3X0WA 1WXAA 2L00B 3NZUA 4II3B 3V61A 2K8HA 5TR5A 5J17A 1P9DU 2O2VB 3QX1A 2D07B 3CMMB 5DCNA 4NNJB 1TBEA 4BOZB 3ZRCA 3IBEA 2C60A 4PS8A 1SE9A 4RM9A 2DHZA 3VUWA 1J0GA 3WAPA 3QQ8B 3EHVA 4ICVA 3ML8A 2WYQA 3CF6E 2N9EB 2MP2B 4FLHA 2OJRA 2KK8A 2LGXA 3GZNI 3N32A 4ANVA 3ZVVA 3NZSA 2GBKA 2FCNA 1UELA 3ALBA 1WY8A 1Z2MA 1WX7A 2N4FA 5C1ZA 2N7DA 4HPLB 2O6VD 5KHOA 4E74A 2K25A 2NPTB
chains in the Genus database with same CATH superfamily
4QAYA 1RM6C 3VDZA 1BT0A 1DOXA 1MG8A 1N61A 4CO7A 2FUHB 2MHJA 1N5XA 1C4PA 1VCBA 5BYQA 1EWCA 3I3TB 1J7AA 4REZA 1SE4A 4EZJA 3A1QA 4W9EA 2IY0B 4W9LA 1PGXA 4K81A 3B2GA 2JRIB 1YQ4B 1M94A 1SE2A 2L05A 2DAFA 1YJ1A 2FNJB 3A9KA 3PS6A 3J9CA 3N20C 4JWUC 1XCTL 1AYFA 1D5MC 3UINB 4WJQA 4KGTA 2LASA 4WWNA 4KSLC 4XDCA 3FILB 3PLVA 3ZTDA 4GLSC 3UQAA 2BYEA 3IVFA 4IUMB 1D3ZA 4A6QA 2AWTA 2KMAA 3GS2A 4OZBA 4A3OA 4JGHB 3QA8A 1TY0A 2G4DB 3PRMB 1I4PA 2NS5A 4DK5A 2WXRA 3SFEB 3OG5A 2J52A 3KWVA 3MC9A 4FHJA 2L0TA 1V1OA 4GIVA 3MC0B 3RD2A 5CHFA 5E6OA 3R7RA 2DWQA 4NAWB 4WAFA 2M0XA 1KLGD 3ZNZB 3H7PA 3SU8X 4LDTB 1VDVA 2KT7A 3TMPB 3EA6A 4W9KA 1E5WA 1N5WA 4ZRJA 2KWUB 1WGDA 2KAJA 1D5XC 4R3DA 1FNWA 4NQKE 4FJZA 2IO3B 4OW0A 2CJNA 3LB8C 2BS3B 2LZ6A 2PE9A 3TL5A 1K52A 1TKGA 1TTNA 1FXTB 2FAZA 1TKEA 3TEWA 1D5ZC 2IJ0A 3IFWB 4IWOA 3UIOB 1SIFA 1UWMA 2KDFB 1D4BA 3RNGC 1FCLA 3VR8B 2MEKA 1SF0A 4L2YA 2OOBB 5H92C 1A70A 3GE8C 1SE3A 2KKCA 2V9HA 2WXKA 3LDZE 2WXMA 4ANXA 4LNNA 3VTUA 2D10A 1TS3A 2CKHB 4IM0A 1HEZE 3KH0A 1YMHE 5EE9A 4W9GA 3P42A 2KWCA 3V6EB 4MT5A 2LJ5A 2LHDA 1P7FA 4DHZE 2JZ3B 2MLBA 3ZXRA 1GB4A 4Q2JA 1LM8B 2C7NB 1WXMA 3H9DA 4LDTD 4RGOS 4A55A 3UI3A 5HFYA 5LNK1 3GZNB 1R7SA 1R4MI 2FCSA 1NBFC 4P1CC 1SJED 5AZHA 1KTKA 2KQSA 5D3DA 2WP9B 3K9OB 2GBRA 4JQWC 1UF0A 4A3PA 3APDA 2BWES 3DBRB 2MQJA 3Q3FA 3JSVA 1MHXA 1NI3A 2GMIC 1YOVB 2W3SA 2PKOA 2BBCA 2W9NA 2MA9B 2LGYA 2MBOA 4ARCA 1YIWA 2C7HA 5JZEB 1T0QC 3Q3JA 2IO2B 3DOWA 4HJGE 1F9JA 1Q0WB 1XLPA 3RCZA 4FULA 2KWDA 3WALA 2KFKB 5D2MB 1RAXA 2HE7A 5D3IB 4S0RA 1L0XB 3L0WB 3E56A 3M63B 1L5PA 2WGSA 2RMMA 1PYWD 4WURA 2WXJA 2W55A 5AUKA 4RH6A 1BXTA 2L0FA 1KOTA 2L1AA 3GE3C 4DDID 1D6EC 2GBMA 3HIZA 3DVNV 2M1MA 3V60A 4GN1A 1ZE3D 1WGRA 5IAAC 1I35A 1TKYA 1N62A 1RFAA 5BMGA 2RPQA 4AP4C 1JCKB 1CMXB 2BWFA 4EZLA 3ZRFA 3V05A 3ZO5B 3GB1A 1Q5WB 5D7GA 3HM6X 3IT4B 2MJEA 1I4QA 2GOWA 3P4PB 2WXGA 3N30A 2ZNVC 4MJSB 2QCZA 1JWBD 2KVRA 3HUIA 2RDGA 3D32A 3AE8B 1LXDA 3SDLC 2KHWB 4W9HA 2JUOA 4HWIB 1PGAA 1TJEA 4K1RB 4RMAA 3A9JA 3KVFB 1WR1A 1WE7A 1WYGA 1Y8RC 2PLPA 1E7UA 4B0MA 3ZNHB 2CS4A 4CYEA 4EOYA 2D3AA 3QWZB 4LNFA 3PVLA 4RM8A 3AMZA 2C5LC 4C00A 1SIJA 2KN5A 2BQQA 4ICUA 1WM3A 4EZKA 2KOXA 1OFFA 1ZDXA 5EE0A 4W9FA 4NJCA 2FCQA 3SR6A 4ASWC 4WAAA 3N1ZC 1VJKA 1GOZA 3WANA 2BTEA 1HE8A 1E0ZA 4BBNC 2D11A 3A1QB 5E6JA 3T8MA 1UGJA 1J8CA 4PYZA 2R2OA 3DQVA 3AU4A 4F1SA 1IBXB 2LXCA 2WLBA 3KYCD 1WMHB 2RPVA 1Y56A 1B9RA 2N0SB 3AE1B 2J0JA 1YN4A 1SEBD 1ACCA 1LO5D 5BYRA 3MFGA 5CTRC 1T5XD 2NPTA 2C7MB 1L2NA 4LJOB 4ACFA 1WH3A 4MSQB 3QIJA 4GSWA 4MGKE 2CU3A 2M4NA 4BKSA 2WWZA 1ZGUB 1QKZA 1V2YA 3OAWA 4FJVB 3X0WA 4RCOA 5TR5A 5HI1A 3CMMB 1VRAB 3P63A 2C60A 4PS8A 1SE9A 3VUWA 2YEPB 2WU2B 5TSSA 3DHIC 3EHVA 3GZNI 3NRZA 2ZW1A 3U52E 2N4FA 4YTPB 3TEYA 4CQNA 5KHOA 2K25A 3DBLB 4HEA1 2KTRB 3QCAA 3DBRI 1FFUA 4A90A 1E90A 1GC6A 3MTNB 4J3OD 3K9PB 3PLUA 3EGRA 1WGHA 3I63C 1YN3A 1QILA 2Z0EB 4NJ6A 2M0AA 3MC8A 1KLVA 1FO4A 2A5UA 1E8WA 1L4ZB 2Y3AA 1OQQA 5FR3A 2ZPYA 4TQ0A 3B08A 3O13A 3OJ4B 4MGYE 4WQOB 1IGCA 1AW7A 4M0WB 2ZCBA 3FKYA 3U7ZA 3U8ZA 4P1BC 1J7BA 4H2AA 2N7EA 2BYTA 4E3CA 3ONSA 3UF8A 3RNAC 2WXNA 3AEAB 1EF5A 3KYDD 3E9SA 3HRDD 1C9FA 3V62A 4FBJB 3BINA 1CZPA 4IC7B 4AS1A 3VQIA 2LEKA 3PSEB 2X38A 4HVBA 3X23A 3N1XC 1U4AA 2LGDA 2LUMA 3NJTA 4B0EA 3BVZA 4G50A 2KMMA 5G2NA 2KXJA 5KHQA 3QARA 2RGFA 4YSZB 2DBYA 2M17A 1UUPA 2IY1B 2NMQA 2WXLA 4ZOHC 4N6EB 3AE2B 4PS7A 3Q3OC 3U4EG 2BS2B 3DBHB 4NJ7A 3H7SA 1KH0A 2WU5B 2QHOA 1M4VA 2KDMA 4KIKA 2RDHA 3PHXB 1V8CA 2G4SA 3U30A 2KZRA 2BF8B 4GDKA 4DDGD 4AQ7A 3JVZX 4RGTA 3IHPC 3R7QA 2IBIB 2E6XA 1E8ZA 2INDC 4TQ1A 1WZ0A 1P1AA 2ASQA 4AOFA 1P0RA 3MHSD 2HJ1A 4K3CA 2OHFA 1B1ZA 3KLSX 3ZKJC 2JQRB 4LLGM 2KWVB 3BWUD 3HM3A 1IPGA 1HQRD 2ZPNA 5EDSA 3IAM1 3NHEB 1C77A 1SSNA 2DAJA 1F2RC 4XWTA 3N1YC 4LNKA 1WX9A 3VTWA 1TT5B 2WS3B 2KDIA 4DHZB 3AI5A 2LJIA 1F2RI 2BKRB 1FFVA 1HZ6A 3BIID 2YEPF 1V1PB 4C4VA 5AUIA 1EM7A 4ZRKA 1ZW7A 3A33B 5GMVA 2V3SA 1STEA 1MG4A 2KJHB 3RNFC 2GBNA 2PE6B 5LLIA 2MBQA 2SEBD 3AE3B 3W1YA 4N59A 4DBGA 1FNVA 2VZKB 4C7YA 3NZ3A 1WWTA 1J7CA 1YJJA 4XWWA 3C19A 3KUCB 5C23A 5I4DA 1H4RA 5D94A 2I2YA 4GDLB 4WJOA 3RT3B 3AECB 4EUTA 2L32A 4M02A 2MCNB 4D2KA 4DXGA 3ENEA 3PHWB 1E9MA 2WXHA 4WWMA 5DPRA 2GRIA 4PS3A 3Q8CA 2LMCA 1RYJA 3DBLI 1Q10A 4EKUA 1DYQA 4HJKA 3TEXA 2R61A 3A4SC 1E7PB 2V3NA 3AV8A 3JW0X 3ZNGC 1LQBA 1AN8A 2ZZPB 2MBHA 1T0YA 3RN9C 3QHTA 2WX0A 3RPFC 2XK5A 4BFRA 4JPSA 1XO3A 4MM3A 2QC8A 2V1YA 4IG7B 3AXCA 5G5HA 3AU5A 5IO9A 2L52A 4HPMB 3L54A 2JZPA 1HTQA 1HA5A 2EMSA 2LVOA 1RWSA 3DVGX 3PZDA 2EMTA 1ZP0B 1T3QA 1L7YA 3L4PA 5BO4B 3R3MA 1FIQA 2MSED 1Q1OA 4W9IA 3PREA 3AEGB 5BMIA 2Z0DB 3ML9A 2KJ6A 4HKZE 2N1VA 2B3AA 2K8BA 1JWAD 3AEFB 1WM2A 4WJPA 5MPOA 4YSYB 2WX1A 4DHJB 2IGGA 2O6VA 4YL8A 1I42A 2KNBA 1WJ6A 4WQMA 2ZCCA 2M19A 3PGEA 4AWJA 2DYOA 1EWYC 5T8IA 2HTME 1KJTA 4IM2A 4L23A 5J18A 4GB9A 4MSMB 1KFYB 3DBHI 2JYTA 4G3XB 2JPHA 3P4SB 3PRZA 3BYTB 3H1UA 1G6JA 4K7SA 1SJHD 4OVVA 1GC7A 1JROA 1P98A 1GPXA 4M8MA 3APCA 3W5VB 4B9KA 5E6PA 3T9LA 2KANA 3CWIA 1ZDVA 2WDVB 3NOBA 5DPTA 1KLUD 4K7UA 4W9CA 1CK1A 2Y5BB 4GMVA 2KDEB 3FC4A 3AEEB 1WRDB 1UH6A 4XC2A 4GXBA 1GAQB 2WXPA 1AWDA 3HHMA 1ZUD2 4DHJD 2CHXA 5BMHA 1MI0A 4ZYNA 1C76A 4II2B 4YT0B 2K0PA 1AARA 3R66C 2N9LA 2Z8LA 3CSFA 2KC1A 2WNMA 3TSSA 3IXSA 4HK2A 4NQLB 4EFOA 1E8YA 2GI9A 4B95A 3BYYB 3V61A 2K8HA 2JWUA 5J17A 1P9DU 2O2VB 2D07B 4KKIA 3NG0A 4NNJB 1TBEA 4BOZB 2J53A 3ZRCA 1C78A 3IBEA 1NYRA 2DHZA 1N63A 3BVGA 5HHDG 3ML8A 3ZVVA 3N9YC 3N32A 2INCC 2H88B 2GBKA 4XGAB 3ALBA 1WY8A 1Z2MA 5C1ZA 4HPLB 4S17A 2REXA 2A4ZA 4KVGB 3EFUA 2G45B 1WJ4A 1WI0A 1EU3A 3R2TA 2DZJA 2LRWA 1N60A 1R4NB 3FILA 4P6VF 1GJZA 3PTFC 2PMVA 4O1NA 4J6IA 1JMLA 2MJ3A 2V4IB 4A9AA 4JL9A 2L7RA 2N1WA 4ZHPA 2KTFA 2LHEA 4ZRIA 3SEBA 1VLBA 3Q3NC 1EF1A 1XEEA 3BY4B 1DOYA 1ZKHA 3VUXA 4KX6B 1FXAA 2W82A 1E7VA 1FXIA 2N9XA 3RMKC 4IKGA 1WGGA 4NAWA 1EUVB 2IDYA 2GB1A 1UWXA 2WHIA 1OEYJ 2QIEB 4LNOA 2MBEA 1YNTE 1P3QU 1VZ7A 3DPDA 3IAS1 3A4RA 1S3SG 1VZ6A 2QMTA 4KDLB 4IOIE 3BK1A 4A20A 1VD2A 2GLSA 3A9KB 1FD6A 3RNEC 2MP2A 