2KANA

Solution nmr structure of ubiquitin-like domain of arabidopsis thaliana protein at2g32350. northeast structural genomics consortium target ar3433a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
MGHHHHHHSHAAVRKIHVTVKFPSKQFTVEVDRTETVSSLKDKIHIVENTPIKRMQLYYSGIELADDYRNLNEYGITEFSEIVVFLKSINRAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein ar3433a
publication title Solution NMR structure of ubiquitin-like domain of Arabidopsis thaliana protein At2g32350.
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 21
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2008-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kanA01
3PLUA 2KTRB 4M0WB 1XT9B 4YL8A 3KUDB 4HWIB 3H1UA 4NAWB 4WJPA 4ZYNA 3GZNI 4CHKA 1L2NA 2BKFA 3AI5A 1WX9A 4BKSA 4KZ0A 3IFWB 3BY4B 3ECIA 3VVWB 3PHWB 2ZNVC 2CHZA 3L13A 3EC8A 2QHOA 2KDBA 4W9LA 4EZKA 1WGRA 1E8XA 3DCGA 1VCBA 3R3MA 4DDGD 1UBIA 2L3ZA 2JRHA 3DVGY 3ZVVA 3KW5B 4JQWC 3W1YA 3CMMB 1OGWA 2MBHA 3RYTA 2MWSB 3JVZX 4ANVA 1UH6A 4EZJA 1IYFA 4G3XB 2KX3A 1V2YA 2LUEA 4MSMB 2DZJA 3KH0A 4F7ZA 2N7DA 2BYFA 2LRUA 2XEWA 2KFJA 2GBKA 1J19A 3H7PA 3IVFA 2R2QA 1SE9A 2L0FA 2MRPA 3PRZA 3W1SA 3WANA 4DBGA 1G6JA 3DBHI 4IW0A 2FCMA 3ZDMC 4PYZA 4G0NB 3RD2A 3CSTA 2LXCA 5CHFA 3LDZE 4A3PA 1V80A 2IBIB 2MX2A 1WY8A 2LJ5A 3ZDTA 1LM8B 2FIFA 3JSVA 1WMHB 2MCNB 2N4FA 4B6WA 1WGYA 5DPSA 3MHSD 1NDDA 1RAXA 2LWPA 2ZCCA 3CF6E 4GOCA 2YVCA 4NNJB 2L7RA 4P7IA 4EFOA 2NCNA 2D11A 2MBBB 4OVVA 4DK5A 5CX3A 1V81A 4HXDA 1H8CA 1XD3B 1P9DU 2CR5A 2K1FA 3DBLI 3O65B 3DVNV 1X1MA 3VUXA 1WH3A 1WJUA 2AL6A 4KIKB 3V60A 4DHZE 3UQBA 3QC8B 2KNBA 3ZUNA 3HM3A 3L54A 2KKCA 4E71A 3UIPB 1Z2MA 5G55A 1UZXB 3KUCB 3APFA 2HD5B 1OEYA 2GBJA 5L83A 4BOZB 3TCAA 5CHWA 3ZIMA 2VRRB 3HIZA 4AOFA 3L0WB 4DHJB 3QHTA 2MBOA 4LJOB 3HK0A 4MDKE 1E8ZA 2NS5A 3DBSA 3Q3FA 4M8NA 3A9JA 1TTNA 3CSFA 2KTRA 1RFAA 2D10A 4NAWA 3P2BA 1BT0A 2OOBB 4FULA 3RZFA 3GOEA 1GNUA 3UGBB 3VDZA 2ZJDA 4W9CA 3ZO5B 3L17A 3APDA 2EMSA 3T9LA 1K8RB 3NHEB 3UF8A 3MTNB 5AZHA 3ML8A 1C1YB 1E8YA 2A4ZA 3PS6A 1E5WA 3U8ZA 2WX1A 3PVLA 2K39A 3ALBA 1P3QU 5JH5C 1AARA 4I6NB 1Q0WB 2PE9A 3VTUA 3R7QA 2KN5A 2JWZA 4F8CB 1ISNA 4GMVA 1YIWA 2FCQA 1V5TA 2N1VA 2KDFB 3UQAA 4ASWC 3OJ3A 3T8MA 5DPRA 2HTHA 2DZKA 2XBBC 2C7MB 2LGYA 2BWES 4BFRA 4URKA 2NR2A 2IO2B 2V3SA 1HE8A 2KWVB 2GBNA 3AULA 5D2MB 2KQSA 4XC2A 5C23A 5HKHA 4HVBA 2MBEA 4PS3A 3RULA 1TBEA 2NPTB 2XK5B 4GXBA 5AEKB 2J7QB 2KDEB 4A20A 3PPAA 4AP4C 1LXDA 1P0RA 3VH3B 3ZW3A 2Z59B 1NI2A 1WMHA 3U7DA 3ZKJC 4X57B 3VH4B 2KK8A 4G11A 2C5LC 2G3QB 2CHWA 2WYQA 1WJNA 1RRBA 2UWQA 4II2B 1U4AA 2M8SA 4HPLB 4FLHA 1WR6E 3QARA 4TKNA 3B1LX 1MG8A 5DPTA 1EUVB 2W9NA 3OJ4B 2IZVB 2K8BA 2NBVB 3TIXA 4EEWA 4JL9A 2JF5A 1ZW7A 3L10B 4MJSB 2KXJA 3DQVA 4JIOU 2GBRA 5LXIB 2N7EA 3EFUA 3A4SC 4DWFA 1UD7A 3ZNZB 3X23A 3H7SA 2L76A 4ZRIA 2V1YA 2IO1B 3DVGX 1V49A 2KVRA 3IBEA 3QCAA 1WGHA 2MP2A 2MSED 5JZEB 1ZKHA 1YX6B 2REXA 4PYUA 3ZNGC 2BPSA 3QAQA 4GIVA 4XZ4A 2NBWB 2M17A 1D3ZA 2FCNA 3A1QB 3ENEA 2C7HA 3UIOB 4ANXA 1UBQA 1WE6A 2MBQA 4TV3A 1FXTB 4EZLA 4W9IA 2LASA 2M0XA 3B0AA 3VUYA 4BOSC 1WFYA 1KJTA 3V6CB 4EKUA 4N9F4 3K9PB 4WWNA 1GJZA 3MJWA 2IO0B 5JHAA 5E6PA 2LVQA 4BVUC 1WF9A 5E6NA 4GDKB 1WR1A 1WIAA 3ZNID 2MW5A 1SGHA 2IO3B 5J17A 4IM3A 1L7YA 2CU1A 2K6QA 2LGDA 3M95A 4KDIC 4MSQB 1A5RA 1I35A 1E7UA 4KZCA 2PPHA 4NJ7A 1LFDA 4FHJA 2KANA 2DAFA 3EECA 3WAPA 3ML9A 3QA8A 4K7UA 4LCDE 3SD5A 4DHJD 5TR5A 3A9KB 4DXAB 3AXCA 3OAWA 1R4NI 3SDLC 2I1JA 2KTFA 2ASQA 2MA9B 4GDLB 1R4MI 4EUTA 2G4DB 3DPDA 3S2AA 2N9PC 1GC6A 3PT2B 2N1WA 2NPTA 2XK5A 3WA0A 2JT4B 3WALA 2CKHB 2KJ6A 4K7WA 4A3OA 2FIDA 3K9OB 1C3TA 2RD0A 4OVUA 4CYEA 2D3GA 1WZ3A 4KVGB 4GGQA 4RMAA 3WIMA 1WX7A 4IWOA 4RM9A 2L05A 3N30A 4WQOB 2WDTB 1WJ4A 4ICUA 2FCSA 2I1KA 3I3TB 2KQ7A 2LVPA 2ZPYA 5EDSA 3VTWA 1H4RA 2C7NB 2Z0DB 3UINB 1Y8RC 2C60A 3H9DA 3ZRCA 1QZEA 2ZVOA 4MM3A 2WWZA 5G2NA 4LJPB 4AJWA 2GMIC 4HDOA 2UYZB 4HDQA 5D7GA 2JPHA 2GOWA 1OTRB 2BYVE 2KLCA 3VTVA 4MJSA 2K8HA 2FNJB 3IG3A 4JGHB 3PSEB 4WAAA 1VD2A 3ZRFA 5KHQA 3PTFC 1WE7A 2AEHA 2JVCA 2K25A 4HJKA 4E3CA 3M63B 3Q3JA 5CHVC 4E74A 3NS8A 5D6JB 2GBMA 3ZNHB 4BKGA 1V9JA 1E90A 2WX0A 4IG7B 3PZDA 5BO4B 1WI0A 4ZRJA 3A1QA 4DHZB 4MGIE 2Y5BB 4JLCA 2KLGA 3RCZA 3HHMA 1GG3A 5E6OA 1S1QB 4WJNA 2DYMA 1TGZB 4LDTD 4NQLB 1KLVA 2O6VD 4II3B 4W9EA 5GMVA 4MGYE 4CO7A 4LDTB 4BBNF 2O6VB 2LD9A 2LI5A 2C9WB 4AUQC 4TUUA 3WAOA 4BBNC 2IYDB 4IM0A 2K6DB 4NY0A 5DCNA 2BF8B 1V5OA 2RSUA 1E7VA 4GDKA 3EHVA 3NOBA 2N9EB 2ZNVB 4KSKC 1LQBA 1WJ6A 4IM2A 1P1AA 1UELA 3N32A 4FJYA 5C1ZA 1WGGA 2K8CA 2JZZA 3QX1A 1YQBA 4HPMB 2IY1B 4KV2A 2JXXA 4GN1A 4W9HA 5IA7A 3A9JB 5J18A 4KIKA 4I6LB 5LLIA 2NBUA 3HM6X 1WGDA 1WZ0A 4DDID 2KO3A 5CTRC 3VFKA 3VHTC 1JRUA 4ANUA 3A9KA 2DZMA 2ZZPB 1E8WA 3N3KB 2BKRB 2LXAA 3PRMB 4KDLB 3DDCB 4GDLA 2G4SA 1EF1A 2D07B 3QWZB 3DOWA 4IWPA 4W9JA 4F1SA 1NBFC 1WRDB 1WX8A 5J2RA 3SHQA 4HCPB 4PS8A 5D94A 2KFKB 3VAWA 1P98A 1TZ1A 1YD8U 3M3JA 3PLVA 1OEYJ 2BYEA 2D2QA 2IY0B 2LZ6A 3A4RA 3M62B 3PHXB 3JYUA 3QK0A 4TQ0A 3NY5A 3KYCD 3PRPB 2L0TA 2KZRA 3ONSA 1GC7A 1WXMA 2Z0EB 1WM2A 2A5UA 2EKEC 2LGXA 2MLBA 2HE7A 3JW0X 2J0KA 1WYWB 2KWCA 3BINA 4K7SA 1RLFA 2ZPNA 3DVNU 2RGFA 1SIFA 1YX5B 2J0JA 2KWUB 4HK2A 1I42A 5IAAC 3R7RA 2RPQA 5DPWA 1EO6A 2KJRA 4ANWA 3AU4A 4FHKA 1Q1OA 2FUHB 2KMCA 2R2OA 4W9DA 2O2VB 1EF5A 3TL5A 4WJQA 3V62A 2V4LA 2DENB 4BKSD 3APCA 2DHZA 4NQKE 5FR6A 4KSLC 4FJVB 1Q5WB 2AL3A 2BWFA 2FAZA 3C0RB 5AZFA 4MGKE 4WJOA 5L95C 3D32A 2DYBA 