5AZGA 2LGSA 1I4HA 2IGHA 1CQVA 4IDIA 3O65B 1SBBB 4UDUC 3WIMA 1C3TA 4P16A 4JLCA 4XX5A 3Q3MC 2ZVNA 2HTHA 4MH0E 1Z5SB 1FMAD 3RI7C 2LVPA 2VH1A 1F52A 1YN5A 3P4QB 3LXFA 5IA7A 1OQRA 4OHJA 1YX6B 1OTRB 2WQYB 2NTSA 4JIOU 3AM9A 4URKA 2IZVB 2JWZA 4BVUC 2YVCA 1ET9A 3TEZA 2L83A 2MX2A 3VH4B 4USAA 1KF6B 1ZOYB 1JRPA 3ETRA 4HXDA 4HDQA 2AQ1B 2FBWB 1TS5A 2X8XX 1BMLC 3PRPB 4PK1A 3KUZA 2ZJDA 2ACZB 2ICIA 3GP7A 1T0RC 3M95A 3RUIB 1P7EA 2XEWA 2LUEA 2K1FA 4DXAB 1K8RB 2AQ3B 3H7PB 1QOAA 3V3XA 4FN2A 1CJEA 2XN9C 1OGWA 1VZ8A 2MH7A 3VTVA 5C2TB 2V3PA 3VVWB 3VH3B 3P1MA 2AYOB 3Q2AC 3AE9B 2LD9A 1WF9A 4WWPA 2KQ7A 2FUG1 4FXCA 3W9CB 2NR2A 2UU7A 3S2AA 3L13A 2G3QB 3H8HA 4MDKE 4M00A 2FCMA 3MP9A 4RF0A 4FHKA 2W54A 2KFKA 2M56B 1ZPSA 4KGRA 3OLMD 1KM7A 4C80A 1V9JA 2G1EA 3PZ8A 2PVOD 1UGMA 4HCPB 4AJYB 1V49A 2Q5WD 1E10A 5GXGB 3RNBC 3QAQA 1C4CA 2BB5A 2NVUI 2J0KA 4DQOC 1A5RA 2JYEA 2K6QA 4I6NB 4IM3A 5JHAA 1WRIA 4IWQA 4F7ZA 1QZEA 3PV1A 2W3RA 3DHGC 2N9KA 3DVNU 1WFYA 3HK0A 1UBQA 2KVZA 1V80A 1R4NI 3PZ7A 4OVZA 3ZIMA 2WXOA 1QT9A 4LK0M 4JX1C 4KV2A 5AEKB 3JSVB 1JW9D 1I4XA 4MJSA 3WCQA 1YQ3B 5E6NA 2M8SA 2GBJA 3T3NA 1WSPA 3AE4B 1NI2A 2RSUA 5FKAC 1F77A 1ZXIA 4TMAB 2DZKA 1V5OA 4ZYSA 1H8CA 2K3UA 1ROEA 4KSKC 3BK2A 2VRRB 2Y5PA 5C3JB 1L6UA 2KX3A 1V6EA 3Q8FA 1EO6A 3BVMA 1WXVA 1OEYA 3TBLD 2Z59B 3NVWA 1KRHA 1WGKA 4AJWA 2PEAA 1WX8A 3EUB2 3NY5A 1I7HA 3ZUNA 1NENB 3B1LX 3L17A 1V86A 3EC8A 4BZAA 3I9V1 4N9F4 4BKGA 3URYA 1TGZB 3C8YA 2UYZB 2OEDA 1QOGA 2QILA 2DNFA 3NUHB 3AEDB 2ZVOA 3ZTCA 2J7QB 2CJOA 3UGBB 1TZOA 2FIDA 1IBXA 3QK0A 1WMHA 2ONQA 2JRHA 3I5JC 4NY0A 5EE3A 1GUAB 4P7IA 4ZDVA 1L0YB 1FPYA 1RRBA 4YWGG 3TIXA 1MPEA 2L8JA 3ZQ4A 2G9HD 1XF5L 3W5UB 4MH8A 3ZNID 4LJPB 2XNAC 2KDBA 4HCNB 1PGBA 1N6ZA 1JWUD 1TIFA 1WYWB 1X1MA 1I4GA 2INPE 2KX0A 2J42A 1WJNA 1JALA 3UIPB 2V0GA 4G11A 3A9JB 5FR6A 2MWSB 3AN1A 3EFCA 3UQBA 4GU2A 2MBBB 2I1KA 2BB6A 1XQQA 2WXIA 4ITKA 3Q8AA 4TSSA 1VR9A 2V4LA 1WJUA 2J0MA 2ZNVB 1NEKB 1FRDA 2RDBC 2J4XA 4KZ0A 1ET6A 2HDEA 4US8A 2H89B 4AUQC 4E71A 3IT6B 3APFA 1HZ5A 1V81A 2BGFA 1J19A 4LNIA 2KTRA 4YXDB 4NZLB 4G0NB 3MJWA 1UZXB 4WH4A 4MGZE 3AH7A 2QEJC 2L00B 1QOFA 5EE1A 1FRRA 5IOIA 1J0GA 3ZJTA 3Q6BA 3VRBB 4C56C 2VZKD 3QQ8B 4ICVA 3VR9B 3CF6E 2MP2B 2OJRA 1LGRA 2LGXA 4JE3B 3AE7B 4M0WA 2KN4A 2N7DA 2LGIA 4E74A 1DGJA 2NPTB 2CHWA 2JT4B 3WA0A 2AL6A 2EKEC 3L08A 1YJIA 3HVDA 3KW5B 3RZFA 1RLFA 5AZFA 4FADA 4IW0A 3ZW3A 2DZIA 3CSTA 3NS1A 2C9WB 3V6CB 3W1SC 4GOCA 2K8CA 4WIPA 5G5GA 3SD5A 5FK9C 3WAMA 3ECIA 2D5GA 2KJRA 1F1HA 4BKTA 2BW2A 3VHTC 3PPAA 2CHZA 4N58A 2BYFA 1WZ3A 2CU1A 4I6PA 2PJHA 2JX5A 4MELA 3JYUA 1K53A 2JVCA 1WXSA 3AE5B 1GNUA 1GG3A 3W1SA 2WDRB 3T3OA 2IYDB 3W2DA 2IO1B 3Q14C 4ARIA 1QF6A 1XLNA 3L16A 4K3BA 5DPWA 1PUTA 2D3GA 4W9DA 1TY2A 4KZCA 3Q8BA 1SXTA 4FJYA 4MACA 4B6WA 3IG3A 3OWEB 4M8NA 3B2FA 3QJZA 2BPSA 2QSDA 2IPKD 1JRUA 3PT2B 3TCAA 4XYCA 4PYUA 4BKSD 1L6VA 2L76A 3RFZB 2ON8A 3SHQA 4K7WA 2NBWB 3MHZA 1E6EB 3I57A 2FIFA 3AULA 4A8XC 1V5TA 2LVQA 1ENFA 3DBSA 3KQ4A 4YTNB 1MHHE 4NAMA 5L83A 2AQ2B 3VRAB 1SB3C 2PIAA 2ZEQA 2DYMA 1IYFA 2MW5A 3RULA 3C0RB 2I38A 2DX5B 4HLEA 3B0AA 3PO0A 1QLBB 1C79A 3AE6B 1JWSD 3P2BA 4EEWA 2BYVE 1GB1A 4X57B 2NBUA 4ANWA 4HDOA 5JXVA 3ZDTA 1FCCC 1TYGB 4MGIE 4NPNA 1EU4A 3NVVA 1V1PA 5G55A 3RNCC 1NDDA 3BZDB 2JXXA 5H8YE 5CHVC 2EKIA 2KO3A 2BKFA 3VAWA 4CHKA 3U7DA 2IGDA 4FA6A 3RYTA 4KIKB 5HG2A 3SFDB 4GDKB 3RZWC 2DENB 3DDCB 2JY6A 2KFJA 2NBVB 4W9JA 1S1QB 2ZW0A 2LRUA 3OJ3A 2VH2A 4WWOA 2AX5A 1MJDA 2R2QA 2LWPA 1XLQA 5HKHA 1WIAA 2KYWA 4RF1A 2JZZA 4GGQA 1K50A 4GDLA 2K39A 2LI5A 2PW9A 1C4AA 2PPHA 4OZAA 3N3KB 4BBNF 2NTTA 4TKNA 5LXHA 3QC8B 3TUOA 2DZMA 4M01A 2KLGA 3GOEA 4IWPA 4RNAA 2QJLA 4KKJA 3ZXVA 2DYBA 3M62B 4ZRPA 1IGDA 4C4VB 1IUEA 1YD8U 1FEHA 1IP9A 2XBBC 2AEHA 4BAXA 4PT5A 3CIRB 1HTOA 3NVYA 5LXIB 4TUUA 1SGHA 4OZCA 3DWGC 2LXAA 2D2QA 4YTMB 3M3JA 2I1JA 2HD5B 1JQ4A 4OVUA 1OQYA 3B9JA 2JXTA 2KC2A 1XLOA 2KD0A 3ZJVA 2TSSA 4XE0A 3Q8EA 3ZJUA 1NYQA 2OJWA 2WDQB 3L10B 1E8XA 1TS4A 2YLMA 2MJDA 2UWQA 3Q69A 3P4RB 1BUIC 2BVCA 4KDIC 2BT6A 1UD7A 1DOIA 1T0SC 2MRPA 4RGMA 2K5PA 4YSXB 4HKQA 2B76B 1PDXA 2WXQA 2FE8A 2E3TA 2KLCA 3HVZA 2WXFA 2N9PC 1ESFA 5CX3A 1QOBA 2EELA 1LFDA 4I6LB 5IP4D 1XCQL 2XK5B 2D3CA 4MM3B 1TZ1A 4KGSA 1QQRA 3LJ3A 2JF5A 3AB5A 3EECA 1FNUA 5IKCM 1RFKA 3VUYA 1L0VB 1XT9B 3ZGZA 2KMCA 2BS4B 2K9XA 3NS8A 3R2IA 4DWFA 2RD0A 5JH5C 1TS2A 2INNE 1WXQA 5L95C 3H6NA 4C7ZA 4TV3A 4ANUA 4RFBA 3R8BA 2KACA 2SAKA 2K6DB 4DXFA 1UBIA 2NCNA 4LTUA 3TJPA 5IN7A 4ZRQA 4XZ4A 1FM0D 1PQSA 2IO0B 1K51A 4WJNA 3VFKA 1V97A 3DWMA 4MEMA 2AL3A 3DHHC 2RR9A 4RGNA 1UNSA 2JSVX 1YQBA 3ZLZA 1JWMD 1XD3B 2HJ8A 2O6VB 1I4RA 3DVGY 1WGYA 1ISNA 1HXYD 3KUDB 2WDTB 1T6BX 2CR5A 3ZDMC 3WAOA 1F0ZA 2L3ZA 1C1YB 5JHBA 2O2VA 4EE2A 5BYSA 3KWLA 2PTLA 1MFWA 3DCGA 5DPSA 4L1BA 5D6JB 2DLBA 1WE6A 2LFIA 5J2RA 3VXWA 3ZYYX 3FAHA 2N7JA 1L4DB 1WR6E 4JWSC 1R4MB 4BOSC 2QDFA 3AEBB 1NVID 1YX5B 3MJ5A 2PVGC 3U2SC 4F8CB 5CHWA 2JU6X 1MVKA 4LCDE 4HROA 4HPPA 1ZXHA 1WXAA 3NZUA 4II3B 3QX1A 3LYYA 4XDDA 3NVZA 5DCNA 2Y5CA 1PFDA 2KQ4X 4RM9A 4US9A 4ZHOA 3ABVB 3WAPA 2WYQA 2K22A 2N9EB 4FLHA 4ANVA 2KK8A 3NZSA 2D3BA 1UELA 2FCNA 1WX7A 1XXGA 2O6VD 4HRSA
chains in the Genus database with same CATH topology
2CHWA 2JT4B 2KTRB 2A4ZA 1BT0A 2REXA 3VDZA 2AL6A 2EKEC 3EFUA 3QCAA 2G45B 3L08A 1WJ4A 4KVGB 4A3OA 1MG8A 1WI0A 3DBRI 3KW5B 4CO7A 2FUHB 3RZFA 2DZJA 1E90A 2LRWA 1GC6A 1RLFA 5AZFA 4FADA 4IW0A 1GJZA 1VCBA 3MTNB 3K9PB 3PLUA 3ZW3A 2DZIA 3CSTA 1WGHA 3I3TB 3PTFC 2C9WB 3V6CB 3W1SC 4GOCA 3A1QA 4EZJA 2K8CA 2Z0EB 4NJ6A 2IY0B 4W9EA 4J6IA 1KLVA 4W9LA 2A5UA 1E8WA 3SD5A 3WAMA 4K81A 2JRIB 2KJRA 3ECIA 4JL9A 4BKTA 2L7RA 2ZPYA 4TQ0A 3B08A 4MGYE 3OJ4B 1M94A 2N1WA 4WQOB 3VHTC 2L05A 2KTFA 2DAFA 3PPAA 4ZRIA 2CHZA 1YJ1A 4M0WB 2BYFA 1WZ3A 2CU1A 4I6PA 2FNJB 2PJHA 4MELA 2ZCBA 3A9KA 3JYUA 1EF1A 3PS6A 2JVCA 3BY4B 3U8ZA 1WXSA 1ZKHA 3UINB 2N7EA 4WJQA 3VUXA 1GNUA 4E3CA 3ONSA 3UF8A 1E7VA 2N9XA 2LASA 1EF5A 4WWNA 1WGGA 3KYDD 4KSLC 4NAWA 1GG3A 3PLVA 3ZTDA 3W1SA 3V62A 4FBJB 3BINA 4IC7B 3UQAA 2BYEA 2IYDB 1EUVB 3IVFA 3VQIA 2IO1B 4IUMB 3L16A 3PSEB 5DPWA 1D3ZA 4HVBA 2AWTA 3X23A 2KMAA 1U4AA 1OEYJ 2LGDA 2D3GA 2MBEA 4W9DA 1P3QU 3QA8A 3DPDA 4JGHB 3A4RA 1S3SG 4G50A 4KDLB 4KZCA 2G4DB 3PRMB 4FJYA 5G2NA 2NS5A 2KXJA 4DK5A 5KHQA 4A20A 3QARA 2RGFA 4B6WA 3IG3A 2M17A 1VD2A 4FHJA 2L0TA 3A9KB 2IY1B 3QJZA 4M8NA 2BPSA 4GIVA 2MP2A 1JRUA 3PT2B 5AZGA 4PS7A 3TCAA 3RD2A 4PYUA 3O65B 4BKSD 5CHFA 3WIMA 5E6OA 3R7RA 2L76A 4NAWB 4NJ7A 1C3TA 3SHQA 2M0XA 3H7SA 4K7WA 4JLCA 4XX5A 2QHOA 2NBWB 2HTHA 2ZVNA 4MH0E 3WA0A 2FIFA 3AULA 1Z5SB 1V5TA 2LVQA 3DBSA 3ZNZB 3H7PA 4KIKA 3SU8X 4LDTB 3PHXB 2LVPA 3TMPB 4W9KA 1E5WA 2G4SA 5IA7A 5L83A 3U30A 2KZRA 2BF8B 4GDKA 1YX6B 4ZRJA 4DDGD 1OTRB 2KWUB 3JVZX 2ZEQA 1WGDA 2DYMA 1IYFA 3IHPC 4JIOU 3R7QA 2IBIB 2MW5A 3RULA 3C0RB 4NQKE 4URKA 2IZVB 2JWZA 2DX5B 4FJZA 2YVCA 2IO3B 4BVUC 4HLEA 1E8ZA 4TQ1A 1WZ0A 3B0AA 1P1AA 2ASQA 2LZ6A 2MX2A 4AOFA 3P2BA 4EEWA 2BYVE 3VH4B 4X57B 2NBUA 4ANWA 4HDOA 2PE9A 3ZDTA 3TL5A 1P0RA 1TTNA 3MHSD 4HXDA 4MGIE 1FXTB 2FAZA 4HDQA 4NPNA 5G55A 1NDDA 3ZKJC 3PRPB 2KWVB 2JXXA 3IFWB 4IWOA 3UIOB 5CHVC 1SIFA 2ZJDA 3HM3A 3KUZA 2KO3A 2BKFA 2KDFB 3M95A 3RUIB 2XEWA 2LUEA 3VAWA 1IPGA 2K1FA 1K8RB 3U7DA 4CHKA 4DXAB 2ZPNA 5EDSA 4FA6A 3H7PB 2OOBB 3RYTA 3NHEB 4KIKB 4FN2A 1OGWA 2KKCA 3LDZE 2DAJA 3VTVA 4ANXA 4GDKB 3RZWC 2DENB 3DDCB 2JY6A 2KFJA 2NBVB 3VTUA 4W9JA 1S1QB 1WX9A 2D10A 3VH3B 3VVWB 2AYOB 2CKHB 2LRUA 3OJ3A 4IM0A 3VTWA 4WWOA 3KH0A 2LD9A 1WF9A 2KDIA 2KQ7A 4WWPA 2R2QA 4DHZB 3AI5A 4W9GA 2LWPA 5HKHA 1WIAA 2BKRB 2JZZA 2KWCA 3V6EB 4GGQA 2NR2A 4GDLA 2LJ5A 3S2AA 3L13A 2G3QB 4MDKE 4DHZE 2JZ3B 2MLBA 4ZRKA 2K39A 2LI5A 1ZW7A 1LM8B 2C7NB 1WXMA 2PPHA 3H9DA 4LDTD 3A33B 2FCMA 4FHKA 5GMVA 2KFKA 3N3KB 4BBNF 4TKNA 5LXHA 1R4MI 2V3SA 3QC8B 2FCSA 3OLMD 2KJHB 2GBNA 1NBFC 2DZMA 1KM7A 2PE6B 5LLIA 2MBQA 2KLGA 5AZHA 2KQSA 1V9JA 3GOEA 3K9OB 2GBRA 4IWPA 4JQWC 3W1YA 4A3PA 4DBGA 3APDA 2BWES 1UGMA 4HCPB 2MQJA 4AJYB 1V49A 3Q3FA 3KUCB 3JSVA 2GMIC 5C23A 2DYBA 3QAQA 3M62B 1H4RA 5D94A 4GDLB 2W9NA 2MA9B 4WJOA 3RT3B 2LGYA 4EUTA 1YD8U 2MBOA 1IP9A 2MCNB 3ENEA 1YIWA 2NVUI 2C7HA 2J0KA 2XBBC 3PHWB 2AEHA 3Q3JA 5JZEB 2IO2B 3DOWA 5LXIB 1A5RA 4TUUA 5DPRA 1F9JA 1Q0WB 4PS3A 3RCZA 2K6QA 1SGHA 4FULA 3WALA 4I6NB 2KFKB 5D2MB 4IM3A 5JHAA 3DBLI 1RAXA 4IWQA 4F7ZA 1QZEA 2HE7A 3PV1A 2LXAA 2D2QA 4EKUA 4HJKA 3A4SC 3L0WB 2I1JA 2HD5B 3M3JA 3DVNU 1WFYA 1OQYA 3HK0A 3M63B 1UBQA 3JW0X 4OVUA 1V80A 1R4NI 2KC2A 3ZNGC 1LQBA 3ZIMA 2ZZPB 2MBHA 1T0YA 2KD0A 4KV2A 3QHTA 2WX0A 3JSVB 4MJSA 5AEKB 2L0FA 2XK5A 4BFRA 4MM3A 1KOTA 3L10B 4IG7B 2V1YA 4DDID 1E8XA 3AXCA 5E6NA 2GBMA 2YLMA 2M8SA 2UWQA 2GBJA 3AU5A 3HIZA 3DVNV 4HPMB 2M1MA 3L54A 3V60A 1NI2A 2RSUA 4GN1A 1WGRA 2DZKA 4KDIC 5IAAC 1I35A 1V5OA 2EMSA 2LVOA 3DVGX 1UD7A 1RFAA 3PZDA 1H8CA 2RPQA 4AP4C 4KSKC 2EMTA 1CMXB 1L7YA 2MRPA 2BWFA 4EZLA 2VRRB 3ZRFA 5BO4B 3R3MA 2KX3A 1V6EA 2MSED 1EO6A 3ZO5B 1WXVA 1Q1OA 1Q5WB 1OEYA 3PREA 4W9IA 3TBLD 5D7GA 2Z59B 2KLCA 3HM6X 2N9PC 2Z0DB 2GOWA 3ML9A 4AJWA 3N30A 2KJ6A 2PEAA 1WX8A 2ZNVC 4MJSB 1LFDA 5CX3A 4I6LB 2XK5B 3NY5A 1TZ1A 3ZUNA 2N1VA 3B1LX 2B3AA 2KVRA 2K8BA 3L17A 1WM2A 1V86A 3EC8A 3LJ3A 4WJPA 2JF5A 2WX1A 3EECA 4DHJB 4N9F4 3D32A 2O6VA 4YL8A 3VUYA 1XT9B 4BKGA 1I42A 1LXDA 1TGZB 1WJ6A 2KHWB 2JUOA 2KNBA 4HWIB 2UYZB 4W9HA 3SDLC 2KMCA 2ZCCA 3NS8A 4K1RB 4DWFA 2RD0A 4RMAA 3A9JA 3KVFB 1WR1A 3PGEA 5JH5C 4AWJA 2DYOA 1WE7A 2ZVOA 3ZTCA 5L95C 2J7QB 3H6NA 3UGBB 2FIDA 1KJTA 4IM2A 1Y8RC 1E7UA 3QK0A 4TV3A 5J18A 4ANUA 4GB9A 1WMHA 3ZNHB 2CS4A 4CYEA 2JRHA 4MSMB 4NY0A 3DBHI 4EOYA 1GUAB 2K6DB 4P7IA 4ZDVA 1UBIA 3QWZB 2NCNA 4G3XB 3TJPA 3PVLA 1RRBA 2JPHA 4RM8A 3TIXA 4XZ4A 1PQSA 2C5LC 2L8JA 3PRZA 2IO0B 4WJNA 3VFKA 2KN5A 3H1UA 4MEMA 4ICUA 1WM3A 2AL3A 4EZKA 2KOXA 3ZNID 4LJPB 1G6JA 2RR9A 4K7SA 4W9FA 4OVVA 1GC7A 2KDBA 2FCQA 1YQBA 3ZLZA 1X1MA 4HCNB 1WYWB 1XD3B 4ASWC 2HJ8A 2KX0A 4WAAA 2O6VB 1P98A 3DVGY 1WGYA 4M8MA 1ISNA 3APCA 1WJNA 3WANA 3UIPB 1HE8A 4BBNC 2D11A 3KUDB 4B9KA 2WDTB 3A1QB 3A9JB 4G11A 5E6PA 5FR6A 2MWSB 3T9LA 3T8MA 3UQBA 2CR5A 3ZDMC 4PYZA 3WAOA 1J8CA 2R2OA 2L3ZA 1C1YB 2KANA 3DQVA 2MBBB 3AU4A 4GU2A 4F1SA 2LXCA 2I1KA 3NOBA 3KYCD 2O2VA 1XQQA 5JHBA 5DPTA 1WMHB 4K7UA 4W9CA 2V4LA 2Y5BB 1WJUA 2J0MA 2ZNVB 4GMVA 3DCGA 5DPSA 2KDEB 5D6JB 2J0JA 4KZ0A 1WRDB 1UH6A 1WE6A 4XC2A 4GXBA 5J2RA 4AUQC 3HHMA 4E71A 3VXWA 4DHJD 2CHXA 3APFA 1V81A 4ZYNA 5CTRC 2BGFA 1J19A 1WR6E 2NPTA 4II2B 2C7MB 2KTRA 1L2NA 4LJOB 4BOSC 1AARA 3R66C 1WH3A 4MSQB 3QIJA 1YX5B 4G0NB 4GSWA 4MGKE 2M4NA 3CSFA 2KC1A 3MJWA 4F8CB 4HK2A 5CHWA 4BKSA 2WWZA 4NQLB 1UZXB 1ZGUB 4EFOA 1E8YA 1V2YA 3OAWA 4LCDE 4MGZE 4FJVB 4B95A 3X0WA 1WXAA 2L00B 3NZUA 4II3B 3V61A 2K8HA 5TR5A 5J17A 1P9DU 2O2VB 3QX1A 2D07B 3CMMB 5DCNA 4NNJB 1TBEA 4BOZB 3ZRCA 3IBEA 2C60A 4PS8A 1SE9A 4RM9A 2DHZA 3VUWA 1J0GA 3WAPA 3QQ8B 3EHVA 4ICVA 3ML8A 2WYQA 3CF6E 2N9EB 2MP2B 4FLHA 2OJRA 2KK8A 2LGXA 3GZNI 3N32A 4ANVA 3ZVVA 3NZSA 2GBKA 2FCNA 1UELA 3ALBA 1WY8A 1Z2MA 1WX7A 2N4FA 5C1ZA 2N7DA 4HPLB 2O6VD 5KHOA 4E74A 2K25A 2NPTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHW A;  2JT4 B;  2KTR B;  2A4Z A;  1BT0 A;  2REX A;  3VDZ A;  2AL6 A;  2EKE C;  3EFU A;  3QCA A;  2G45 B;  3L08 A;  1WJ4 A;  4KVG B;  4A3O A;  1MG8 A;  1WI0 A;  3DBR I;  3KW5 B;  4CO7 A;  2FUH B;  3RZF A;  2DZJ A;  1E90 A;  2LRW A;  1GC6 A;  1RLF A;  5AZF A;  4FAD A;  4IW0 A;  1GJZ A;  1VCB A;  3MTN B;  3K9P B;  3PLU A;  3ZW3 A;  2DZI A;  3CST A;  1WGH A;  3I3T B;  3PTF C;  2C9W B;  3V6C B;  3W1S C;  4GOC A;  3A1Q A;  4EZJ A;  2K8C A;  2Z0E B;  4NJ6 A;  2IY0 B;  4W9E A;  4J6I A;  1KLV A;  4W9L A;  2A5U A;  1E8W A;  3SD5 A;  3WAM A;  4K81 A;  2JRI B;  2KJR A;  3ECI A;  4JL9 A;  4BKT A;  2L7R A;  2ZPY A;  4TQ0 A;  3B08 A;  4MGY E;  3OJ4 B;  1M94 A;  2N1W A;  4WQO B;  3VHT C;  2L05 A;  2KTF A;  2DAF A;  3PPA A;  4ZRI A;  2CHZ A;  1YJ1 A;  4M0W B;  2BYF A;  1WZ3 A;  2CU1 A;  4I6P A;  2FNJ B;  2PJH A;  4MEL A;  2ZCB A;  3A9K A;  3JYU A;  1EF1 A;  3PS6 A;  2JVC A;  3BY4 B;  3U8Z A;  1WXS A;  1ZKH A;  3UIN B;  2N7E A;  4WJQ A;  3VUX A;  1GNU A;  4E3C A;  3ONS A;  3UF8 A;  1E7V A;  2N9X A;  2LAS A;  1EF5 A;  4WWN A;  1WGG A;  3KYD D;  4KSL C;  4NAW A;  1GG3 A;  3PLV A;  3ZTD A;  3W1S A;  3V62 A;  4FBJ B;  3BIN A;  4IC7 B;  3UQA A;  2BYE A;  2IYD B;  1EUV B;  3IVF A;  3VQI A;  2IO1 B;  4IUM B;  3L16 A;  3PSE B;  5DPW A;  1D3Z A;  4HVB A;  2AWT A;  3X23 A;  2KMA A;  1U4A A;  1OEY J;  2LGD A;  2D3G A;  2MBE A;  4W9D A;  1P3Q U;  3QA8 A;  3DPD A;  4JGH B;  3A4R A;  1S3S G;  4G50 A;  4KDL B;  4KZC A;  2G4D B;  3PRM B;  4FJY A;  5G2N A;  2NS5 A;  2KXJ A;  4DK5 A;  5KHQ A;  4A20 A;  3QAR A;  2RGF A;  4B6W A;  3IG3 A;  2M17 A;  1VD2 A;  4FHJ A;  2L0T A;  3A9K B;  2IY1 B;  3QJZ A;  4M8N A;  2BPS A;  4GIV A;  2MP2 A;  1JRU A;  3PT2 B;  5AZG A;  4PS7 A;  3TCA A;  3RD2 A;  4PYU A;  3O65 B;  4BKS D;  5CHF A;  3WIM A;  5E6O A;  3R7R A;  2L76 A;  4NAW B;  4NJ7 A;  1C3T A;  3SHQ A;  2M0X A;  3H7S