4GB9A 4FJZA 1V86A 2JY6A 1Z5SB 4NJ6A 2KC2A 3PGEA 2KHWB 2O6VA 2YLMA 3V61A 3VQIA 3V6EB 3AU5A 4I6PA 4GU2A 3VXWA 4HLEA 2JZ3B 1IPGA 4HCNB 4W9KA 3A33B 4FA6A 2KC1A 4EOYA 4FBJB 2BGFA 3WAMA 2KOXA 4W9GA 3H6NA 4RM8A 3L08A 2AWTA 3QQ8B 1WXVA 3R66C 4ICVA 2AYOB 2KD0A 4MH0E 4GSWA 2DX5B 2PE6B 2DZIA 4ZDVA 2PEAA 5KHOA 4FN2A 1M94A 2MP2B 2KX0A 4AWJA 3H7PB 3TBLD 2L00B 4IWQA 4B9KA 3QJZA 4XX5A 3VUWA 3ZTCA 1XQQA 2M1MA 4WWOA 4BKTA 2DAJA 1KM7A 1WXAA 5AZGA 3B08A 5JHBA 4IUMB 2G45B 4W9FA 2L8JA 3OLMD 2DYOA 4K1RB 1ZGUB 4M8MA 4K81A 3X0WA 3NZSA 1T0YA 2MQJA 4PS7A 3IHPC 1OQYA 2LRWA 2ZVNA 1WM3A 2NVUI 3JSVB 3PV1A 4MELA 2KFKA 4ZRKA 3SU8X 1F9JA 3L16A 4G50A 2HJ8A 2PJHA 4MGZE 3U30A 3ZLZA 4AJYB 2EMTA 3NZUA 2JUOA 3KUZA 3KYDD 1WXSA 4J6IA 3RUIB 3W1SC 3DBRI 2CS4A 1V6EA 2RR9A 1S3SG 4MEMA 1J8CA 3RT3B 5LXHA 1IP9A 2ZCBA 3TJPA 4IC7B 2JRIB 2KDIA 4B95A 4FADA 1J0GA 2LVOA 1CMXB 3KVFB 1PQSA 4TQ1A 3TMPB 2CHXA 2B3AA 1GUAB 1UGMA 3RZWC 4WWPA 2OJRA 1YJ1A 2ZEQA 2M4NA 3PREA 3LJ3A 3QIJA 2N9XA 2KMAA 1KOTA 2KJHB 4NPNA 2O2VA 3ZTDA 2J0MA
chains in the Genus database with same CATH superfamily
4ZRQA 4M0WB 1XT9B 2W55A 3IAS1 3H1UA 1RM6C 2WP9B 4CHKA 2BKFA 3HRDD 3BY4B 3VVWB 2ZNVC 2CHZA 3EC8A 4M01A 2QJLA 1WGRA 2K22A 1XLOA 3DVGY 1WXQA 1IUEA 3W1YA 3CMMB 1OGWA 3RYTA 4ANVA 3AEAB 2KX3A 1V2YA 2DZJA 4F7ZA 2N7DA 1MPEA 4PT5A 1J19A 3H7PA 2L0FA 3W1SA 1G6JA 3P63A 2WU5B 3CSTA 4P16A 2LXCA 2NMQA 1HTQA 1IBXB 2M56B 1N62A 1TKYA 1N63A 1JWBD 1R7SA 4YXDB 1L6UA 3MHSD 1JROA 2NCNA 3P4RB 2V0GA 4OVVA 5CX3A 2CR5A 4US9A 2K1FA 3DVNV 3VUXA 2WLBA 2QEJC 4USAA 3ZUNA 3HM3A 3L54A 1E10A 4WWMA 5T8IA 4C80A 1L4ZB 4BOZB 5CHWA 2VRRB 3MC8A 1TTNA 2J53A 4WQMA 5BYRA 5IO9A 1RFAA 1EM7A 3P2BA 2JYEA 2OOBB 3GE8C 3N1XC 3GOEA 1WRIA 4W9CA 3L17A 2EMSA 5AUIA 3NHEB 3UF8A 1L5PA 2A4ZA 2N7JA 1K51A 3PVLA 1FRDA 3IT6B 2K39A 4I6NB 1AW7A 4YSZB 3KQ4A 1HA5A 2RDHA 3UQAA 5DPRA 2HTHA 3E56A 2DZKA 2E3TA 2LGYA 3AE3B 4BFRA 3NRZA 3DHIC 2QDFA 1HE8A 2GBNA 3Q14C 4HEA1 4HVBA 4PS3A 1YQ3B 1FRRA 3RULA 4N59A 1TBEA 2XK5B 5IKCM 3PPAA 1LXDA 4TMAB 2Z59B 1C4CA 3ZKJC 5EE0A 3W9CB 3DWMA 2XN9C 2CHWA 1RRBA 3FILB 1U4AA 3BVGA 4FLHA 3QARA 3B1LX 3RFZB 2J52A 2W9NA 3OJ4B 2WDRB 1FPYA 3TIXA 4EEWA 4JL9A 4MJSB 1SBBB 5LXIB 4RGOS 3EFUA 3URYA 1AN8A 1UD7A 3ZNZB 3H7SA 4ZRIA 1PDXA 3DVGX 1QT9A 1V49A 4RFBA 1WGHA 2MP2A 5G5GA 5JZEB 1ZKHA 1CK1A 3QAQA 1SIJA 2NBWB 4S0RA 1PGAA 3ENEA 1UBQA 1WE6A 1TT5B 4KKIA 2WHIA 2M0XA 4BOSC 1M4VA 1WFYA 4H2AA 4N9F4 5FK9C 1GJZA 3MJWA 2IO0B 2PVGC 4O1NA 5E6NA 2QC8A 2IO3B 3RI7C 1K50A 2K3UA 1L7YA 2CU1A 2K6QA 3M95A 1GOZA 2PPHA 1JRPA 1R4MB 4L2YA 4LCDE 1XLQA 3SDLC 2SEBD 4JWSC 4EUTA 3DPDA 1TS5A 3WA0A 2JT4B 3WALA 2CKHB 1A70A 1C3TA 2BS3B 4OVUA 4CYEA 4RMAA 4GGQA 4YT0B 3WIMA 1V1PB 5FKAC 2I1KA 1JQ4A 2KMMA 1H4RA 2C7NB 3UINB 1Y8RC 1EWYC 5G2NA 2HJ1A 2JPHA 3RN9C 1LGRA 2KN4A 2GOWA 3ZGZA 2K8HA 3IG3A 4WAAA 5KHQA 1WE7A 4HJKA 2JVCA 3AEDB 1DOXA 4A90A 1E90A 2MHJA 1ESFA 5BO4B 1WSPA 1E9MA 4OHJA 3RCZA 2HDEA 4WJNA 1KLVA 4LDTD 2EKIA 4W9EA 5GMVA 4ZRPA 1SEBD 4NY0A 5DCNA 2ACZB 2RSUA 4GDKA 3NOBA 2N9EB 4KSKC 1P1AA 2JSVX 2JZZA 2LJIA 1YQBA 3QX1A 4HPMB 2J4XA 2JXXA 3A9JB 1TY0A 3TEWA 3HM6X 1WGDA 3DHHC 4DDID 3W5VB 4ANUA 1E8WA 4L23A 3PRMB 4KDLB 3DDCB 3EGRA 4GDLA 1Y56A 3QWZB 2BBCA 3RNBC 3M3JA 2BYEA 3QK0A 4TQ0A 2WXRA 3PRPB 2KZRA 2LUMA 2A5UA 1DOYA 4TSSA 3JW0X 2J0KA 2KWCA 3BINA 4K7SA 2ZPNA 2J0JA 5IAAC 3R2TA 1E6EB 1EO6A 2FUHB 3WCQA 1QF6A 4LTUA 2R2OA 4W9DA 3AH7A 4WJQA 2ONQA 2V4LA 3V62A 3P1MA 1CQVA 2DHZA 3N1YC 2AL3A 2BWFA 3C0RB 4WIPA 4MGKE 3D32A 4LNOA 2R61A 4GB9A 1V86A 1SXTA 1TKGA 4L1BA 4I6PA 4NAMA 5EE9A 4HLEA 1UNSA 1UWXA 4ZHPA 3AV8A 4QAYA 3AEGB 3WAMA 2AYOB 2DX5B 2PEAA 5KHOA 4FN2A 1M94A 3RPFC 2L00B 3VUWA 1XQQA 2W3SA 2DAJA 4A8XC 2BB5A 1KM7A 1F52A 5JHBA 2G45B 1ZGUB 2PLPA 1T0YA 1KH0A 4MELA 3OWEB 3PV1A 4P1BC 4KGSA 2EMTA 4K3CA 1RYJA 3KUZA 2D3AA 2XNAC 1BUIC 1FNUA 1J8CA 1JWAD 1J0GA 2JRIB 2KDIA 1PQSA 3TMPB 1DGJA 2CHXA 3I57A 1GUAB 1UGMA 3RZWC 2M4NA 2LGIA 2N9XA 2KMAA 1KOTA 3Q3OC 3SFEB 3ZTDA 4NJCA 2KTRB 3KUDB 4NAWB 4WJPA 3GZNI 1T0SC 4LNKA 3AI5A 3L4PA 4KZ0A 3IFWB 3ECIA 3I63C 3L13A 3Q3MC 2QHOA 4Q2JA 4W9LA 1FIQA 1E8XA 4MM3B 3DCGA 3I9V1 5C2TB 3BK1A 1PGBA 3KW5B 3VR9B 2SAKA 3JVZX 1IYFA 3DBHB 2LUEA 3O13A 3Q8BA 2GBKA 2R2QA 3WANA 3BK2A 4J3OD 3BVMA 1PYWD 2FCMA 4G0NB 2HTME 3LDZE 4JE3B 2IBIB 5HFYA 1D5MC 3ZDTA 1LM8B 4IDIA 1WMHB 4IOIE 2L1AA 4B6WA 3DBLB 1NDDA 1RAXA 3CF6E 4NNJB 2D11A 4DK5A 1V81A 3ETRA 1EU4A 1XD3B 1ZOYB 1JALA 3O65B 3NUHB 2KKCA 5E6JA 3UIPB 1Z2MA 5H92C 3APFA 1VJKA 1UWMA 3HIZA 4AOFA 3L0WB 4LJOB 5D3IB 4MDKE 1XO3A 3DBSA 3Q3FA 4A6QA 2M0AA 1P7EA 2WU2B 2KWDA 4FULA 2ZJDA 3APDA 3T9LA 5AZHA 1VZ6A 1C1YB 1E8YA 3AB5A 5BMIA 4LNIA 1C77A 1MI0A 3ZYYX 1GAQB 2DNFA 2KN5A 5EE1A 1MHHE 5GXGB 1ISNA 3AE9B 4GMVA 2N1VA 1VRAB 3T8MA 2BWES 1FMAD 4URKA 2V3SA 1J7AA 3AULA 1TIFA 2KQSA 3HVZA 2NTSA 2NPTB 4RCOA 5AEKB 1IBXA 4AP4C 1OQQA 3VH3B 2N0SB 1C9FA 3PZ7A 4ZHOA 2V3NA 3P4SB 2G3QB 3FKYA 2GB1A 1WR6E 4TKNA 1MG8A 2K8BA 2NBVB 1CJEA 3BZDB 1ZW7A 3DQVA 4P1CC 3A4SC 4DWFA 3N1ZC 2L76A 3IBEA 4CQNA 1TKEA 1YX6B 1D3ZA 1YNTE 3RNAC 2C7HA 4OZBA 1FXAA 4EZLA 4W9IA 2LASA 3VUYA 4US8A 3P42A 1KJTA 3ZJTA 4XDCA 3DHGC 2LHEA 2Y5PA 1WF9A 4BVUC 4DQOC 4YSYB 3LXFA 2WNMA 4KDIC 1I35A 4NJ7A 4FHJA 4JPSA 3KWVA 4OW0A 2K5PA 3ML9A 4K7UA 2AQ1B 3SD5A 4DHJD 4DXAB 3OAWA 2I1JA 2VZKB 1R4MI 1YMHE 4KKJA 5LNK1 2XK5A 3Q8AA 2KJ6A 4KX6B 3Q8EA 2FIDA 2RD0A 1XLPA 2PKOA 4KVGB 3MC0B 3DWGC 4YTNB 2WDTB 2JX5A 1F2RI 1QZEA 1DOIA 4IKGA 3TSSA 