A;  4K7W A;  4JLC A;  4XX5 A;  2QHO A;  2NBW B;  2HTH A;  2ZVN A;  4MH0 E;  3WA0 A;  2FIF A;  3AUL A;  1Z5S B;  1V5T A;  2LVQ A;  3DBS A;  3ZNZ B;  3H7P A;  4KIK A;  3SU8 X;  4LDT B;  3PHX B;  2LVP A;  3TMP B;  4W9K A;  1E5W A;  2G4S A;  5IA7 A;  5L83 A;  3U30 A;  2KZR A;  2BF8 B;  4GDK A;  1YX6 B;  4ZRJ A;  4DDG D;  1OTR B;  2KWU B;  3JVZ X;  2ZEQ A;  1WGD A;  2DYM A;  1IYF A;  3IHP C;  4JIO U;  3R7Q A;  2IBI B;  2MW5 A;  3RUL A;  3C0R B;  4NQK E;  4URK A;  2IZV B;  2JWZ A;  2DX5 B;  4FJZ A;  2YVC A;  2IO3 B;  4BVU C;  4HLE A;  1E8Z A;  4TQ1 A;  1WZ0 A;  3B0A A;  1P1A A;  2ASQ A;  2LZ6 A;  2MX2 A;  4AOF A;  3P2B A;  4EEW A;  2BYV E;  3VH4 B;  4X57 B;  2NBU A;  4ANW A;  4HDO A;  2PE9 A;  3ZDT A;  3TL5 A;  1P0R A;  1TTN A;  3MHS D;  4HXD A;  4MGI E;  1FXT B;  2FAZ A;  4HDQ A;  4NPN A;  5G55 A;  1NDD A;  3ZKJ C;  3PRP B;  2KWV B;  2JXX A;  3IFW B;  4IWO A;  3UIO B;  5CHV C;  1SIF A;  2ZJD A;  3HM3 A;  3KUZ A;  2KO3 A;  2BKF A;  2KDF B;  3M95 A;  3RUI B;  2XEW A;  2LUE A;  3VAW A;  1IPG A;  2K1F A;  1K8R B;  3U7D A;  4CHK A;  4DXA B;  2ZPN A;  5EDS A;  4FA6 A;  3H7P B;  2OOB B;  3RYT A;  3NHE B;  4KIK B;  4FN2 A;  1OGW A;  2KKC A;  3LDZ E;  2DAJ A;  3VTV A;  4ANX A;  4GDK B;  3RZW C;  2DEN B;  3DDC B;  2JY6 A;  2KFJ A;  2NBV B;  3VTU A;  4W9J A;  1S1Q B;  1WX9 A;  2D10 A;  3VH3 B;  3VVW B;  2AYO B;  2CKH B;  2LRU A;  3OJ3 A;  4IM0 A;  3VTW A;  4WWO A;  3KH0 A;  2LD9 A;  1WF9 A;  2KDI A;  2KQ7 A;  4WWP A;  2R2Q A;  4DHZ B;  3AI5 A;  4W9G A;  2LWP A;  5HKH A;  1WIA A;  2BKR B;  2JZZ A;  2KWC A;  3V6E B;  4GGQ A;  2NR2 A;  4GDL A;  2LJ5 A;  3S2A A;  3L13 A;  2G3Q B;  4MDK E;  4DHZ E;  2JZ3 B;  2MLB A;  4ZRK A;  2K39 A;  2LI5 A;  1ZW7 A;  1LM8 B;  2C7N B;  1WXM A;  2PPH A;  3H9D A;  4LDT D;  3A33 B;  2FCM A;  4FHK A;  5GMV A;  2KFK A;  3N3K B;  4BBN F;  4TKN A;  5LXH A;  1R4M I;  2V3S A;  3QC8 B;  2FCS A;  3OLM D;  2KJH B;  2GBN A;  1NBF C;  2DZM A;  1KM7 A;  2PE6 B;  5LLI A;  2MBQ A;  2KLG A;  5AZH A;  2KQS A;  1V9J A;  3GOE A;  3K9O B;  2GBR A;  4IWP A;  4JQW C;  3W1Y A;  4A3P A;  4DBG A;  3APD A;  2BWE S;  1UGM A;  4HCP B;  2MQJ A;  4AJY B;  1V49 A;  3Q3F A;  3KUC B;  3JSV A;  2GMI C;  5C23 A;  2DYB A;  3QAQ A;  3M62 B;  1H4R A;  5D94 A;  4GDL B;  2W9N A;  2MA9 B;  4WJO A;  3RT3 B;  2LGY A;  4EUT A;  1YD8 U;  2MBO A;  1IP9 A;  2MCN B;  3ENE A;  1YIW A;  2NVU I;  2C7H A;  2J0K A;  2XBB C;  3PHW B;  2AEH A;  3Q3J A;  5JZE B;  2IO2 B;  3DOW A;  5LXI B;  1A5R A;  4TUU A;  5DPR A;  1F9J A;  1Q0W B;  4PS3 A;  3RCZ A;  2K6Q A;  1SGH A;  4FUL A;  3WAL A;  4I6N B;  2KFK B;  5D2M B;  4IM3 A;  5JHA A;  3DBL I;  1RAX A;  4IWQ A;  4F7Z A;  1QZE A;  2HE7 A;  3PV1 A;  2LXA A;  2D2Q A;  4EKU A;  4HJK A;  3A4S C;  3L0W B;  2I1J A;  2HD5 B;  3M3J A;  3DVN U;  1WFY A;  1OQY A;  3HK0 A;  3M63 B;  1UBQ A;  3JW0 X;  4OVU A;  1V80 A;  1R4N I;  2KC2 A;  3ZNG C;  1LQB A;  3ZIM A;  2ZZP B;  2MBH A;  1T0Y A;  2KD0 A;  4KV2 A;  3QHT A;  2WX0 A;  3JSV B;  4MJS A;  5AEK B;  2L0F A;  2XK5 A;  4BFR A;  4MM3 A;  1KOT A;  3L10 B;  4IG7 B;  2V1Y A;  4DDI D;  1E8X A;  3AXC A;  5E6N A;  2GBM A;  2YLM A;  2M8S A;  2UWQ A;  2GBJ A;  3AU5 A;  3HIZ A;  3DVN V;  4HPM B;  2M1M A;  3L54 A;  3V60 A;  1NI2 A;  2RSU A;  4GN1 A;  1WGR A;  2DZK A;  4KDI C;  5IAA C;  1I35 A;  1V5O A;  2EMS A;  2LVO A;  3DVG X;  1UD7 A;  1RFA A;  3PZD A;  1H8C A;  2RPQ A;  4AP4 C;  4KSK C;  2EMT A;  1CMX B;  1L7Y A;  2MRP A;  2BWF A;  4EZL A;  2VRR B;  3ZRF A;  5BO4 B;  3R3M A;  2KX3 A;  1V6E A;  2MSE D;  1EO6 A;  3ZO5 B;  1WXV A;  1Q1O A;  1Q5W B;  1OEY A;  3PRE A;  4W9I A;  3TBL D;  5D7G A;  2Z59 B;  2KLC A;  3HM6 X;  2N9P C;  2Z0D B;  2GOW A;  3ML9 A;  4AJW A;  3N30 A;  2KJ6 A;  2PEA A;  1WX8 A;  2ZNV C;  4MJS B;  1LFD A;  5CX3 A;  4I6L B;  2XK5 B;  3NY5 A;  1TZ1 A;  3ZUN A;  2N1V A;  3B1L X;  2B3A A;  2KVR A;  2K8B A;  3L17 A;  1WM2 A;  1V86 A;  3EC8 A;  3LJ3 A;  4WJP A;  2JF5 A;  2WX1 A;  3EEC A;  4DHJ B;  4N9F 4;  3D32 A;  2O6V A;  4YL8 A;  3VUY A;  1XT9 B;  4BKG A;  1I42 A;  1LXD A;  1TGZ B;  1WJ6 A;  2KHW B;  2JUO A;  2KNB A;  4HWI B;  2UYZ B;  4W9H A;  3SDL C;  2KMC A;  2ZCC A;  3NS8 A;  4K1R B;  4DWF A;  2RD0 A;  4RMA A;  3A9J A;  3KVF B;  1WR1 A;  3PGE A;  5JH5 C;  4AWJ A;  2DYO A;  1WE7 A;  2ZVO A;  3ZTC A;  5L95 C;  2J7Q B;  3H6N A;  3UGB B;  2FID A;  1KJT A;  4IM2 A;  1Y8R C;  1E7U A;  3QK0 A;  4TV3 A;  5J18 A;  4ANU A;  4GB9 A;  1WMH A;  3ZNH B;  2CS4 A;  4CYE A;  2JRH A;  4MSM B;  4NY0 A;  3DBH I;  4EOY A;  1GUA B;  2K6D B;  4P7I A;  4ZDV A;  1UBI A;  3QWZ B;  2NCN A;  4G3X B;  3TJP A;  3PVL A;  1RRB A;  2JPH A;  4RM8 A;  3TIX A;  4XZ4 A;  1PQS A;  2C5L C;  2L8J A;  3PRZ A;  2IO0 B;  4WJN A;  3VFK A;  2KN5 A;  3H1U A;  4MEM A;  4ICU A;  1WM3 A;  2AL3 A;  4EZK A;  2KOX A;  3ZNI D;  4LJP B;  1G6J A;  2RR9 A;  4K7S A;  4W9F A;  4OVV A;  1GC7 A;  2KDB A;  2FCQ A;  1YQB A;  3ZLZ A;  1X1M A;  4HCN B;  1WYW B;  1XD3 B;  4ASW C;  2HJ8 A;  2KX0 A;  4WAA A;  2O6V B;  1P98 A;  3DVG Y;  1WGY A;  4M8M A;  1ISN A;  3APC A;  1WJN A;  3WAN A;  3UIP B;  1HE8 A;  4BBN C;  2D11 A;  3KUD B;  4B9K A;  2WDT B;  3A1Q B;  3A9J B;  4G11 A;  5E6P A;  5FR6 A;  2MWS B;  3T9L A;  3T8M A;  3UQB A;  2CR5 A;  3ZDM C;  4PYZ A;  3WAO A;  1J8C A;  2R2O A;  2L3Z A;  1C1Y B;  2KAN A;  3DQV A;  2MBB B;  3AU4 A;  4GU2 A;  4F1S A;  2LXC A;  2I1K A;  3NOB A;  3KYC D;  2O2V A;  1XQQ A;  5JHB A;  5DPT A;  1WMH B;  4K7U A;  4W9C A;  2V4L A;  2Y5B B;  1WJU A;  2J0M A;  2ZNV B;  4GMV A;  3DCG A;  5DPS A;  2KDE B;  5D6J B;  2J0J A;  4KZ0 A;  1WRD B;  1UH6 A;  1WE6 A;  4XC2 A;  4GXB A;  5J2R A;  4AUQ C;  3HHM A;  4E71 A;  3VXW A;  4DHJ D;  2CHX A;  3APF A;  1V81 A;  4ZYN A;  5CTR C;  2BGF A;  1J19 A;  1WR6 E;  2NPT A;  4II2 B;  2C7M B;  2KTR A;  1L2N A;  4LJO B;  4BOS C;  1AAR A;  3R66 C;  1WH3 A;  4MSQ B;  3QIJ A;  1YX5 B;  4G0N B;  4GSW A;  4MGK E;  2M4N A;  3CSF A;  2KC1 A;  3MJW A;  4F8C B;  4HK2 A;  5CHW A;  4BKS A;  2WWZ A;  4NQL B;  1UZX B;  1ZGU B;  4EFO A;  1E8Y A;  1V2Y A;  3OAW A;  4LCD E;  4MGZ E;  4FJV B;  4B95 A;  3X0W A;  1WXA A;  2L00 B;  3NZU A;  4II3 B;  3V61 A;  2K8H A;  5TR5 A;  5J17 A;  1P9D U;  2O2V B;  3QX1 A;  2D07 B;  3CMM B;  5DCN A;  4NNJ B;  1TBE A;  4BOZ B;  3ZRC A;  3IBE A;  2C60 A;  4PS8 A;  1SE9 A;  4RM9 A;  2DHZ A;  3VUW A;  1J0G A;  3WAP A;  3QQ8 B;  3EHV A;  4ICV A;  3ML8 A;  2WYQ A;  3CF6 E;  2N9E B;  2MP2 B;  4FLH A;  2OJR A;  2KK8 A;  2LGX A;  3GZN I;  3N32 A;  4ANV A;  3ZVV A;  3NZS A;  2GBK A;  2FCN A;  1UEL A;  3ALB A;  1WY8 A;  1Z2M A;  1WX7 A;  2N4F A;  5C1Z A;  2N7D A;  4HPL B;  2O6V D;  5KHO A;  4E74 A;  2K25 A;  2NPT B; 