3NVZA 1OTRB 2BYVE 2KLCA 4MJSA 2FNJB 4YSXB 4HROA 2AEHA 1F2RC 3M63B 5CHVC 1KLGD 3NS8A 2JQRB 4RF1A 2DWQA 4LNFA 1L4DB 3PZDA 1WI0A 3MC9A 4DHZB 1VLBA 2KLGA 3ZXVA 5E6OA 4A9AA 4NQLB 2TSSA 4FXCA 2BTEA 2O6VB 2LD9A 2W3RA 2C9WB 4NZLB 1NYQA 3B9JA 2BF8B 1BXTA 2V9HA 4OVZA 1LO5D 1V5OA 1E7VA 1ROEA 4JX1C 2ZNVB 1LQBA 1UELA 4FJYA 3Q8FA 4KIKA 2X8XX 2ZW0A 2KO3A 1YOVB 2DZMA 4XWWA 1B9RA 3N3KB 2G4SA 3R2IA 3DOWA 4IWPA 1NBFC 1WRDB 5HG2A 3AE2B 3SHQA 4HCPB 5D94A 2KFKB 3VAWA 3N9YC 3PHXB 2RPVA 3V3XA 3KYCD 1V1PA 1GC7A 1SE2A 1WM2A 2LGXA 1RLFA 2OHFA 1SIFA 4HK2A 1QILA 1FCCC 1KF6B 2RPQA 2KJRA 3AU4A 4FHKA 1TS2A 1F0ZA 3APCA 5FR6A 1UUPA 5AZFA 2FAZA 2L83A 4RF0A 4WJOA 1WGKA 1JMLA 4S17A 2JY6A 2W82A 4NJ6A 4ACFA 3PGEA 2YLMA 1PFDA 3V61A 3AU5A 2QILA 2JZ3B 4W9KA 3A33B 4D2KA 2BGFA 2KACA 3VRAB 4RM8A 4GSWA 1C78A 2G9HD 2MP2B 4B9KA 2KAJA 4BKTA 2L8JA 2DYOA 3IHPC 1OQYA 1E7PB 1WM3A 3JSVB 3SU8X 3KWLA 3L16A 4G50A 2PJHA 1SB3C 4AJYB 4J6IA 1WXSA 3RUIB 1FFVA 3AE4B 4MEMA 1NENB 1SE3A 3MP9A 1QOAA 1IP9A 2ZCBA 4IC7B 1TS4A 4B95A 4TQ1A 4N58A 2WXKA 2AX5A 4WWPA 3HUIA 1YJ1A 2ZEQA 1K53A 1XCQL 1N6ZA 1D4BA 3LJ3A 2LHDA 2KJHB 1YN3A 2KVZA 1ZP0B 4YL8A 1HZ5A 4HWIB 4HKQA 1C76A 1L2NA 3PHWB 1XF5L 1FNWA 2KDBA 3VRBB 2PW9A 2WS3B 1N5XA 3NVYA 1K52A 1VCBA 3R3MA 1UBIA 3ZVVA 4JQWC 3GP7A 2MWSB 1EWCA 4EZJA 4G3XB 5IP4D 2BYFA 2LRUA 2XEWA 2KFJA 2ZW1A 3U2SC 3AE8B 3IVFA 4DBGA 3PRZA 2MRPA 3DBHI 1D5XC 4XWTA 4PYZA 4M00A 3RD2A 1YJIA 2BS2B 3FAHA 1WY8A 2LJ5A 1L0YB 2FIFA 4AS1A 1MFWA 2N4FA 1JW9D 2D3BA 1WGYA 2INCC 4HPPA 4RH6A 5DPSA 2ZCCA 4GOCA 2L7RA 1FO4A 1N5WA 1H8CA 1P9DU 2NTTA 2MH7A 3DBLI 1X1MA 1WH3A 1WJUA 3V60A 3UQBA 1AWDA 3ZJUA 2FBWB 1UZXB 3IT4B 2HD5B 3GB1A 2GBJA 4R3DA 3V05A 3N20C 2OEDA 3KLSX 3TCAA 3ZIMA 2K0PA 3QHTA 2MBOA 1E8ZA 4GLSC 3CSFA 2V4IB 2KTRA 2D10A 4NAWA 3NVWA 3B2FA 2KYWA 3VDZA 3CWIA 3ZO5B 1K8RB 3ML8A 2D3CA 1SJED 3PS6A 1E5WA 3U8ZA 1XLNA 5AUKA 3ALBA 1Q0WB 3RNFC 3AE6B 2PE9A 3VTUA 3R7QA 2K9XA 4F8CB 1V5TA 4ASWC 3OJ3A 2XBBC 2C7MB 2KQ4X 3CIRB 1C4AA 5D2MB 5C23A 2MBEA 4DXGA 4GXBA 2OJWA 4A20A 2KDEB 2RDGA 2LFIA 1WMHA 3AMZA 1V97A 4X57B 3VH4B 1VZ8A 4G11A 2C5LC 1WJNA 4AQ7A 4II2B 4LK0M 4HPLB 1QOGA 5DPTA 1EUVB 1PGXA 2W54A 2JF5A 3L10B 2KXJA 3Q2AC 4JIOU 2GBRA 2N7EA 2JU6X 3X23A 2KVRA 4ZYSA 3QCAA 2MSED 2REXA 3BYTB 2BPSA 4XZ4A 3ZNGC 2M17A 2WXFA 3A1QB 4ANXA 2MBQA 4TV3A 2AQ2B 3BVZA 1I4HA 3V6CB 5BYSA 1FFUA 3J9CA 1IGDA 1T5XD 1WR1A 1WIAA 5HHDG 2MW5A 1SGHA 2Y3AA 1AYFA 1STEA 4WURA 1J7BA 2LGDA 4MSQB 1A5RA 1T6BX 1LFDA 2CJNA 1R4NB 2G1EA 2CU3A 3AECB 3BWUD 3QA8A 2WXMA 2VZKD 3A9KB 2KTFA 1UF0A 2ASQA 1UGJA 3BYYB 1FEHA 2G4DB 2N9PC 1TY2A 2N1WA 2NPTA 3T3OA 3NG0A 1N60A 1ZXHA 4M0WA 4A3OA 3I5JC 3K9OB 2D3GA 1WX7A 2IDYA 4IWOA 4RM9A 1ET9A 2L05A 3N30A 1P7FA 4HRSA 4WQOB 2VH1A 1WJ4A 4UDUC 3I3TB 2LVPA 2ZPYA 1ZDVA 5EDSA 5EE3A 3VTWA 2GRIA 2Z0DB 1RFKA 2C60A 3H9DA 3ZRCA 1I7HA 2ZVOA 2UU7A 4LJPB 4AJWA 2GMIC 4HDOA 5D7GA 3VTVA 4JGHB 1C79A 2K25A 4E3CA 2N9KA 5D6JB 3ZNHB 4BZAA 1BMLC 2WX0A 1YJJA 1T3QA 5C3JB 4JLCA 1S1QB 2DYMA 2O6VD 4II3B 5I4DA 4BBNF 2LI5A 2Y5CA 4BBNC 2IYDB 4IM0A 4B0EA 2N9LA 4HKZE 1FD6A 1WJ6A 4IM2A 3Q69A 2LMCA 2K8CA 2IY1B 4KV2A 1I4RA 4GN1A 4W9HA 1TJEA 1JWUD 3MFGA 2BQQA 5CTRC 3VFKA 4YWGG 2BKRB 2LXAA 1EF1A 1WX8A 5J2RA 2Q5WD 4RGNA 4XGAB 1P98A 1TZ1A 1YD8U 3MJ5A 4RGTA 2D2QA 2LZ6A 3M62B 2YEPB 2JWUA 1QQRA 3JYUA 1GB4A 2D5GA 4YTMB 3ONSA 1V8CA 1WXMA 1JWMD 1TS3A 2GI9A 2HE7A 1WWTA 2RGFA 1YX5B 2KWUB 1GPXA 2RMMA 4C4VB 3RNCC 5DPWA 1TZOA 1Q1OA 2KMCA 3C8YA 2BVCA 1I4QA 2O2VB 3TL5A 4PK1A 4BKSD 4NQKE 4KSLC 3NVVA 3EUB2 3UI3A 2LGSA 5L95C 4ARCA 4KGTA 2DYBA 4XYCA 1I4XA 5BMHA 2KHWB 2O6VA 3VQIA 3V6EB 4RGMA 4GU2A 3VXWA 2KC1A 4ITKA 2MJEA 2KOXA 4W9GA 3H6NA 3L08A 4JWUC 2AWTA 3R66C 3FILA 4ICVA 2KD0A 2WXIA 2PE6B 5H8YE 4C00A 1DYQA 2KX0A 4AWJA 3H7PB 3LYYA 3AEEB 1ZE3D 2M1MA 1WXAA 4IUMB 5TSSA 3X0WA 3NZSA 1VDVA 2MQJA 2PTLA 1KTKA 3P4PB 2KFKA 1F9JA 3DBRB 4WH4A 3ZLZA 2HJ8A 4MGZE 1HZ6A 2JUOA 1HEZE 3ZXRA 2WXLA 3SR6A 2RR9A 1S3SG 2MJ3A 5LXHA 3TJPA 4FADA 2LVOA 3EFCA 1CMXB 2B3AA 3W2DA 2OJRA 2QCZA 2H88B 1NEKB 3NS1A 4WAFA 4B0MA 4NPNA 1L6VA 3PLUA 4MT5A 2KDMA 1D6EC 4ZYNA 1D5ZC 5IOIA 4BKSA 1WX9A 2LEKA 5HI1A 2FE8A 3LB8C 4EZKA 3AEBB 1CZPA 4DDGD 2L32A 2L3ZA 2JRHA 3AE5B 5FR3A 2MBHA 2PVOD 1UH6A 2ICIA 2WXGA 4MSMB 3KH0A 1SE9A 4IW0A 2JYTA 2AQ3B 3ZDMC 3AE7B 5CHFA 4A3PA 1V80A 2MX2A 3JSVA 3TEYA 1FCLA 2MCNB 1V1OA 4LNNA 2LWPA 4P7IA 2YVCA 4EFOA 2MBBB 4HXDA 1QOBA 1ACCA 1T0RC 2AL6A 3AEFB 4KIKB 4DHZE 3QC8B 2KNBA 3T3NA 1SF0A 1VR9A 4E71A 4A55A 5G55A 3KUCB 1OEYA 5L83A 1T0QC 1NI3A 5BMGA 1MJDA 4DHJB 2M19A 1HQRD 3HK0A 3EA6A 2NS5A 4M8NA 3A9JA 2DLBA 2QIEB 1BT0A 3RZFA 3AM9A 2RDBC 1GNUA 3UGBB 2IPKD 2IGHA 3MTNB 2V3PA 4MACA 2INPE 2WX1A 4DXFA 1P3QU 5JH5C 1AARA 3VR8B 1XCTL 1FXIA 1RWSA 2JWZA 1SE4A 3U4EG 3IXSA 4EE2A 1EU3A 1YIWA 2FCQA 1YN5A 2KDFB 1C4PA 2Z8LA 4K3BA 1J7CA 1FNVA 2NR2A 2IO2B 2KWVB 2L52A 4XC2A 4P6VF 5HKHA 2WXNA 2J7QB 1L0XB 1P0RA 3ZW3A 1NI2A 1ZXIA 3U7DA 1ET6A 1F77A 2KK8A 5BYQA 3R8BA 2WYQA 2UWQA 2FUG1 2I38A 2M8SA 1ZPSA 3ZQ4A 2IZVB 2WXQA 4C7ZA 1KLUD 4BAXA 1VZ7A 3TEZA 4LLGM 2V1YA 2IO1B 3PZ8A 2BS4B 4PYUA 4GIVA 2FCNA 3UIOB 1FXTB 1QKZA 3RMKC 3B0AA 3MHZA 2QSDA 3ABVB 4EKUA 3E9SA 3K9PB 4WWNA 3OG5A 5JHAA 1PUTA 2KT7A 5E6PA 2LVQA 4C56C 3AE1B 4GDKB 3ZNID 2MEKA 2INDC 4IM3A 5J17A 1QLBB 4KGRA 3FC4A 2PIAA 1E7UA 4KZCA 2KANA 1Q10A 1YQ4B 2DAFA 5MPOA 3RNGC 3EECA 2BB6A 3WAPA 1OQRA 5TR5A 3AXCA 1R4NI 3Q8CA 2WDQB 4GDLB 2MA9B 3S2AA 1GC6A 3PT2B 4M02A 1ZUD2 4K7WA 2INNE 1WZ3A 2I2YA 4ICUA 2FCSA 2KQ7A 3NZ3A 2J42A 3TUOA 2WXOA 4MM3A 2WWZA 1HXYD 2PMVA 3HVDA 2UYZB 4HDQA 1ZDXA 2IGGA 3Q3NC 4ZOHC 3PSEB 1VD2A 2DBYA 3ZRFA 3PTFC 3Q3JA 1WYGA 4E74A 1XXGA 2GBMA 2QMTA 4HJGE 4BKGA 1V9JA 4IG7B 3ZJVA 2VH2A 4ZRJA 3RNEC 3A1QA 4MGIE 3PO0A 2Y5BB 2B76B 3HHMA 1GG3A 3U52E 2MJDA 3SEBA 3U7ZA 1TGZB 2BT6A 1KRHA 4MGYE 4LDTB 4CO7A 4REZA 3GE3C 4AUQC 4TUUA 3WAOA 2K6DB 4RNAA 1IGCA 5IN7A 1ENFA 1OFFA 3EHVA 2WDVB 3N32A 5C1ZA 1WGGA 2GLSA 4OZAA 1I4PA 5IA7A 5J18A 4I6LB 5LLIA 2NBUA 1TYGB 2IGDA 1WZ0A 3VHTC 1JRUA 3A9KA 2WGSA 2WXJA 2ZZPB 1F1HA 4N6EB 2D07B 4W9JA 4F1SA 4PS8A 3PLVA 1OEYJ 2IY0B 3A4RA 3Q6BA 3NY5A 3P4QB 2BYTA 2L0TA 3SFDB 2Z0EB 2EELA 2EKEC 2ON8A 5JXVA 2MLBA 1WYWB 3DVNU 3W5UB 1I42A 3B2GA 3R7RA 1GB1A 2YEPF 4ANWA 1EF5A 1KFYB 1MVKA 2X38A 2DENB 1SJHD 1NVID 4OZCA 1SSNA 1Q5WB 1L0VB 4FJVB 1YN4A 1MG4A 4FJZA 1Z5SB 2BW2A 1MHXA 2KC2A 1B1ZA 5G5HA 1NYRA 1JCKB 2CJOA 1N61A 1IPGA 4HCNB 5D3DA 4EOYA 4FBJB 3QQ8B 1WXVA 4MH0E 2IJ0A 2DZIA 3TEXA 3AN1A 4ZDVA 2WXPA 3C19A 3TBLD 2JXTA 4IWQA 3QJZA 4XX5A 3ZTCA 4WWOA 4YTPB 5AZGA 3B08A 3BIID 4W9FA 1FM0D 1QOFA 3OLMD 4K1RB 1HTOA 4M8MA 4K81A 4PS7A 2H89B 2LRWA 2ZVNA 2NVUI 1I4GA 4ZRKA 2WQYB 3IAM1 3U30A 2JZPA 4ARIA 3NZUA 3KYDD 2WXHA 3W1SC 4MH8A 3DBRI 2CS4A 1V6EA 4XE0A 3H8HA 1E0ZA 1XEEA 3RT3B 4C7YA 3NJTA 3KVFB 1JWSD 3GS2A 4C4VA 2E6XA 3PREA 4XDDA 3QIJA 3GZNB 4FA6A 2O2VA 2J0MA
chains in the Genus database with same CATH topology
3PLUA 2KTRB 4M0WB 1XT9B 4YL8A 3KUDB 4HWIB 3H1UA 4NAWB 4WJPA 4ZYNA 3GZNI 4CHKA 1L2NA 2BKFA 3AI5A 1WX9A 4BKSA 4KZ0A 3IFWB 3BY4B 3ECIA 3VVWB 3PHWB 2ZNVC 2CHZA 3L13A 3EC8A 2QHOA 2KDBA 4W9LA 4EZKA 1WGRA 1E8XA 3DCGA 1VCBA 3R3MA 4DDGD 1UBIA 2L3ZA 2JRHA 3DVGY 3ZVVA 3KW5B 4JQWC 3W1YA 3CMMB 1OGWA 2MBHA 3RYTA 2MWSB 3JVZX 4ANVA 1UH6A 4EZJA 1IYFA 4G3XB 2KX3A 1V2YA 2LUEA 4MSMB 2DZJA 3KH0A 4F7ZA 2N7DA 2BYFA 2LRUA 2XEWA 2KFJA 2GBKA 1J19A 3H7PA 3IVFA 2R2QA 1SE9A 2L0FA 2MRPA 3PRZA 3W1SA 3WANA 4DBGA 1G6JA 3DBHI 4IW0A 2FCMA 3ZDMC 4PYZA 4G0NB 3RD2A 3CSTA 2LXCA 5CHFA 3LDZE 4A3PA 1V80A 2IBIB 2MX2A 1WY8A 2LJ5A 3ZDTA 1LM8B 2FIFA 3JSVA 1WMHB 2MCNB 2N4FA 4B6WA 1WGYA 5DPSA 3MHSD 1NDDA 1RAXA 2LWPA 2ZCCA 3CF6E 4GOCA 2YVCA 4NNJB 2L7RA 4P7IA 4EFOA 2NCNA 2D11A 2MBBB 4OVVA 4DK5A 5CX3A 1V81A 4HXDA 1H8CA 1XD3B 1P9DU 2CR5A 2K1FA 3DBLI 3O65B 3DVNV 1X1MA 3VUXA 1WH3A 1WJUA 2AL6A 4KIKB 3V60A 4DHZE 3UQBA 3QC8B 2KNBA 3ZUNA 3HM3A 3L54A 2KKCA 4E71A 3UIPB 1Z2MA 5G55A 1UZXB 3KUCB 3APFA 2HD5B 1OEYA 2GBJA 5L83A 4BOZB 3TCAA 5CHWA 3ZIMA 2VRRB 3HIZA 4AOFA 3L0WB 4DHJB 3QHTA 2MBOA 4LJOB 3HK0A 4MDKE 1E8ZA 2NS5A 3DBSA 3Q3FA 4M8NA 3A9JA 1TTNA 3CSFA 2KTRA 1RFAA 2D10A 4NAWA 3P2BA 1BT0A 2OOBB 4FULA 3RZFA 3GOEA 1GNUA 3UGBB 3VDZA 2ZJDA 4W9CA 3ZO5B 3L17A 3APDA 2EMSA 3T9LA 1K8RB 3NHEB 3UF8A 3MTNB 5AZHA 3ML8A 1C1YB 1E8YA 2A4ZA 3PS6A 1E5WA 3U8ZA 2WX1A 3PVLA 2K39A 3ALBA 1P3QU 5JH5C 1AARA 4I6NB 1Q0WB 2PE9A 3VTUA 3R7QA 2KN5A 2JWZA 4F8CB 1ISNA 4GMVA 1YIWA 2FCQA 1V5TA 2N1VA 2KDFB 3UQAA 4ASWC 3OJ3A 3T8MA 5DPRA 2HTHA 2DZKA 2XBBC 2C7MB 2LGYA 2BWES 4BFRA 4URKA 2NR2A 2IO2B 2V3SA 1HE8A 2KWVB 2GBNA 3AULA 5D2MB 2KQSA 4XC2A 5C23A 5HKHA 4HVBA 2MBEA 4PS3A 3RULA 1TBEA 2NPTB 2XK5B 4GXBA 5AEKB 2J7QB 2KDEB 4A20A 3PPAA 4AP4C 1LXDA 1P0RA 3VH3B 3ZW3A 2Z59B 1NI2A 1WMHA 3U7DA 3ZKJC 4X57B 3VH4B 2KK8A 4G11A 2C5LC 2G3QB 2CHWA 2WYQA 1WJNA 1RRBA 2UWQA 4II2B 1U4AA 2M8SA 4HPLB 4FLHA 1WR6E 3QARA 4TKNA 3B1LX 1MG8A 5DPTA 1EUVB 2W9NA 3OJ4B 2IZVB 2K8BA 2NBVB 3TIXA 4EEWA 4JL9A 2JF5A 1ZW7A 3L10B 4MJSB 2KXJA 3DQVA 4JIOU 2GBRA 5LXIB 2N7EA 3EFUA 3A4SC 4DWFA 1UD7A 3ZNZB 3X23A 3H7SA 2L76A 4ZRIA 2V1YA 2IO1B 3DVGX 1V49A 2KVRA 3IBEA 3QCAA 1WGHA 2MP2A 2MSED 5JZEB 1ZKHA 1YX6B 2REXA 4PYUA 3ZNGC 2BPSA 3QAQA 4GIVA 4XZ4A 2NBWB 2M17A 1D3ZA 2FCNA 3A1QB 3ENEA 2C7HA 3UIOB 4ANXA 1UBQA 1WE6A 2MBQA 4TV3A 1FXTB 4EZLA 4W9IA 2LASA 2M0XA 3B0AA 3VUYA 4BOSC 1WFYA 1KJTA 3V6CB 4EKUA 4N9F4 3K9PB 4WWNA 1GJZA 3MJWA 2IO0B 5JHAA 5E6PA 2LVQA 4BVUC 1WF9A 5E6NA 4GDKB 1WR1A 1WIAA 3ZNID 2MW5A 1SGHA 2IO3B 5J17A 4IM3A 1L7YA 2CU1A 2K6QA 2LGDA 3M95A 4KDIC 4MSQB 1A5RA 1I35A 1E7UA 4KZCA 2PPHA 4NJ7A 1LFDA 4FHJA 2KANA 2DAFA 3EECA 3WAPA 3ML9A 3QA8A 4K7UA 4LCDE 3SD5A 4DHJD 5TR5A 3A9KB 4DXAB 3AXCA 3OAWA 1R4NI 3SDLC 2I1JA 2KTFA 2ASQA 2MA9B 4GDLB 1R4MI 4EUTA 2G4DB 3DPDA 3S2AA 2N9PC 1GC6A 3PT2B 2N1WA 2NPTA 2XK5A 3WA0A 2JT4B 3WALA 2CKHB 2KJ6A 4K7WA 4A3OA 2FIDA 3K9OB 1C3TA 2RD0A 4OVUA 4CYEA 2D3GA 1WZ3A 4KVGB 4GGQA 4RMAA 3WIMA 1WX7A 4IWOA 4RM9A 2L05A 3N30A 4WQOB 2WDTB 1WJ4A 4ICUA 2FCSA 2I1KA 3I3TB 2KQ7A 2LVPA 2ZPYA 5EDSA 3VTWA 1H4RA 2C7NB 2Z0DB 3UINB 1Y8RC 2C60A 3H9DA 3ZRCA 1QZEA 2ZVOA 4MM3A 2WWZA 5G2NA 4LJPB 4AJWA 2GMIC 4HDOA 2UYZB 4HDQA 5D7GA 2JPHA 2GOWA 1OTRB 2BYVE 2KLCA 3VTVA 4MJSA 2K8HA 2FNJB 3IG3A 4JGHB 3PSEB 4WAAA 1VD2A 3ZRFA 5KHQA 3PTFC 1WE7A 2AEHA 2JVCA 2K25A 4HJKA 4E3CA 3M63B 3Q3JA 5CHVC 4E74A 3NS8A 5D6JB 2GBMA 3ZNHB 4BKGA 1V9JA 1E90A 2WX0A 4IG7B 3PZDA 5BO4B 1WI0A 4ZRJA 3A1QA 4DHZB 4MGIE 2Y5BB 4JLCA 2KLGA 3RCZA 3HHMA 1GG3A 5E6OA 1S1QB 4WJNA 2DYMA 1TGZB 4LDTD 4NQLB 1KLVA 2O6VD 4II3B 4W9EA 5GMVA 4MGYE 4CO7A 4LDTB 4BBNF 2O6VB 2LD9A 2LI5A 2C9WB 4AUQC 4TUUA 3WAOA 4BBNC 2IYDB 4IM0A 2K6DB 4NY0A 5DCNA 2BF8B 1V5OA 2RSUA 1E7VA 4GDKA 3EHVA 3NOBA 2N9EB 2ZNVB 4KSKC 1LQBA 1WJ6A 4IM2A 1P1AA 1UELA 3N32A 4FJYA 5C1ZA 1WGGA 2K8CA 2JZZA 3QX1A 1YQBA 4HPMB 2IY1B 4KV2A 2JXXA 4GN1A 4W9HA 5IA7A 3A9JB 5J18A 4KIKA 4I6LB 5LLIA 2NBUA 3HM6X 1WGDA 1WZ0A 4DDID 2KO3A 5CTRC 