#chains in the Genus database with same CATH topology
 4QAY A;  1RM6 C;  3VDZ A;  1BT0 A;  1DOX A;  1MG8 A;  1N61 A;  4CO7 A;  2FUH B;  2MHJ A;  1N5X A;  1C4P A;  1VCB A;  5BYQ A;  1EWC A;  3I3T B;  1J7A A;  4REZ A;  1SE4 A;  4EZJ A;  3A1Q A;  4W9E A;  2IY0 B;  4W9L A;  1PGX A;  4K81 A;  3B2G A;  2JRI B;  1YQ4 B;  1M94 A;  1SE2 A;  2L05 A;  2DAF A;  1YJ1 A;  2FNJ B;  3A9K A;  3PS6 A;  3J9C A;  3N20 C;  4JWU C;  1XCT L;  1AYF A;  1D5M C;  3UIN B;  4WJQ A;  4KGT A;  2LAS A;  4WWN A;  4KSL C;  4XDC A;  3FIL B;  3PLV A;  3ZTD A;  4GLS C;  3UQA A;  2BYE A;  3IVF A;  4IUM B;  1D3Z A;  4A6Q A;  2AWT A;  2KMA A;  3GS2 A;  4OZB A;  4A3O A;  4JGH B;  3QA8 A;  1TY0 A;  2G4D B;  3PRM B;  1I4P A;  2NS5 A;  4DK5 A;  2WXR A;  3SFE B;  3OG5 A;  2J52 A;  3KWV A;  3MC9 A;  4FHJ A;  2L0T A;  1V1O A;  4GIV A;  3MC0 B;  3RD2 A;  5CHF A;  5E6O A;  3R7R A;  2DWQ A;  4NAW B;  4WAF A;  2M0X A;  1KLG D;  3ZNZ B;  3H7P A;  3SU8 X;  4LDT B;  1VDV A;  2KT7 A;  3TMP B;  3EA6 A;  4W9K A;  1E5W A;  1N5W A;  4ZRJ A;  2KWU B;  1WGD A;  2KAJ A;  1D5X C;  4R3D A;  1FNW A;  4NQK E;  4FJZ A;  2IO3 B;  4OW0 A;  2CJN A;  3LB8 C;  2BS3 B;  2LZ6 A;  2PE9 A;  3TL5 A;  1K52 A;  1TKG A;  1TTN A;  1FXT B;  2FAZ A;  1TKE A;  3TEW A;  1D5Z C;  2IJ0 A;  3IFW B;  4IWO A;  3UIO B;  1SIF A;  1UWM A;  2KDF B;  1D4B A;  3RNG C;  1FCL A;  3VR8 B;  2MEK A;  1SF0 A;  4L2Y A;  2OOB B;  5H92 C;  1A70 A;  3GE8 C;  1SE3 A;  2KKC A;  2V9H A;  2WXK A;  3LDZ E;  2WXM A;  4ANX A;  4LNN A;  3VTU A;  2D10 A;  1TS3 A;  2CKH B;  4IM0 A;  1HEZ E;  3KH0 A;  1YMH E;  5EE9 A;  4W9G A;  3P42 A;  2KWC A;  3V6E B;  4MT5 A;  2LJ5 A;  2LHD A;  1P7F A;  4DHZ E;  2JZ3 B;  2MLB A;  3ZXR A;  1GB4 A;  4Q2J A;  1LM8 B;  2C7N B;  1WXM A;  3H9D A;  4LDT D;  4RGO S;  4A55 A;  3UI3 A;  5HFY A;  5LNK 1;  3GZN B;  1R7S A;  1R4M I;  2FCS A;  1NBF C;  4P1C C;  1SJE D;  5AZH A;  1KTK A;  2KQS A;  5D3D A;  2WP9 B;  3K9O B;  2GBR A;  4JQW C;  1UF0 A;  4A3P A;  3APD A;  2BWE S;  3DBR B;  2MQJ A;  3Q3F A;  3JSV A;  1MHX A;  1NI3 A;  2GMI C;  1YOV B;  2W3S A;  2PKO A;  2BBC A;  2W9N A;  2MA9 B;  2LGY A;  2MBO A;  4ARC A;  1YIW A;  2C7H A;  5JZE B;  1T0Q C;  3Q3J A;  2IO2 B;  3DOW A;  4HJG E;  1F9J A;  1Q0W B;  1XLP A;  3RCZ A;  4FUL A;  2KWD A;  3WAL A;  2KFK B;  5D2M B;  1RAX A;  2HE7 A;  5D3I B;  4S0R A;  1L0X B;  3L0W B;  3E56 A;  3M63 B;  1L5P A;  2WGS A;  2RMM A;  1PYW D;  4WUR A;  2WXJ A;  2W55 A;  5AUK A;  4RH6 A;  1BXT A;  2L0F A;  1KOT A;  2L1A A;  3GE3 C;  4DDI D;  1D6E C;  2GBM A;  3HIZ A;  3DVN V;  2M1M A;  3V60 A;  4GN1 A;  1ZE3 D;  1WGR A;  5IAA C;  1I35 A;  1TKY A;  1N62 A;  1RFA A;  5BMG A;  2RPQ A;  4AP4 C;  1JCK B;  1CMX B;  2BWF A;  4EZL A;  3ZRF A;  3V05 A;  3ZO5 B;  3GB1 A;  1Q5W B;  5D7G A;  3HM6 X;  3IT4 B;  2MJE A;  1I4Q A;  2GOW A;  3P4P B;  2WXG A;  3N30 A;  2ZNV C;  4MJS B;  2QCZ A;  1JWB D;  2KVR A;  3HUI A;  2RDG A;  3D32 A;  3AE8 B;  1LXD A;  3SDL C;  2KHW B;  4W9H A;  2JUO A;  4HWI B;  1PGA A;  1TJE A;  4K1R B;  4RMA A;  3A9J A;  3KVF B;  1WR1 A;  1WE7 A;  1WYG A;  1Y8R C;  2PLP A;  1E7U A;  4B0M A;  3ZNH B;  2CS4 A;  4CYE A;  4EOY A;  2D3A A;  3QWZ B;  4LNF A;  3PVL A;  4RM8 A;  3AMZ A;  2C5L C;  4C00 A;  1SIJ A;  2KN5 A;  2BQQ A;  4ICU A;  1WM3 A;  4EZK A;  2KOX A;  1OFF A;  1ZDX A;  5EE0 A;  4W9F A;  4NJC A;  2FCQ A;  3SR6 A;  4ASW C;  4WAA A;  3N1Z C;  1VJK A;  1GOZ A;  3WAN A;  2BTE A;  1HE8 A;  1E0Z A;  4BBN C;  2D11 A;  3A1Q B;  5E6J A;  3T8M A;  1UGJ A;  1J8C A;  4PYZ A;  2R2O A;  3DQV A;  3AU4 A;  4F1S A;  1IBX B;  2LXC A;  2WLB A;  3KYC D;  1WMH B;  2RPV A;  1Y56 A;  1B9R A;  2N0S B;  3AE1 B;  2J0J A;  1YN4 A;  1SEB D;  1ACC A;  1LO5 D;  5BYR A;  3MFG A;  5CTR C;  1T5X D;  2NPT A;  2C7M B;  1L2N A;  4LJO B;  4ACF A;  1WH3 A;  4MSQ B;  3QIJ A;  4GSW A;  4MGK E;  2CU3 A;  2M4N A;  4BKS A;  2WWZ A;  1ZGU B;  1QKZ A;  1V2Y A;  3OAW A;  4FJV B;  3X0W A;  4RCO A;  5TR5 A;  5HI1 A;  3CMM B;  1VRA B;  3P63 A;  2C60 A;  4PS8 A;  1SE9 A;  3VUW A;  2YEP B;  2WU2 B;  5TSS A;  3DHI C;  3EHV A;  3GZN I;  3NRZ A;  2ZW1 A;  3U52 E;  2N4F A;  4YTP B;  3TEY A;  4CQN A;  5KHO A;  2K25 A;  3DBL B;  4HEA 1;  2KTR B;  3QCA A;  3DBR I;  1FFU A;  4A90 A;  1E90 A;  1GC6 A;  3MTN B;  4J3O D;  3K9P B;  3PLU A;  3EGR A;  1WGH A;  3I63 C;  1YN3 A;  1QIL A;  2Z0E B;  4NJ6 A;  2M0A A;  3MC8 A;  1KLV A;  1FO4 A;  2A5U A;  1E8W A;  1L4Z B;  2Y3A A;  1OQQ A;  5FR3 A;  2ZPY A;  4TQ0 A;  3B08 A;  3O13 A;  3OJ4 B;  4MGY E;  4WQO B;  1IGC A;  1AW7 A;  4M0W B;  2ZCB A;  3FKY A;  3U7Z A;  3U8Z A;  4P1B C;  1J7B A;  4H2A A;  2N7E A;  2BYT A;  4E3C A;  3ONS A;  3UF8 A;  3RNA C;  2WXN A;  3AEA B;  1EF5 A;  3KYD D;  3E9S A;  3HRD D;  1C9F A;  3V62 A;  4FBJ B;  3BIN A;  1CZP A;  4IC7 B;  4AS1 A;  3VQI A;  2LEK A;  3PSE B;  2X38 A;  4HVB A;  3X23 A;  3N1X C;  1U4A A;  2LGD A;  2LUM A;  3NJT A;  4B0E A;  3BVZ A;  4G50 A;  2KMM A;  5G2N A;  2KXJ A;  5KHQ A;  3QAR A;  2RGF A;  4YSZ B;  2DBY A;  2M17 A;  1UUP A;  2IY1 B;  2NMQ A;  2WXL A;  4ZOH C;  4N6E B;  3AE2 B;  4PS7 A;  3Q3O C;  3U4E G;  2BS2 B;  3DBH B;  4NJ7 A;  3H7S A;  1KH0 A;  2WU5 B;  2QHO A;  1M4V A;  2KDM A;  4KIK A;  2RDH A;  3PHX B;  1V8C A;  2G4S A;  3U30 A;  2KZR A;  2BF8 B;  4GDK A;  4DDG D;  4AQ7 A;  3JVZ X;  4RGT A;  3IHP C;  3R7Q A;  2IBI B;  2E6X A;  1E8Z A;  2IND C;  4TQ1 A;  1WZ0 A;  1P1A A;  2ASQ A;  4AOF A;  1P0R A;  3MHS D;  2HJ1 A;  4K3C A;  2OHF A;  1B1Z A;  3KLS X;  3ZKJ C;  2JQR B;  4LLG M;  2KWV B;  3BWU D;  3HM3 A;  1IPG A;  1HQR D;  2ZPN A;  5EDS A;  3IAM 1;  3NHE B;  1C77 A;  1SSN A;  2DAJ A;  1F2R C;  4XWT A;  3N1Y C;  4LNK A;  1WX9 A;  3VTW A;  1TT5 B;  2WS3 B;  2KDI A;  4DHZ B;  3AI5 A;  2LJI A;  1F2R I;  2BKR B;  1FFV A;  1HZ6 A;  3BII D;  2YEP F;  1V1P B;  4C4V A;  5AUI A;  1EM7 A;  4ZRK A;  1ZW7 A;  3A33 B;  5GMV A;  2V3S A;  1STE A;  1MG4 A;  2KJH B;  3RNF C;  2GBN A;  2PE6 B;  5LLI A;  2MBQ A;  2SEB D;  3AE3 B;  3W1Y A;  4N59 A;  4DBG A;  1FNV A;  2VZK B;  4C7Y A;  3NZ3 A;  1WWT A;  1J7C A;  1YJJ A;  4XWW A;  3C19 A;  3KUC B;  