3VFKA 3VHTC 1JRUA 4ANUA 3A9KA 2DZMA 2ZZPB 1E8WA 3N3KB 2BKRB 2LXAA 3PRMB 4KDLB 3DDCB 4GDLA 2G4SA 1EF1A 2D07B 3QWZB 3DOWA 4IWPA 4W9JA 4F1SA 1NBFC 1WRDB 1WX8A 5J2RA 3SHQA 4HCPB 4PS8A 5D94A 2KFKB 3VAWA 1P98A 1TZ1A 1YD8U 3M3JA 3PLVA 1OEYJ 2BYEA 2D2QA 2IY0B 2LZ6A 3A4RA 3M62B 3PHXB 3JYUA 3QK0A 4TQ0A 3NY5A 3KYCD 3PRPB 2L0TA 2KZRA 3ONSA 1GC7A 1WXMA 2Z0EB 1WM2A 2A5UA 2EKEC 2LGXA 2MLBA 2HE7A 3JW0X 2J0KA 1WYWB 2KWCA 3BINA 4K7SA 1RLFA 2ZPNA 3DVNU 2RGFA 1SIFA 1YX5B 2J0JA 2KWUB 4HK2A 1I42A 5IAAC 3R7RA 2RPQA 5DPWA 1EO6A 2KJRA 4ANWA 3AU4A 4FHKA 1Q1OA 2FUHB 2KMCA 2R2OA 4W9DA 2O2VB 1EF5A 3TL5A 4WJQA 3V62A 2V4LA 2DENB 4BKSD 3APCA 2DHZA 4NQKE 5FR6A 4KSLC 4FJVB 1Q5WB 2AL3A 2BWFA 2FAZA 3C0RB 5AZFA 4MGKE 4WJOA 5L95C 3D32A 2DYBA 4GB9A 4FJZA 1V86A 2JY6A 1Z5SB 4NJ6A 2KC2A 3PGEA 2KHWB 2O6VA 2YLMA 3V61A 3VQIA 3V6EB 3AU5A 4I6PA 4GU2A 3VXWA 4HLEA 2JZ3B 1IPGA 4HCNB 4W9KA 3A33B 4FA6A 2KC1A 4EOYA 4FBJB 2BGFA 3WAMA 2KOXA 4W9GA 3H6NA 4RM8A 3L08A 2AWTA 3QQ8B 1WXVA 3R66C 4ICVA 2AYOB 2KD0A 4MH0E 4GSWA 2DX5B 2PE6B 2DZIA 4ZDVA 2PEAA 5KHOA 4FN2A 1M94A 2MP2B 2KX0A 4AWJA 3H7PB 3TBLD 2L00B 4IWQA 4B9KA 3QJZA 4XX5A 3VUWA 3ZTCA 1XQQA 2M1MA 4WWOA 4BKTA 2DAJA 1KM7A 1WXAA 5AZGA 3B08A 5JHBA 4IUMB 2G45B 4W9FA 2L8JA 3OLMD 2DYOA 4K1RB 1ZGUB 4M8MA 4K81A 3X0WA 3NZSA 1T0YA 2MQJA 4PS7A 3IHPC 1OQYA 2LRWA 2ZVNA 1WM3A 2NVUI 3JSVB 3PV1A 4MELA 2KFKA 4ZRKA 3SU8X 1F9JA 3L16A 4G50A 2HJ8A 2PJHA 4MGZE 3U30A 3ZLZA 4AJYB 2EMTA 3NZUA 2JUOA 3KUZA 3KYDD 1WXSA 4J6IA 3RUIB 3W1SC 3DBRI 2CS4A 1V6EA 2RR9A 1S3SG 4MEMA 1J8CA 3RT3B 5LXHA 1IP9A 2ZCBA 3TJPA 4IC7B 2JRIB 2KDIA 4B95A 4FADA 1J0GA 2LVOA 1CMXB 3KVFB 1PQSA 4TQ1A 3TMPB 2CHXA 2B3AA 1GUAB 1UGMA 3RZWC 4WWPA 2OJRA 1YJ1A 2ZEQA 2M4NA 3PREA 3LJ3A 3QIJA 2N9XA 2KMAA 1KOTA 2KJHB 4NPNA 2O2VA 3ZTDA 2J0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLU A;  2KTR B;  4M0W B;  1XT9 B;  4YL8 A;  3KUD B;  4HWI B;  3H1U A;  4NAW B;  4WJP A;  4ZYN A;  3GZN I;  4CHK A;  1L2N A;  2BKF A;  3AI5 A;  1WX9 A;  4BKS A;  4KZ0 A;  3IFW B;  3BY4 B;  3ECI A;  3VVW B;  3PHW B;  2ZNV C;  2CHZ A;  3L13 A;  3EC8 A;  2QHO A;  2KDB A;  4W9L A;  4EZK A;  1WGR A;  1E8X A;  3DCG A;  1VCB A;  3R3M A;  4DDG D;  1UBI A;  2L3Z A;  2JRH A;  3DVG Y;  3ZVV A;  3KW5 B;  4JQW C;  3W1Y A;  3CMM B;  1OGW A;  2MBH A;  3RYT A;  2MWS B;  3JVZ X;  4ANV A;  1UH6 A;  4EZJ A;  1IYF A;  4G3X B;  2KX3 A;  1V2Y A;  2LUE A;  4MSM B;  2DZJ A;  3KH0 A;  4F7Z A;  2N7D A;  2BYF A;  2LRU A;  2XEW A;  2KFJ A;  2GBK A;  1J19 A;  3H7P A;  3IVF A;  2R2Q A;  1SE9 A;  2L0F A;  2MRP A;  3PRZ A;  3W1S A;  3WAN A;  4DBG A;  1G6J A;  3DBH I;  4IW0 A;  2FCM A;  3ZDM C;  4PYZ A;  4G0N B;  3RD2 A;  3CST A;  2LXC A;  5CHF A;  3LDZ E;  4A3P A;  1V80 A;  2IBI B;  2MX2 A;  1WY8 A;  2LJ5 A;  3ZDT A;  1LM8 B;  2FIF A;  3JSV A;  1WMH B;  2MCN B;  2N4F A;  4B6W A;  1WGY A;  5DPS A;  3MHS D;  1NDD A;  1RAX A;  2LWP A;  2ZCC A;  3CF6 E;  4GOC A;  2YVC A;  4NNJ B;  2L7R A;  4P7I A;  4EFO A;  2NCN A;  2D11 A;  2MBB B;  4OVV A;  4DK5 A;  5CX3 A;  1V81 A;  4HXD A;  1H8C A;  1XD3 B;  1P9D U;  2CR5 A;  2K1F A;  3DBL I;  3O65 B;  3DVN V;  1X1M A;  3VUX A;  1WH3 A;  1WJU A;  2AL6 A;  4KIK B;  3V60 A;  4DHZ E;  3UQB A;  3QC8 B;  2KNB A;  3ZUN A;  3HM3 A;  3L54 A;  2KKC A;  4E71 A;  3UIP B;  1Z2M A;  5G55 A;  1UZX B;  3KUC B;  3APF A;  2HD5 B;  1OEY A;  2GBJ A;  5L83 A;  4BOZ B;  3TCA A;  5CHW A;  3ZIM A;  2VRR B;  3HIZ A;  4AOF A;  3L0W B;  4DHJ B;  3QHT A;  2MBO A;  4LJO B;  3HK0 A;  4MDK E;  1E8Z A;  2NS5 A;  3DBS A;  3Q3F A;  4M8N A;  3A9J A;  1TTN A;  3CSF A;  2KTR A;  1RFA A;  2D10 A;  4NAW A;  3P2B A;  1BT0 A;  2OOB B;  4FUL A;  3RZF A;  3GOE A;  1GNU A;  3UGB B;  3VDZ A;  2ZJD A;  4W9C A;  3ZO5 B;  3L17 A;  3APD A;  2EMS A;  3T9L A;  1K8R B;  3NHE B;  3UF8 A;  3MTN B;  5AZH A;  3ML8 A;  1C1Y B;  1E8Y A;  2A4Z A;  3PS6 A;  1E5W A;  3U8Z A;  2WX1 A;  3PVL A;  2K39 A;  3ALB A;  1P3Q U;  5JH5 C;  1AAR A;  4I6N B;  1Q0W B;  2PE9 A;  3VTU A;  3R7Q A;  2KN5 A;  2JWZ A;  4F8C B;  1ISN A;  4GMV A;  1YIW A;  2FCQ A;  1V5T A;  2N1V A;  2KDF B;  3UQA A;  4ASW C;  3OJ3 A;  3T8M A;  5DPR A;  2HTH A;  2DZK A;  2XBB C;  2C7M B;  2LGY A;  2BWE S;  4BFR A;  4URK A;  2NR2 A;  2IO2 B;  2V3S A;  1HE8 A;  2KWV B;  2GBN A;  3AUL A;  5D2M B;  2KQS A;  4XC2 A;  5C23 A;  5HKH A;  4HVB A;  2MBE A;  4PS3 A;  3RUL A;  1TBE A;  2NPT B;  2XK5 B;  4GXB A;  5AEK B;  2J7Q B;  2KDE B;  4A20 A;  3PPA A;  4AP4 C;  1LXD A;  1P0R A;  3VH3 B;  3ZW3 A;  2Z59 B;  1NI2 A;  1WMH A;  3U7D A;  3ZKJ C;  4X57 B;  3VH4 B;  2KK8 A;  4G11 A;  2C5L C;  2G3Q B;  2CHW A;  2WYQ A;  1WJN A;  1RRB A;  2UWQ A;  4II2 B;  1U4A A;  2M8S A;  4HPL B;  4FLH A;  1WR6 E;  3QAR A;  4TKN A;  3B1L X;  1MG8 A;  5DPT A;  1EUV B;  2W9N A;  3OJ4 B;  2IZV B;  2K8B A;  2NBV B;  3TIX A;  4EEW A;  4JL9 A;  2JF5 A;  1ZW7 A;  3L10 B;  4MJS B;  2KXJ A;  3DQV A;  4JIO U;  2GBR A;  5LXI B;  2N7E A;  3EFU A;  3A4S C;  4DWF A;  1UD7 A;  3ZNZ B;  3X23 A;  3H7S A;  2L76 A;  4ZRI A;  2V1Y A;  2IO1 B;  3DVG X;  1V49 A;  2KVR A;  3IBE A;  3QCA A;  1WGH A;  2MP2 A;  2MSE D;  5JZE B;  1ZKH A;  1YX6 B;  2REX A;  4PYU A;  3ZNG C;  2BPS A;  3QAQ A;  4GIV A;  4XZ4 A;  2NBW B;  2M17 A;  1D3Z A;  2FCN A;  3A1Q B;  3ENE A;  2C7H A;  3UIO B;  4ANX A;  1UBQ A;  1WE6 A;  2MBQ A;  4TV3 A;  1FXT B;  4EZL A;  4W9I A;  2LAS A;  2M0X A;  3B0A