5C23 A;  5I4D A;  1H4R A;  5D94 A;  2I2Y A;  4GDL B;  4WJO A;  3RT3 B;  3AEC B;  4EUT A;  2L32 A;  4M02 A;  2MCN B;  4D2K A;  4DXG A;  3ENE A;  3PHW B;  1E9M A;  2WXH A;  4WWM A;  5DPR A;  2GRI A;  4PS3 A;  3Q8C A;  2LMC A;  1RYJ A;  3DBL I;  1Q10 A;  4EKU A;  1DYQ A;  4HJK A;  3TEX A;  2R61 A;  3A4S C;  1E7P B;  2V3N A;  3AV8 A;  3JW0 X;  3ZNG C;  1LQB A;  1AN8 A;  2ZZP B;  2MBH A;  1T0Y A;  3RN9 C;  3QHT A;  2WX0 A;  3RPF C;  2XK5 A;  4BFR A;  4JPS A;  1XO3 A;  4MM3 A;  2QC8 A;  2V1Y A;  4IG7 B;  3AXC A;  5G5H A;  3AU5 A;  5IO9 A;  2L52 A;  4HPM B;  3L54 A;  2JZP A;  1HTQ A;  1HA5 A;  2EMS A;  2LVO A;  1RWS A;  3DVG X;  3PZD A;  2EMT A;  1ZP0 B;  1T3Q A;  1L7Y A;  3L4P A;  5BO4 B;  3R3M A;  1FIQ A;  2MSE D;  1Q1O A;  4W9I A;  3PRE A;  3AEG B;  5BMI A;  2Z0D B;  3ML9 A;  2KJ6 A;  4HKZ E;  2N1V A;  2B3A A;  2K8B A;  1JWA D;  3AEF B;  1WM2 A;  4WJP A;  5MPO A;  4YSY B;  2WX1 A;  4DHJ B;  2IGG A;  2O6V A;  4YL8 A;  1I42 A;  2KNB A;  1WJ6 A;  4WQM A;  2ZCC A;  2M19 A;  3PGE A;  4AWJ A;  2DYO A;  1EWY C;  5T8I A;  2HTM E;  1KJT A;  4IM2 A;  4L23 A;  5J18 A;  4GB9 A;  4MSM B;  1KFY B;  3DBH I;  2JYT A;  4G3X B;  2JPH A;  3P4S B;  3PRZ A;  3BYT B;  3H1U A;  1G6J A;  4K7S A;  1SJH D;  4OVV A;  1GC7 A;  1JRO A;  1P98 A;  1GPX A;  4M8M A;  3APC A;  3W5V B;  4B9K A;  5E6P A;  3T9L A;  2KAN A;  3CWI A;  1ZDV A;  2WDV B;  3NOB A;  5DPT A;  1KLU D;  4K7U A;  4W9C A;  1CK1 A;  2Y5B B;  4GMV A;  2KDE B;  3FC4 A;  3AEE B;  1WRD B;  1UH6 A;  4XC2 A;  4GXB A;  1GAQ B;  2WXP A;  1AWD A;  3HHM A;  1ZUD 2;  4DHJ D;  2CHX A;  5BMH A;  1MI0 A;  4ZYN A;  1C76 A;  4II2 B;  4YT0 B;  2K0P A;  1AAR A;  3R66 C;  2N9L A;  2Z8L A;  3CSF A;  2KC1 A;  2WNM A;  3TSS A;  3IXS A;  4HK2 A;  4NQL B;  4EFO A;  1E8Y A;  2GI9 A;  4B95 A;  3BYY B;  3V61 A;  2K8H A;  2JWU A;  5J17 A;  1P9D U;  2O2V B;  2D07 B;  4KKI A;  3NG0 A;  4NNJ B;  1TBE A;  4BOZ B;  2J53 A;  3ZRC A;  1C78 A;  3IBE A;  1NYR A;  2DHZ A;  1N63 A;  3BVG A;  5HHD G;  3ML8 A;  3ZVV A;  3N9Y C;  3N32 A;  2INC C;  2H88 B;  2GBK A;  4XGA B;  3ALB A;  1WY8 A;  1Z2M A;  5C1Z A;  4HPL B;  4S17 A;  2REX A;  2A4Z A;  4KVG B;  3EFU A;  2G45 B;  1WJ4 A;  1WI0 A;  1EU3 A;  3R2T A;  2DZJ A;  2LRW A;  1N60 A;  1R4N B;  3FIL A;  4P6V F;  1GJZ A;  3PTF C;  2PMV A;  4O1N A;  4J6I A;  1JML A;  2MJ3 A;  2V4I B;  4A9A A;  4JL9 A;  2L7R A;  2N1W A;  4ZHP A;  2KTF A;  2LHE A;  4ZRI A;  3SEB A;  1VLB A;  3Q3N C;  1EF1 A;  1XEE A;  3BY4 B;  1DOY A;  1ZKH A;  3VUX A;  4KX6 B;  1FXA A;  2W82 A;  1E7V A;  1FXI A;  2N9X A;  3RMK C;  4IKG A;  1WGG A;  4NAW A;  1EUV B;  2IDY A;  2GB1 A;  1UWX A;  2WHI A;  1OEY J;  2QIE B;  4LNO A;  2MBE A;  1YNT E;  1P3Q U;  1VZ7 A;  3DPD A;  3IAS 1;  3A4R A;  1S3S G;  1VZ6 A;  2QMT A;  4KDL B;  4IOI E;  3BK1 A;  4A20 A;  1VD2 A;  2GLS A;  3A9K B;  1FD6 A;  3RNE C;  2MP2 A;  5AZG A;  2LGS A;  1I4H A;  2IGH A;  1CQV A;  4IDI A;  3O65 B;  1SBB B;  4UDU C;  3WIM A;  1C3T A;  4P16 A;  4JLC A;  4XX5 A;  3Q3M C;  2ZVN A;  2HTH A;  4MH0 E;  1Z5S B;  1FMA D;  3RI7 C;  2LVP A;  2VH1 A;  1F52 A;  1YN5 A;  3P4Q B;  3LXF A;  5IA7 A;  1OQR A;  4OHJ A;  1YX6 B;  1OTR B;  2WQY B;  2NTS A;  4JIO U;  3AM9 A;  4URK A;  2IZV B;  2JWZ A;  4BVU C;  2YVC A;  1ET9 A;  3TEZ A;  2L83 A;  2MX2 A;  3VH4 B;  4USA A;  1KF6 B;  1ZOY B;  1JRP A;  3ETR A;  4HXD A;  4HDQ A;  2AQ1 B;  2FBW B;  1TS5 A;  2X8X X;  1BML C;  3PRP B;  4PK1 A;  3KUZ A;  2ZJD A;  2ACZ B;  2ICI A;  3GP7 A;  1T0R C;  3M95 A;  3RUI B;  1P7E A;  2XEW A;  2LUE A;  2K1F A;  4DXA B;  1K8R B;  2AQ3 B;  3H7P B;  1QOA A;  3V3X A;  4FN2 A;  1CJE A;  2XN9 C;  1OGW A;  1VZ8 A;  2MH7 A;  3VTV A;  5C2T B;  2V3P A;  3VVW B;  3VH3 B;  3P1M A;  2AYO B;  3Q2A C;  3AE9 B;  2LD9 A;  1WF9 A;  4WWP A;  2KQ7 A;  2FUG 1;  4FXC A;  3W9C B;  2NR2 A;  2UU7 A;  3S2A A;  3L13 A;  2G3Q B;  3H8H A;  4MDK E;  4M00 A;  2FCM A;  3MP9 A;  4RF0 A;  4FHK A;  2W54 A;  2KFK A;  2M56 B;  1ZPS A;  4KGR A;  3OLM D;  1KM7 A;  4C80 A;  1V9J A;  2G1E A;  3PZ8 A;  2PVO D;  1UGM A;  4HCP B;  4AJY B;  1V49 A;  2Q5W D;  1E10 A;  5GXG B;  3RNB C;  3QAQ A;  1C4C A;  2BB5 A;  2NVU I;  2J0K A;  4DQO C;  1A5R A;  2JYE A;  2K6Q A;  4I6N B;  4IM3 A;  5JHA A;  1WRI A;  4IWQ A;  4F7Z A;  1QZE A;  3PV1 A;  2W3R A;  3DHG C;  2N9K A;  3DVN U;  1WFY A;  3HK0 A;  1UBQ A;  2KVZ A;  1V80 A;  1R4N I;  3PZ7 A;  4OVZ A;  3ZIM A;  2WXO A;  1QT9 A;  4LK0 M;  4JX1 C;  4KV2 A;  5AEK B;  3JSV B;  1JW9 D;  1I4X A;  4MJS A;  3WCQ A;  1YQ3 B;  5E6N A;  2M8S A;  2GBJ A;  3T3N A;  1WSP A;  3AE4 B;  1NI2 A;  2RSU A;  5FKA C;  1F77 A;  1ZXI A;  4TMA B;  2DZK A;  1V5O A;  4ZYS A;  1H8C A;  2K3U A;  1ROE A;  4KSK C;  3BK2 A;  2VRR B;  2Y5P A;  5C3J B;  1L6U A;  2KX3 A;  1V6E A;  3Q8F A;  1EO6 A;  3BVM A;  1WXV A;  1OEY A;  3TBL D;  2Z59 B;  3NVW A;  1KRH A;  1WGK A;  4AJW A;  2PEA A;  1WX8 A;  3EUB 2;  3NY5 A;  1I7H A;  3ZUN A;  1NEN B;  3B1L X;  3L17 A;  1V86 A;  3EC8 A;  4BZA A;  3I9V 1;  4N9F 4;  4BKG A;  3URY A;  1TGZ B;  3C8Y A;  2UYZ B;  2OED A;  1QOG A;  2QIL A;  2DNF A;  3NUH B;  3AED B;  2ZVO A;  3ZTC A;  2J7Q B;  2CJO A;  3UGB B;  1TZO A;  2FID A;  1IBX A;  3QK0 A;  1WMH A;  2ONQ A;  2JRH A;  3I5J C;  4NY0 A;  5EE3 A;  1GUA B;  4P7I A;  4ZDV A;  1L0Y B;  1FPY A;  1RRB A;  4YWG G;  3TIX A;  1MPE A;  2L8J A;  3ZQ4 A;  2G9H D;  1XF5 L;  3W5U B;  4MH8 A;  3ZNI D;  4LJP B;  2XNA C;  2KDB A;  4HCN B;  1PGB A;  1N6Z A;  1JWU D;  1TIF A;  1WYW B;  1X1M A;  1I4G A;  2INP E;  2KX0 A;  2J42 A;  1WJN A;  1JAL A;  3UIP B;  2V0G A;  4G11 A;  3A9J B;  5FR6 A;  2MWS B;  3AN1 A;  3EFC A;  3UQB A;  4GU2 A;  2MBB B;  2I1K A;  2BB6 A;  1XQQ A;  2WXI A;  4ITK A;  3Q8A A;  4TSS A;  1VR9 A;  2V4L A;  1WJU A;  2J0M A;  2ZNV B;  1NEK B;  1FRD A;  2RDB C;  2J4X A;  4KZ0 A;  1ET6 A;  2HDE A;  4US8 A;  2H89 B;  4AUQ C;  4E71 A;  3IT6 B;  3APF A;  1HZ5 A;  1V81 A;  2BGF A;  1J19 A;  4LNI A;  2KTR A;  4YXD B;  4NZL B;  4G0N B;  3MJW A;  1UZX B;  4WH4 A;  4MGZ E;  3AH7 A;  2QEJ C;  2L00 B;  1QOF A;  5EE1 A;  1FRR A;  5IOI A;  1J0G A;  3ZJT A;  3Q6B A;  3VRB B;  4C56 C;  2VZK D;  3QQ8 B;  4ICV A;  3VR9 B;  3CF6 E;  2MP2 B;  2OJR A;  1LGR A;  2LGX A;  4JE3 B;  3AE7 B;  4M0W A;  2KN4 A;  2N7D A;  2LGI A;  4E74 A;  1DGJ A;  2NPT B;  2CHW A;  2JT4 B;  3WA0 A;  2AL6 A;  2EKE C;  3L08 A;  1YJI A;  3HVD A;  3KW5 B;  3RZF A;  1RLF A;  5AZF A;  4FAD A;  4IW0 A;  3ZW3 A;  2DZI A;  3CST A;  3NS1 A;  2C9W B;  3V6C B;  3W1S C;  4GOC A;  2K8C A;  4WIP A;  5G5G A;  3SD5 A;  5FK9 C;  3WAM A;  3ECI A;  2D5G A;  2KJR A;  1F1H A;  4BKT A;  2BW2 A;  3VHT C;  3PPA A;  2CHZ A;  4N58 A;  2BYF A;  1WZ3 A;  2CU1 A;  4I6P A;  2PJH A;  2JX5 A;  4MEL A;  3JYU A;  1K53 A;  2JVC A;  1WXS A;  3AE5 B;  1GNU A;  1GG3 A;  3W1S A;  2WDR B;  3T3O A;  2IYD B;  3W2D A;  2IO1 B;  3Q14 C;  4ARI A;  1QF6 A;  1XLN A;  3L16 A;  4K3B A;  5DPW A;  1PUT A;  2D3G A;  4W9D A;  1TY2 A;  4KZC A;  3Q8B A;  1SXT A;  4FJY A;  4MAC A;  4B6W A;  3IG3 A;  3OWE B;  4M8N A;  3B2F A;  3QJZ A;  2BPS A;  2QSD A;  2IPK D;  1JRU A;  3PT2 B;  3TCA A;  4XYC A;  4PYU A;  4BKS D;  1L6V A;  2L76 A;  3RFZ B;  2ON8 A;  3SHQ A;  4K7W A;  2NBW B;  3MHZ A;  1E6E B;  3I57 A;  2FIF A;  3AUL A;  4A8X C;  1V5T A;  2LVQ A;  1ENF A;  3DBS A;  3KQ4 A;  4YTN B;  1MHH E;  4NAM A;  5L83 A;  2AQ2 B;  3VRA B;  1SB3 C;  2PIA A;  2ZEQ A;  2DYM A;  1IYF A;  2MW5 A;  3RUL A;  3C0R B;  2I38 A;  2DX5 B;  4HLE A;  3B0A A;  3PO0 A;  1QLB B;  1C79 A;  3AE6 B;  1JWS D;  3P2B A;  4EEW A;  2BYV E;  1GB1 A;  4X57 B;  2NBU A;  4ANW A;  4HDO A;  5JXV A;  3ZDT A;  1FCC C;  1TYG B;  4MGI E;  4NPN A;  1EU4 A;  3NVV A;  1V1P A;  5G55 A;  3RNC C;  1NDD A;  3BZD B;  2JXX A;  5H8Y E;  5CHV C;  2EKI A;  2KO3 A;  2BKF A;  3VAW A;  4CHK A;  3U7D A;  2IGD A;  4FA6 A;  3RYT A;  4KIK B;  5HG2 A;  3SFD B;  4GDK B;  3RZW C;  2DEN B;  3DDC B;  2JY6 A;  2KFJ A;  2NBV B;  4W9J A;  1S1Q B;  2ZW0 A;  2LRU A;  3OJ3 A;  2VH2 A;  4WWO A;  2AX5 A;  1MJD A;  2R2Q A;  2LWP A;  1XLQ A;  5HKH A;  1WIA A;  2KYW A;  4RF1 A;  2JZZ A;  4GGQ A;  1K50 A;  4GDL A;  2K39 A;  2LI5 A;  2PW9 A;  1C4A A;  2PPH A;  4OZA A;  3N3K B;  4BBN F;  2NTT A;  4TKN A;  5LXH A;  3QC8 B;  3TUO A;  2DZM A;  4M01 A;  2KLG A;  3GOE A;  4IWP A;  4RNA A;  2QJL A;  4KKJ A;  3ZXV A;  2DYB A;  3M62 B;  4ZRP A;  1IGD A;  4C4V B;  1IUE A;  1YD8 U;  1FEH A;  1IP9 A;  2XBB C;  2AEH A;  4BAX A;  4PT5 A;  3CIR B;  1HTO A;  3NVY A;  5LXI B;  4TUU A;  1SGH A;  4OZC A;  3DWG C;  2LXA A;  2D2Q A;  4YTM B;  3M3J A;  2I1J A;  2HD5 B;  1JQ4 A;  4OVU A;  1OQY A;  3B9J A;  2JXT A;  2KC2 A;  1XLO A;  2KD0 A;  3ZJV A;  2TSS A;  4XE0 A;  3Q8E A;  3ZJU A;  1NYQ A;  2OJW A;  2WDQ B;  3L10 B;  1E8X A;  1TS4 A;  2YLM A;  2MJD A;  2UWQ A;  3Q69 A;  3P4R B;  1BUI C;  2BVC A;  4KDI C;  2BT6 A;  1UD7 A;  1DOI A;  1T0S C;  2MRP A;  4RGM A;  2K5P A;  4YSX B;  4HKQ A;  2B76 B;  1PDX A;  2WXQ A;  2FE8 A;  2E3T A;  2KLC A;  3HVZ A;  2WXF A;  2N9P C;  1ESF A;  5CX3 A;  1QOB A;  2EEL A;  1LFD A;  4I6L B;  5IP4 D;  1XCQ L;  2XK5 B;  2D3C A;  4MM3 B;  1TZ1 A;  4KGS A;  1QQR A;  3LJ3 A;  2JF5 A;  3AB5 A;  3EEC A;  1FNU A;  5IKC M;  1RFK A;  3VUY A;  1L0V B;  1XT9 B;  3ZGZ A;  2KMC A;  2BS4 B;  2K9X A;  3NS8 A;  3R2I A;  4DWF A;  2RD0 A;  5JH5 C;  1TS2 A;  2INN E;  1WXQ A;  5L95 C;  3H6N A;  4C7Z A;  4TV3 A;  4ANU A;  4RFB A;  3R8B A;  2KAC A;  2SAK A;  2K6D B;  4DXF A;  1UBI A;  2NCN A;  4LTU A;  3TJP A;  5IN7 A;  4ZRQ A;  4XZ4 A;  1FM0 D;  1PQS A;  2IO0 B;  1K51 A;  4WJN A;  3VFK A;  1V97 A;  3DWM A;  4MEM A;  2AL3 A;  3DHH C;  2RR9 A;  4RGN A;  1UNS A;  2JSV X;  1YQB A;  3ZLZ A;  1JWM D;  1XD3 B;  2HJ8 A;  2O6V B;  1I4R A;  3DVG Y;  1WGY A;  1ISN A;  1HXY D;  3KUD B;  2WDT B;  1T6B X;  2CR5 A;  3ZDM C;  3WAO A;  1F0Z A;  2L3Z A;  1C1Y B;  5JHB A;  2O2V A;  4EE2 A;  5BYS A;  3KWL A;  2PTL A;  1MFW A;  3DCG A;  5DPS A;  4L1B A;  5D6J B;  2DLB A;  1WE6 A;  2LFI A;  5J2R A;  3VXW A;  3ZYY X;  3FAH A;  2N7J A;  1L4D B;  1WR6 E;  4JWS C;  1R4M B;  4BOS C;  2QDF A;  3AEB B;  1NVI D;  1YX5 B;  3MJ5 A;  2PVG C;  3U2S C;  4F8C B;  5CHW A;  2JU6 X;  1MVK A;  4LCD E;  4HRO A;  4HPP A;  1ZXH A;  1WXA A;  3NZU A;  4II3 B;  3QX1 A;  3LYY A;  4XDD A;  3NVZ A;  5DCN A;  2Y5C A;  1PFD A;  2KQ4 X;  4RM9 A;  4US9 A;  4ZHO A;  3ABV B;  3WAP A;  2WYQ A;  2K22 A;  2N9E B;  4FLH A;  4ANV A;  2KK8 A;  3NZS A;  2D3B A;  1UEL A;  2FCN A;  1WX7 A;  1XXG A;  2O6V D;  4HRS A; 
#chains in the Genus database with same CATH homology
 2CHW A;  2JT4 B;  2KTR B;  2A4Z A;  1BT0 A;  2REX A;  3VDZ A;  2AL6 A;  2EKE C;  3EFU A;  3QCA A;  2G45 B;  3L08 A;  1WJ4 A;  4KVG B;  4A3O A;  1MG8 A;  1WI0 A;  3DBR I;  3KW5 B;  4CO7 A;  2FUH B;  3RZF A;  2DZJ A;  1E90 A;  2LRW A;  1GC6 A;  1RLF A;  5AZF A;  4FAD A;  4IW0 A;  1GJZ A;  1VCB A;  3MTN B;  3K9P B;  3PLU A;  3ZW3 A;  2DZI A;  3CST A;  1WGH A;  3I3T B;  3PTF C;  2C9W B;  3V6C B;  3W1S C;  4GOC A;  3A1Q A;  4EZJ A;  2K8C A;  2Z0E B;  4NJ6 A;  2IY0 B;  4W9E A;  4J6I A;  1KLV A;  4W9L A;  2A5U A;  1E8W A;  3SD5 A;  3WAM A;  4K81 A;  2JRI B;  2KJR A;  3ECI A;  4JL9 A;  4BKT A;  2L7R A;  2ZPY A;  4TQ0 A;  3B08 A;  4MGY E;  3OJ4 B;  1M94 A;  2N1W A;  4WQO B;  3VHT C;  2L05 A;  2KTF A;  2DAF A;  3PPA A;  4ZRI A;  2CHZ A;  1YJ1 A;  4M0W B;  2BYF A;  1WZ3 A;  2CU1 A;  4I6P A;  2FNJ B;  2PJH A;  4MEL A;  2ZCB A;  3A9K A;  3JYU A;  1EF1 A;  3PS6 A;  2JVC A;  3BY4 B;  3U8Z A;  1WXS A;  1ZKH A;  3UIN B;  2N7E A;  4WJQ A;  3VUX A;  1GNU A;  4E3C A;  3ONS A;  3UF8 A;  1E7V A;  2N9X A;  2LAS A;  1EF5 A;  4WWN A;  1WGG A;  3KYD D;  4KSL C;  4NAW A;  1GG3 A;  3PLV A;  3ZTD A;  3W1S A;  3V62 A;  4FBJ B;  3BIN A;  4IC7 B;  3UQA A;  2BYE A;  2IYD B;  1EUV B;  3IVF A;  3VQI A;  2IO1 B;  4IUM B;  3L16 A;  3PSE B;  5DPW A;  1D3Z A;  4HVB A;  2AWT A;  3X23 A;  2KMA A;  1U4A A;  1OEY J;  2LGD A;  2D3G A;  2MBE A;  4W9D A;  1P3Q U;  3QA8 A;  3DPD A;  4JGH B;  3A4R A;  1S3S G;  4G50 A;  4KDL B;  4KZC A;  2G4D B;  3PRM B;  4FJY A;  5G2N A;  2NS5 A;  2KXJ A;  4DK5 A;  5KHQ A;  4A20 A;  3QAR A;  2RGF A;  4B6W A;  3IG3 A;  2M17 A;  1VD2 A;  4FHJ A;  2L0T A;  3A9K B;  2IY1 B;  3QJZ A;  4M8N A;  2BPS A;  4GIV A;  2MP2 A;  1JRU A;  3PT2 B;  5AZG A;  4PS7 A;  3TCA A;  3RD2 A;  4PYU A;  3O65 B;  4BKS D;  5CHF A;  3WIM A;  5E6O A;  3R7R A;  2L76 A;  4NAW B;  4NJ7 A;  1C3T A;  3SHQ A;  2M0X A;  3H7S A;  4K7W A;  4JLC A;  4XX5 A;  2QHO A;  2NBW B;  2HTH A;  2ZVN A;  4MH0 E;  3WA0 A;  2FIF A;  3AUL A;  1Z5S B;  1V5T A;  2LVQ A;  3DBS A;  3ZNZ B;  3H7P A;  4KIK A;  3SU8 X;  4LDT B;  3PHX B;  2LVP A;  3TMP B;  4W9K A;  1E5W A;  2G4S A;  5IA7 A;  5L83 A;  3U30 A;  2KZR A;  2BF8 B;  4GDK A;  1YX6 B;  4ZRJ A;  4DDG D;  1OTR B;  2KWU