A;  3VUY A;  4BOS C;  1WFY A;  1KJT A;  3V6C B;  4EKU A;  4N9F 4;  3K9P B;  4WWN A;  1GJZ A;  3MJW A;  2IO0 B;  5JHA A;  5E6P A;  2LVQ A;  4BVU C;  1WF9 A;  5E6N A;  4GDK B;  1WR1 A;  1WIA A;  3ZNI D;  2MW5 A;  1SGH A;  2IO3 B;  5J17 A;  4IM3 A;  1L7Y A;  2CU1 A;  2K6Q A;  2LGD A;  3M95 A;  4KDI C;  4MSQ B;  1A5R A;  1I35 A;  1E7U A;  4KZC A;  2PPH A;  4NJ7 A;  1LFD A;  4FHJ A;  2KAN A;  2DAF A;  3EEC A;  3WAP A;  3ML9 A;  3QA8 A;  4K7U A;  4LCD E;  3SD5 A;  4DHJ D;  5TR5 A;  3A9K B;  4DXA B;  3AXC A;  3OAW A;  1R4N I;  3SDL C;  2I1J A;  2KTF A;  2ASQ A;  2MA9 B;  4GDL B;  1R4M I;  4EUT A;  2G4D B;  3DPD A;  3S2A A;  2N9P C;  1GC6 A;  3PT2 B;  2N1W A;  2NPT A;  2XK5 A;  3WA0 A;  2JT4 B;  3WAL A;  2CKH B;  2KJ6 A;  4K7W A;  4A3O A;  2FID A;  3K9O B;  1C3T A;  2RD0 A;  4OVU A;  4CYE A;  2D3G A;  1WZ3 A;  4KVG B;  4GGQ A;  4RMA A;  3WIM A;  1WX7 A;  4IWO A;  4RM9 A;  2L05 A;  3N30 A;  4WQO B;  2WDT B;  1WJ4 A;  4ICU A;  2FCS A;  2I1K A;  3I3T B;  2KQ7 A;  2LVP A;  2ZPY A;  5EDS A;  3VTW A;  1H4R A;  2C7N B;  2Z0D B;  3UIN B;  1Y8R C;  2C60 A;  3H9D A;  3ZRC A;  1QZE A;  2ZVO A;  4MM3 A;  2WWZ A;  5G2N A;  4LJP B;  4AJW A;  2GMI C;  4HDO A;  2UYZ B;  4HDQ A;  5D7G A;  2JPH A;  2GOW A;  1OTR B;  2BYV E;  2KLC A;  3VTV A;  4MJS A;  2K8H A;  2FNJ B;  3IG3 A;  4JGH B;  3PSE B;  4WAA A;  1VD2 A;  3ZRF A;  5KHQ A;  3PTF C;  1WE7 A;  2AEH A;  2JVC A;  2K25 A;  4HJK A;  4E3C A;  3M63 B;  3Q3J A;  5CHV C;  4E74 A;  3NS8 A;  5D6J B;  2GBM A;  3ZNH B;  4BKG A;  1V9J A;  1E90 A;  2WX0 A;  4IG7 B;  3PZD A;  5BO4 B;  1WI0 A;  4ZRJ A;  3A1Q A;  4DHZ B;  4MGI E;  2Y5B B;  4JLC A;  2KLG A;  3RCZ A;  3HHM A;  1GG3 A;  5E6O A;  1S1Q B;  4WJN A;  2DYM A;  1TGZ B;  4LDT D;  4NQL B;  1KLV A;  2O6V D;  4II3 B;  4W9E A;  5GMV A;  4MGY E;  4CO7 A;  4LDT B;  4BBN F;  2O6V B;  2LD9 A;  2LI5 A;  2C9W B;  4AUQ C;  4TUU A;  3WAO A;  4BBN C;  2IYD B;  4IM0 A;  2K6D B;  4NY0 A;  5DCN A;  2BF8 B;  1V5O A;  2RSU A;  1E7V A;  4GDK A;  3EHV A;  3NOB A;  2N9E B;  2ZNV B;  4KSK C;  1LQB A;  1WJ6 A;  4IM2 A;  1P1A A;  1UEL A;  3N32 A;  4FJY A;  5C1Z A;  1WGG A;  2K8C A;  2JZZ A;  3QX1 A;  1YQB A;  4HPM B;  2IY1 B;  4KV2 A;  2JXX A;  4GN1 A;  4W9H A;  5IA7 A;  3A9J B;  5J18 A;  4KIK A;  4I6L B;  5LLI A;  2NBU A;  3HM6 X;  1WGD A;  1WZ0 A;  4DDI D;  2KO3 A;  5CTR C;  3VFK A;  3VHT C;  1JRU A;  4ANU A;  3A9K A;  2DZM A;  2ZZP B;  1E8W A;  3N3K B;  2BKR B;  2LXA A;  3PRM B;  4KDL B;  3DDC B;  4GDL A;  2G4S A;  1EF1 A;  2D07 B;  3QWZ B;  3DOW A;  4IWP A;  4W9J A;  4F1S A;  1NBF C;  1WRD B;  1WX8 A;  5J2R A;  3SHQ A;  4HCP B;  4PS8 A;  5D94 A;  2KFK B;  3VAW A;  1P98 A;  1TZ1 A;  1YD8 U;  3M3J A;  3PLV A;  1OEY J;  2BYE A;  2D2Q A;  2IY0 B;  2LZ6 A;  3A4R A;  3M62 B;  3PHX B;  3JYU A;  3QK0 A;  4TQ0 A;  3NY5 A;  3KYC D;  3PRP B;  2L0T A;  2KZR A;  3ONS A;  1GC7 A;  1WXM A;  2Z0E B;  1WM2 A;  2A5U A;  2EKE C;  2LGX A;  2MLB A;  2HE7 A;  3JW0 X;  2J0K A;  1WYW B;  2KWC A;  3BIN A;  4K7S A;  1RLF A;  2ZPN A;  3DVN U;  2RGF A;  1SIF A;  1YX5 B;  2J0J A;  2KWU B;  4HK2 A;  1I42 A;  5IAA C;  3R7R A;  2RPQ A;  5DPW A;  1EO6 A;  2KJR A;  4ANW A;  3AU4 A;  4FHK A;  1Q1O A;  2FUH B;  2KMC A;  2R2O A;  4W9D A;  2O2V B;  1EF5 A;  3TL5 A;  4WJQ A;  3V62 A;  2V4L A;  2DEN B;  4BKS D;  3APC A;  2DHZ A;  4NQK E;  5FR6 A;  4KSL C;  4FJV B;  1Q5W B;  2AL3 A;  2BWF A;  2FAZ A;  3C0R B;  5AZF A;  4MGK E;  4WJO A;  5L95 C;  3D32 A;  2DYB A;  4GB9 A;  4FJZ A;  1V86 A;  2JY6 A;  1Z5S B;  4NJ6 A;  2KC2 A;  3PGE A;  2KHW B;  2O6V A;  2YLM A;  3V61 A;  3VQI A;  3V6E B;  3AU5 A;  4I6P A;  4GU2 A;  3VXW A;  4HLE A;  2JZ3 B;  1IPG A;  4HCN B;  4W9K A;  3A33 B;  4FA6 A;  2KC1 A;  4EOY A;  4FBJ B;  2BGF A;  3WAM A;  2KOX A;  4W9G A;  3H6N A;  4RM8 A;  3L08 A;  2AWT A;  3QQ8 B;  1WXV A;  3R66 C;  4ICV A;  2AYO B;  2KD0 A;  4MH0 E;  4GSW A;  2DX5 B;  2PE6 B;  2DZI A;  4ZDV A;  2PEA A;  5KHO A;  4FN2 A;  1M94 A;  2MP2 B;  2KX0 A;  4AWJ A;  3H7P B;  3TBL D;  2L00 B;  4IWQ A;  4B9K A;  3QJZ A;  4XX5 A;  3VUW A;  3ZTC A;  1XQQ A;  2M1M A;  4WWO A;  4BKT A;  2DAJ A;  1KM7 A;  1WXA A;  5AZG A;  3B08 A;  5JHB A;  4IUM B;  2G45 B;  4W9F A;  2L8J A;  3OLM D;  2DYO A;  4K1R B;  1ZGU B;  4M8M A;  4K81 A;  3X0W A;  3NZS A;  1T0Y A;  2MQJ A;  4PS7 A;  3IHP C;  1OQY A;  2LRW A;  2ZVN A;  1WM3 A;  2NVU I;  3JSV B;  3PV1 A;  4MEL A;  2KFK A;  4ZRK A;  3SU8 X;  1F9J A;  3L16 A;  4G50 A;  2HJ8 A;  2PJH A;  4MGZ E;  3U30 A;  3ZLZ A;  4AJY B;  2EMT A;  3NZU A;  2JUO A;  3KUZ A;  3KYD D;  1WXS A;  4J6I A;  3RUI B;  3W1S C;  3DBR I;  2CS4 A;  1V6E A;  2RR9 A;  1S3S G;  4MEM A;  1J8C A;  3RT3 B;  5LXH A;  1IP9 A;  2ZCB A;  3TJP A;  4IC7 B;  2JRI B;  2KDI A;  4B95 A;  4FAD A;  1J0G A;  2LVO A;  1CMX B;  3KVF B;  1PQS A;  4TQ1 A;  3TMP B;  2CHX A;  2B3A A;  1GUA B;  1UGM A;  3RZW C;  4WWP A;  2OJR A;  1YJ1 A;  2ZEQ A;  2M4N A;  3PRE A;  3LJ3 A;  3QIJ A;  2N9X A;  2KMA A;  1KOT A;  2KJH B;  4NPN A;  2O2V A;  3ZTD A;  2J0M A; 
#chains in the Genus database with same CATH topology