B;  3JVZ X;  2ZEQ A;  1WGD A;  2DYM A;  1IYF A;  3IHP C;  4JIO U;  3R7Q A;  2IBI B;  2MW5 A;  3RUL A;  3C0R B;  4NQK E;  4URK A;  2IZV B;  2JWZ A;  2DX5 B;  4FJZ A;  2YVC A;  2IO3 B;  4BVU C;  4HLE A;  1E8Z A;  4TQ1 A;  1WZ0 A;  3B0A A;  1P1A A;  2ASQ A;  2LZ6 A;  2MX2 A;  4AOF A;  3P2B A;  4EEW A;  2BYV E;  3VH4 B;  4X57 B;  2NBU A;  4ANW A;  4HDO A;  2PE9 A;  3ZDT A;  3TL5 A;  1P0R A;  1TTN A;  3MHS D;  4HXD A;  4MGI E;  1FXT B;  2FAZ A;  4HDQ A;  4NPN A;  5G55 A;  1NDD A;  3ZKJ C;  3PRP B;  2KWV B;  2JXX A;  3IFW B;  4IWO A;  3UIO B;  5CHV C;  1SIF A;  2ZJD A;  3HM3 A;  3KUZ A;  2KO3 A;  2BKF A;  2KDF B;  3M95 A;  3RUI B;  2XEW A;  2LUE A;  3VAW A;  1IPG A;  2K1F A;  1K8R B;  3U7D A;  4CHK A;  4DXA B;  2ZPN A;  5EDS A;  4FA6 A;  3H7P B;  2OOB B;  3RYT A;  3NHE B;  4KIK B;  4FN2 A;  1OGW A;  2KKC A;  3LDZ E;  2DAJ A;  3VTV A;  4ANX A;  4GDK B;  3RZW C;  2DEN B;  3DDC B;  2JY6 A;  2KFJ A;  2NBV B;  3VTU A;  4W9J A;  1S1Q B;  1WX9 A;  2D10 A;  3VH3 B;  3VVW B;  2AYO B;  2CKH B;  2LRU A;  3OJ3 A;  4IM0 A;  3VTW A;  4WWO A;  3KH0 A;  2LD9 A;  1WF9 A;  2KDI A;  2KQ7 A;  4WWP A;  2R2Q A;  4DHZ B;  3AI5 A;  4W9G A;  2LWP A;  5HKH A;  1WIA A;  2BKR B;  2JZZ A;  2KWC A;  3V6E B;  4GGQ A;  2NR2 A;  4GDL A;  2LJ5 A;  3S2A A;  3L13 A;  2G3Q B;  4MDK E;  4DHZ E;  2JZ3 B;  2MLB A;  4ZRK A;  2K39 A;  2LI5 A;  1ZW7 A;  1LM8 B;  2C7N B;  1WXM A;  2PPH A;  3H9D A;  4LDT D;  3A33 B;  2FCM A;  4FHK A;  5GMV A;  2KFK A;  3N3K B;  4BBN F;  4TKN A;  5LXH A;  1R4M I;  2V3S A;  3QC8 B;  2FCS A;  3OLM D;  2KJH B;  2GBN A;  1NBF C;  2DZM A;  1KM7 A;  2PE6 B;  5LLI A;  2MBQ A;  2KLG A;  5AZH A;  2KQS A;  1V9J A;  3GOE A;  3K9O B;  2GBR A;  4IWP A;  4JQW C;  3W1Y A;  4A3P A;  4DBG A;  3APD A;  2BWE S;  1UGM A;  4HCP B;  2MQJ A;  4AJY B;  1V49 A;  3Q3F A;  3KUC B;  3JSV A;  2GMI C;  5C23 A;  2DYB A;  3QAQ A;  3M62 B;  1H4R A;  5D94 A;  4GDL B;  2W9N A;  2MA9 B;  4WJO A;  3RT3 B;  2LGY A;  4EUT A;  1YD8 U;  2MBO A;  1IP9 A;  2MCN B;  3ENE A;  1YIW A;  2NVU I;  2C7H A;  2J0K A;  2XBB C;  3PHW B;  2AEH A;  3Q3J A;  5JZE B;  2IO2 B;  3DOW A;  5LXI B;  1A5R A;  4TUU A;  5DPR A;  1F9J A;  1Q0W B;  4PS3 A;  3RCZ A;  2K6Q A;  1SGH A;  4FUL A;  3WAL A;  4I6N B;  2KFK B;  5D2M B;  4IM3 A;  5JHA A;  3DBL I;  1RAX A;  4IWQ A;  4F7Z A;  1QZE A;  2HE7 A;  3PV1 A;  2LXA A;  2D2Q A;  4EKU A;  4HJK A;  3A4S C;  3L0W B;  2I1J A;  2HD5 B;  3M3J A;  3DVN U;  1WFY A;  1OQY A;  3HK0 A;  3M63 B;  1UBQ A;  3JW0 X;  4OVU A;  1V80 A;  1R4N I;  2KC2 A;  3ZNG C;  1LQB A;  3ZIM A;  2ZZP B;  2MBH A;  1T0Y A;  2KD0 A;  4KV2 A;  3QHT A;  2WX0 A;  3JSV B;  4MJS A;  5AEK B;  2L0F A;  2XK5 A;  4BFR A;  4MM3 A;  1KOT A;  3L10 B;  4IG7 B;  2V1Y A;  4DDI D;  1E8X A;  3AXC A;  5E6N A;  2GBM A;  2YLM A;  2M8S A;  2UWQ A;  2GBJ A;  3AU5 A;  3HIZ A;  3DVN V;  4HPM B;  2M1M A;  3L54 A;  3V60 A;  1NI2 A;  2RSU A;  4GN1 A;  1WGR A;  2DZK A;  4KDI C;  5IAA C;  1I35 A;  1V5O A;  2EMS A;  2LVO A;  3DVG X;  1UD7 A;  1RFA A;  3PZD A;  1H8C A;  2RPQ A;  4AP4 C;  4KSK C;  2EMT A;  1CMX B;  1L7Y A;  2MRP A;  2BWF A;  4EZL A;  2VRR B;  3ZRF A;  5BO4 B;  3R3M A;  2KX3 A;  1V6E A;  2MSE D;  1EO6 A;  3ZO5 B;  1WXV A;  1Q1O A;  1Q5W B;  1OEY A;  3PRE A;  4W9I A;  3TBL D;  5D7G A;  2Z59 B;  2KLC A;  3HM6 X;  2N9P C;  2Z0D B;  2GOW A;  3ML9 A;  4AJW A;  3N30 A;  2KJ6 A;  2PEA A;  1WX8 A;  2ZNV C;  4MJS B;  1LFD A;  5CX3 A;  4I6L B;  2XK5 B;  3NY5 A;  1TZ1 A;  3ZUN A;  2N1V A;  3B1L X;  2B3A A;  2KVR A;  2K8B A;  3L17 A;  1WM2 A;  1V86 A;  3EC8 A;  3LJ3 A;  4WJP A;  2JF5 A;  2WX1 A;  3EEC A;  4DHJ B;  4N9F 4;  3D32 A;  2O6V A;  4YL8 A;  3VUY A;  1XT9 B;  4BKG A;  1I42 A;  1LXD A;  1TGZ B;  1WJ6 A;  2KHW B;  2JUO A;  2KNB A;  4HWI B;  2UYZ B;  4W9H A;  3SDL C;  2KMC A;  2ZCC A;  3NS8 A;  4K1R B;  4DWF A;  2RD0 A;  4RMA A;  3A9J A;  3KVF B;  1WR1 A;  3PGE A;  5JH5 C;  4AWJ A;  2DYO A;  1WE7 A;  2ZVO A;  3ZTC A;  5L95 C;  2J7Q B;  3H6N A;  3UGB B;  2FID A;  1KJT A;  4IM2 A;  1Y8R C;  1E7U A;  3QK0 A;  4TV3 A;  5J18 A;  4ANU A;  4GB9 A;  1WMH A;  3ZNH B;  2CS4 A;  4CYE A;  2JRH A;  4MSM B;  4NY0 A;  3DBH I;  4EOY A;  1GUA B;  2K6D B;  4P7I A;  4ZDV A;  1UBI A;  3QWZ B;  2NCN A;  4G3X B;  3TJP A;  3PVL A;  1RRB A;  2JPH A;  4RM8 A;  3TIX A;  4XZ4 A;  1PQS A;  2C5L C;  2L8J A;  3PRZ A;  2IO0 B;  4WJN A;  3VFK A;  2KN5 A;  3H1U A;  4MEM A;  4ICU A;  1WM3 A;  2AL3 A;  4EZK A;  2KOX A;  3ZNI D;  4LJP B;  1G6J A;  2RR9 A;  4K7S A;  4W9F A;  4OVV A;  1GC7 A;  2KDB A;  2FCQ A;  1YQB A;  3ZLZ A;  1X1M A;  4HCN B;  1WYW B;  1XD3 B;  4ASW C;  2HJ8 A;  2KX0 A;  4WAA A;  2O6V B;  1P98 A;  3DVG Y;  1WGY A;  4M8M A;  1ISN A;  3APC A;  1WJN A;  3WAN A;  3UIP B;  1HE8 A;  4BBN C;  2D11 A;  3KUD B;  4B9K A;  2WDT B;  3A1Q B;  3A9J B;  4G11 A;  5E6P A;  5FR6 A;  2MWS B;  3T9L A;  3T8M A;  3UQB A;  2CR5 A;  3ZDM C;  4PYZ A;  3WAO A;  1J8C A;  2R2O A;  2L3Z A;  1C1Y B;  2KAN A;  3DQV A;  2MBB B;  3AU4 A;  4GU2 A;  4F1S A;  2LXC A;  2I1K A;  3NOB A;  3KYC D;  2O2V A;  1XQQ A;  5JHB A;  5DPT A;  1WMH B;  4K7U A;  4W9C A;  2V4L A;  2Y5B B;  1WJU A;  2J0M A;  2ZNV B;  4GMV A;  3DCG A;  5DPS A;  2KDE B;  5D6J B;  2J0J A;  4KZ0 A;  1WRD B;  1UH6 A;  1WE6 A;  4XC2 A;  4GXB A;  5J2R A;  4AUQ C;  3HHM A;  4E71 A;  3VXW A;  4DHJ D;  2CHX A;  3APF A;  1V81 A;  4ZYN A;  5CTR C;  2BGF A;  1J19 A;  1WR6 E;  2NPT A;  4II2 B;  2C7M B;  2KTR A;  1L2N A;  4LJO B;  4BOS C;  1AAR A;  3R66 C;  1WH3 A;  4MSQ B;  3QIJ A;  1YX5 B;  4G0N B;  4GSW A;  4MGK E;  2M4N A;  3CSF A;  2KC1 A;  3MJW A;  4F8C B;  4HK2 A;  5CHW A;  4BKS A;  2WWZ A;  4NQL B;  1UZX B;  1ZGU B;  4EFO A;  1E8Y A;  1V2Y A;  3OAW A;  4LCD E;  4MGZ E;  4FJV B;  4B95 A;  3X0W A;  1WXA A;  2L00 B;  3NZU A;  4II3 B;  3V61 A;  2K8H A;  5TR5 A;  5J17 A;  1P9D U;  2O2V B;  3QX1 A;  2D07 B;  3CMM B;  5DCN A;  4NNJ B;  1TBE A;  4BOZ B;  3ZRC A;  3IBE A;  2C60 A;  4PS8 A;  1SE9 A;  4RM9 A;  2DHZ A;  3VUW A;  1J0G A;  3WAP A;  3QQ8 B;  3EHV A;  4ICV A;  3ML8 A;  2WYQ A;  3CF6 E;  2N9E B;  2MP2 B;  4FLH A;  2OJR A;  2KK8 A;  2LGX A;  3GZN I;  3N32 A;  4ANV A;  3ZVV A;  3NZS A;  2GBK A;  2FCN A;  1UEL A;  3ALB A;  1WY8 A;  1Z2M A;  1WX7 A;  2N4F A;  5C1Z A;  2N7D A;  4HPL B;  2O6V D;  5KHO A;  4E74 A;  2K25 A;  2NPT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...