 4ZRQ A;  4M0W B;  1XT9 B;  2W55 A;  3IAS 1;  3H1U A;  1RM6 C;  2WP9 B;  4CHK A;  2BKF A;  3HRD D;  3BY4 B;  3VVW B;  2ZNV C;  2CHZ A;  3EC8 A;  4M01 A;  2QJL A;  1WGR A;  2K22 A;  1XLO A;  3DVG Y;  1WXQ A;  1IUE A;  3W1Y A;  3CMM B;  1OGW A;  3RYT A;  4ANV A;  3AEA B;  2KX3 A;  1V2Y A;  2DZJ A;  4F7Z A;  2N7D A;  1MPE A;  4PT5 A;  1J19 A;  3H7P A;  2L0F A;  3W1S A;  1G6J A;  3P63 A;  2WU5 B;  3CST A;  4P16 A;  2LXC A;  2NMQ A;  1HTQ A;  1IBX B;  2M56 B;  1N62 A;  1TKY A;  1N63 A;  1JWB D;  1R7S A;  4YXD B;  1L6U A;  3MHS D;  1JRO A;  2NCN A;  3P4R B;  2V0G A;  4OVV A;  5CX3 A;  2CR5 A;  4US9 A;  2K1F A;  3DVN V;  3VUX A;  2WLB A;  2QEJ C;  4USA A;  3ZUN A;  3HM3 A;  3L54 A;  1E10 A;  4WWM A;  5T8I A;  4C80 A;  1L4Z B;  4BOZ B;  5CHW A;  2VRR B;  3MC8 A;  1TTN A;  2J53 A;  4WQM A;  5BYR A;  5IO9 A;  1RFA A;  1EM7 A;  3P2B A;  2JYE A;  2OOB B;  3GE8 C;  3N1X C;  3GOE A;  1WRI A;  4W9C A;  3L17 A;  2EMS A;  5AUI A;  3NHE B;  3UF8 A;  1L5P A;  2A4Z A;  2N7J A;  1K51 A;  3PVL A;  1FRD A;  3IT6 B;  2K39 A;  4I6N B;  1AW7 A;  4YSZ B;  3KQ4 A;  1HA5 A;  2RDH A;  3UQA A;  5DPR A;  2HTH A;  3E56 A;  2DZK A;  2E3T A;  2LGY A;  3AE3 B;  4BFR A;  3NRZ A;  3DHI C;  2QDF A;  1HE8 A;  2GBN A;  3Q14 C;  4HEA 1;  4HVB A;  4PS3 A;  1YQ3 B;  1FRR A;  3RUL A;  4N59 A;  1TBE A;  2XK5 B;  5IKC M;  3PPA A;  1LXD A;  4TMA B;  2Z59 B;  1C4C A;  3ZKJ C;  5EE0 A;  3W9C B;  3DWM A;  2XN9 C;  2CHW A;  1RRB A;  3FIL B;  1U4A A;  3BVG A;  4FLH A;  3QAR A;  3B1L X;  3RFZ B;  2J52 A;  2W9N A;  3OJ4 B;  2WDR B;  1FPY A;  3TIX A;  4EEW A;  4JL9 A;  4MJS B;  1SBB B;  5LXI B;  4RGO S;  3EFU A;  3URY A;  1AN8 A;  1UD7 A;  3ZNZ B;  3H7S A;  4ZRI A;  1PDX A;  3DVG X;  1QT9 A;  1V49 A;  4RFB A;  1WGH A;  2MP2 A;  5G5G A;  5JZE B;  1ZKH A;  1CK1 A;  3QAQ A;  1SIJ A;  2NBW B;  4S0R A;  1PGA A;  3ENE A;  1UBQ A;  1WE6 A;  1TT5 B;  4KKI A;  2WHI A;  2M0X A;  4BOS C;  1M4V A;  1WFY A;  4H2A A;  4N9F 4;  5FK9 C;  1GJZ A;  3MJW A;  2IO0 B;  2PVG C;  4O1N A;  5E6N A;  2QC8 A;  2IO3 B;  3RI7 C;  1K50 A;  2K3U A;  1L7Y A;  2CU1 A;  2K6Q A;  3M95 A;  1GOZ A;  2PPH A;  1JRP A;  1R4M B;  4L2Y A;  4LCD E;  1XLQ A;  3SDL C;  2SEB D;  4JWS C;  4EUT A;  3DPD A;  1TS5 A;  3WA0 A;  2JT4 B;  3WAL A;  2CKH B;  1A70 A;  1C3T A;  2BS3 B;  4OVU A;  4CYE A;  4RMA A;  4GGQ A;  4YT0 B;  3WIM A;  1V1P B;  5FKA C;  2I1K A;  1JQ4 A;  2KMM A;  1H4R A;  2C7N B;  3UIN B;  1Y8R C;  1EWY C;  5G2N A;  2HJ1 A;  2JPH A;  3RN9 C;  1LGR A;  2KN4 A;  2GOW A;  3ZGZ A;  2K8H A;  3IG3 A;  4WAA A;  5KHQ A;  1WE7 A;  4HJK A;  2JVC A;  3AED B;  1DOX A;  4A90 A;  1E90 A;  2MHJ A;  1ESF A;  5BO4 B;  1WSP A;  1E9M A;  4OHJ A;  3RCZ A;  2HDE A;  4WJN A;  1KLV A;  4LDT D;  2EKI A;  4W9E A;  5GMV A;  4ZRP A;  1SEB D;  4NY0 A;  5DCN A;  2ACZ B;  2RSU A;  4GDK A;  3NOB A;  2N9E B;  4KSK C;  1P1A A;  2JSV X;  2JZZ A;  2LJI A;  1YQB A;  3QX1 A;  4HPM B;  2J4X A;  2JXX A;  3A9J B;  1TY0 A;  3TEW A;  3HM6 X;  1WGD A;  3DHH C;  4DDI D;  3W5V B;  4ANU A;  1E8W A;  4L23 A;  3PRM B;  4KDL B;  3DDC B;  3EGR A;  4GDL A;  1Y56 A;  3QWZ B;  2BBC A;  3RNB C;  3M3J A;  2BYE A;  3QK0 A;  4TQ0 A;  2WXR A;  3PRP B;  2KZR A;  2LUM A;  2A5U A;  1DOY A;  4TSS A;  3JW0 X;  2J0K A;  2KWC A;  3BIN A;  4K7S A;  2ZPN A;  2J0J A;  5IAA C;  3R2T A;  1E6E B;  1EO6 A;  2FUH B;  3WCQ A;  1QF6 A;  4LTU A;  2R2O A;  4W9D A;  3AH7 A;  4WJQ A;  2ONQ A;  2V4L A;  3V62 A;  3P1M A;  1CQV A;  2DHZ A;  3N1Y C;  2AL3 A;  2BWF A;  3C0R B;  4WIP A;  4MGK E;  3D32 A;  4LNO A;  2R61 A;  4GB9 A;  1V86 A;  1SXT A;  1TKG A;  4L1B A;  4I6P A;  4NAM A;  5EE9 A;  4HLE A;  1UNS A;  1UWX A;  4ZHP A;  3AV8 A;  4QAY A;  3AEG B;  3WAM A;  2AYO B;  2DX5 B;  2PEA A;  5KHO A;  4FN2 A;  1M94 A;  3RPF C;  2L00 B;  3VUW A;  1XQQ A;  2W3S A;  2DAJ A;  4A8X C;  2BB5 A;  1KM7 A;  1F52 A;  5JHB A;  2G45 B;  1ZGU B;  2PLP A;  1T0Y A;  1KH0 A;  4MEL A;  3OWE B;  3PV1 A;  4P1B C;  4KGS A;  2EMT A;  4K3C A;  1RYJ A;  3KUZ A;  2D3A A;  2XNA C;  1BUI C;  1FNU A;  1J8C A;  1JWA D;  1J0G A;  2JRI B;  2KDI A;  1PQS A;  3TMP B;  1DGJ A;  2CHX A;  3I57 A;  1GUA B;  1UGM A;  3RZW C;  2M4N A;  2LGI A;  2N9X A;  2KMA A;  1KOT A;  3Q3O C;  3SFE B;  3ZTD A;  4NJC A;  2KTR B;  3KUD B;  4NAW B;  4WJP A;  3GZN I;  1T0S C;  4LNK A;  3AI5 A;  3L4P A;  4KZ0 A;  3IFW B;  3ECI A;  3I63 C;  3L13 A;  3Q3M C;  2QHO A;  4Q2J A;  4W9L A;  1FIQ A;  1E8X A;  4MM3 B;  3DCG A;  3I9V 1;  5C2T B;  3BK1 A;  1PGB A;  3KW5 B;  3VR9 B;  2SAK A;  3JVZ X;  1IYF A;  3DBH B;  2LUE A;  3O13 A;  3Q8B A;  2GBK A;  2R2Q A;  3WAN A;  3BK2 A;  4J3O D;  3BVM A;  1PYW D;  2FCM A;  4G0N B;  2HTM E;  3LDZ E;  4JE3 B;  2IBI B;  5HFY A;  1D5M C;  3ZDT A;  1LM8 B;  4IDI A;  1WMH B;  4IOI E;  2L1A A;  4B6W A;  3DBL B;  1NDD A;  1RAX A;  3CF6 E;  4NNJ B;  2D11 A;  4DK5 A;  1V81 A;  3ETR A;  1EU4 A;  1XD3 B;  1ZOY B;  1JAL A;  3O65 B;  3NUH B;  2KKC A;  5E6J A;  3UIP B;  1Z2M A;  5H92 C;  3APF A;  1VJK A;  1UWM A;  3HIZ A;  4AOF A;  3L0W B;  4LJO B;  5D3I B;  4MDK E;  1XO3 A;  3DBS A;  3Q3F A;  4A6Q A;  2M0A A;  1P7E A;  2WU2 B;  2KWD A;  4FUL A;  2ZJD A;  3APD A;  3T9L A;  5AZH A;  1VZ6 A;  1C1Y B;  1E8Y A;  3AB5 A;  5BMI A;  4LNI A;  1C77 A;  1MI0 A;  3ZYY X;  1GAQ B;  2DNF A;  2KN5 A;  5EE1 A;  1MHH E;  5GXG B;  1ISN A;  3AE9 B;  4GMV A;  2N1V A;  1VRA B;  3T8M A;  2BWE S;  1FMA D;  4URK A;  2V3S A;  1J7A A;  3AUL A;  1TIF A;  2KQS A;  3HVZ A;  2NTS A;  2NPT B;  4RCO A;  5AEK B;  1IBX A;  4AP4 C;  1OQQ A;  3VH3 B;  2N0S B;  1C9F A;  3PZ7 A;  4ZHO A;  2V3N A;  3P4S B;  2G3Q B;  3FKY A;  2GB1 A;  1WR6 E;  4TKN A;  1MG8 A;  2K8B A;  2NBV B;  1CJE A;  3BZD B;  1ZW7 A;  3DQV A;  4P1C C;  3A4S C;  4DWF A;  3N1Z C;  2L76 A;  3IBE A;  4CQN A;  1TKE A;  1YX6 B;  1D3Z A;  1YNT E;  3RNA C;  2C7H A;  4OZB A;  1FXA A;  4EZL A;  4W9I A;  2LAS A;  3VUY A;  4US8 A;  3P42 A;  1KJT A;  3ZJT A;  4XDC A;  3DHG C;  2LHE A;  2Y5P A;  1WF9 A;  4BVU C;  4DQO C;  4YSY B;  3LXF A;  2WNM A;  4KDI C;  1I35 A;  4NJ7 A;  4FHJ A;  4JPS A;  3KWV A;  4OW0 A;  2K5P A;  3ML9 A;  4K7U A;  2AQ1 B;  3SD5 A;  4DHJ D;  4DXA B;  3OAW A;  2I1J A;  2VZK B;  1R4M I;  1YMH E;  4KKJ A;  5LNK 1;  2XK5 A;  3Q8A A;  2KJ6 A;  4KX6 B;  3Q8E A;  2FID A;  2RD0 A;  1XLP A;  2PKO A;  4KVG B;  3MC0 B;  3DWG C;  4YTN B;  2WDT B;  2JX5 A;  1F2R I;  1QZE A;  1DOI A;  4IKG A;  3TSS A;  3NVZ A;  1OTR B;  2BYV E;  2KLC A;  4MJS A;  2FNJ B;  4YSX B;  4HRO A;  2AEH A;  1F2R C;  3M63 B;  5CHV C;  1KLG D;  3NS8 A;  2JQR B;  4RF1 A;  2DWQ A;  4LNF A;  1L4D B;  3PZD A;  1WI0 A;  3MC9 A;  4DHZ B;  1VLB A;  2KLG A;  3ZXV A;  5E6O A;  4A9A A;  4NQL B;  2TSS A;  4FXC A;  2BTE A;  2O6V B;  2LD9 A;  2W3R A;  2C9W B;  4NZL B;  1NYQ A;  3B9J A;  2BF8 B;  1BXT A;  2V9H A;  4OVZ A;  1LO5 D;  1V5O A;  1E7V A;  1ROE A;  4JX1 C;  2ZNV B;  1LQB A;  1UEL A;  4FJY A;  3Q8F A;  4KIK A;  2X8X X;  2ZW0 A;  2KO3 A;  1YOV B;  2DZM A;  4XWW A;  1B9R A;  3N3K B;  2G4S A;  3R2I A;  3DOW A;  4IWP A;  1NBF C;  1WRD B;  5HG2 A;  3AE2 B;  3SHQ A;  4HCP B;  5D94 A;  2KFK B;  3VAW A;  3N9Y C;  3PHX B;  2RPV A;  3V3X A;  3KYC D;  1V1P A;  1GC7 A;  1SE2 A;  1WM2 A;  2LGX A;  1RLF A;  2OHF A;  1SIF A;  4HK2 A;  1QIL A;  1FCC C;  1KF6 B;  2RPQ A;  2KJR A;  3AU4 A;  4FHK A;  1TS2 A;  1F0Z A;  3APC A;  5FR6 A;  1UUP A;  5AZF A;  2FAZ A;  2L83 A;  4RF0 A;  4WJO A;  1WGK A;  1JML A;  4S17 A;  2JY6 A;  2W82 A;  4NJ6 A;  4ACF A;  3PGE A;  2YLM A;  1PFD A;  3V61 A;  3AU5 A;  2QIL A;  2JZ3 B;  4W9K A;  3A33 B;  4D2K A;  2BGF A;  2KAC A;  3VRA B;  4RM8 A;  4GSW A;  1C78 A;  2G9H D;  2MP2 B;  4B9K A;  2KAJ A;  4BKT A;  2L8J A;  2DYO A;  3IHP C;  1OQY A;  1E7P B;  1WM3 A;  3JSV B;  3SU8 X;  3KWL A;  3L16 A;  4G50 A;  2PJH A;  1SB3 C;  4AJY B;  4J6I A;  1WXS A;  3RUI B;  1FFV A;  3AE4 B;  4MEM A;  1NEN B;  1SE3 A;  3MP9 A;  1QOA A;  1IP9 A;  2ZCB A;  4IC7 B;  1TS4 A;  4B95 A;  4TQ1 A;  4N58 A;  2WXK A;  2AX5 A;  4WWP A;  3HUI A;  1YJ1 A;  2ZEQ A;  1K53 A;  1XCQ L;  1N6Z A;  1D4B A;  3LJ3 A;  2LHD A;  2KJH B;  1YN3 A;  2KVZ A;  1ZP0 B;  4YL8 A;  1HZ5 A;  4HWI B;  4HKQ A;  1C76 A;  1L2N A;  3PHW B;  1XF5 L;  1FNW A;  2KDB A;  3VRB B;  2PW9 A;  2WS3 B;  1N5X A;  3NVY A;  1K52 A;  1VCB A;  3R3M A;  1UBI A;  3ZVV A;  4JQW C;  3GP7 A;  2MWS B;  1EWC A;  4EZJ A;  4G3X B;  5IP4 D;  2BYF A;  2LRU A;  2XEW A;  2KFJ A;  2ZW1 A;  3U2S C;  3AE8 B;  3IVF A;  4DBG A;  3PRZ A;  2MRP A;  3DBH I;  1D5X C;  4XWT A;  4PYZ A;  4M00 A;  3RD2 A;  1YJI A;  2BS2 B;  3FAH A;  1WY8 A;  2LJ5 A;  1L0Y B;  2FIF A;  4AS1 A;  1MFW A;  2N4F A;  1JW9 D;  2D3B A;  1WGY A;  2INC C;  4HPP A;  4RH6 A;  5DPS A;  2ZCC A;  4GOC A;  2L7R A;  1FO4 A;  1N5W A;  1H8C A;  1P9D U;  2NTT A;  2MH7 A;  3DBL I;  1X1M A;  1WH3 A;  1WJU A;  3V60 A;  3UQB A;  1AWD A;  3ZJU A;  2FBW B;  1UZX B;  3IT4 B;  2HD5 B;  3GB1 A;  2GBJ A;  4R3D A;  3V05 A;  3N20 C;  2OED A;  3KLS X;  3TCA A;  3ZIM A;  2K0P A;  3QHT A;  2MBO A;  1E8Z A;  4GLS C;  3CSF A;  2V4I B;  2KTR A;  2D10 A;  4NAW A;  3NVW A;  3B2F A;  2KYW A;  3VDZ A;  3CWI A;  3ZO5 B;  1K8R B;  3ML8 A;  2D3C A;  1SJE D;  3PS6 A;  1E5W A;  3U8Z A;  1XLN A;  5AUK A;  3ALB A;  1Q0W B;  3RNF C;  3AE6 B;  2PE9 A;  3VTU A;  3R7Q A;  2K9X A;  4F8C B;  1V5T A;  4ASW C;  3OJ3 A;  2XBB C;  2C7M B;  2KQ4 X;  3CIR B;  1C4A A;  5D2M B;  5C23 A;  2MBE A;  4DXG A;  4GXB A;  2OJW A;  4A20 A;  2KDE B;  2RDG A;  2LFI A;  1WMH A;  3AMZ A;  1V97 A;  4X57 B;  3VH4 B;  1VZ8 A;  4G11 A;  2C5L C;  1WJN A;  4AQ7 A;  4II2 B;  4LK0 M;  4HPL B;  1QOG A;  5DPT A;  1EUV B;  1PGX A;  2W54 A;  2JF5 A;  3L10 B;  2KXJ A;  3Q2A C;  4JIO U;  2GBR A;  2N7E A;  2JU6 X;  3X23 A;  2KVR A;  4ZYS A;  3QCA A;  2MSE D;  2REX A;  3BYT B;  2BPS A;  4XZ4 A;  3ZNG C;  2M17 A;  2WXF A;  3A1Q B;  4ANX A;  2MBQ A;  4TV3 A;  2AQ2 B;  3BVZ A;  1I4H A;  3V6C B;  5BYS A;  1FFU A;  3J9C A;  1IGD A;  1T5X D;  1WR1 A;  1WIA A;  5HHD G;  2MW5 A;  1SGH A;  2Y3A A;  1AYF A;  1STE A;  4WUR A;  1J7B A;  2LGD A;  4MSQ B;  1A5R A;  1T6B X;  1LFD A;  2CJN A;  1R4N B;  2G1E A;  2CU3 A;  3AEC B;  3BWU D;  3QA8 A;  2WXM A;  2VZK D;  3A9K B;  2KTF A;  1UF0 A;  2ASQ A;  1UGJ A;  3BYY B;  1FEH A;  2G4D B;  2N9P C;  1TY2 A;  2N1W A;  2NPT A;  3T3O A;  3NG0 A;  1N60 A;  1ZXH A;  4M0W A;  4A3O A;  3I5J C;  3K9O B;  2D3G A;  1WX7 A;  2IDY A;  4IWO A;  4RM9 A;  1ET9 A;  2L05 A;  3N30 A;  1P7F A;  4HRS A;  4WQO B;  2VH1 A;  1WJ4 A;  4UDU C;  3I3T B;  2LVP A;  2ZPY A;  1ZDV A;  5EDS A;  5EE3 A;  3VTW A;  2GRI A;  2Z0D B;  1RFK A;  2C60 A;  3H9D A;  3ZRC A;  1I7H A;  2ZVO A;  2UU7 A;  4LJP B;  4AJW A;  2GMI C;  4HDO A;  5D7G A;  3VTV A;  4JGH B;  1C79 A;  2K25 A;  4E3C A;  2N9K A;  5D6J B;  3ZNH B;  4BZA A;  1BML C;  2WX0 A;  1YJJ A;  1T3Q A;  5C3J B;  4JLC A;  1S1Q B;  2DYM A;  2O6V D;  4II3 B;  5I4D A;  4BBN F;  2LI5 A;  2Y5C A;  4BBN C;  2IYD B;  4IM0 A;  4B0E A;  2N9L A;  4HKZ E;  1FD6 A;  1WJ6 A;  4IM2 A;  3Q69 A;  2LMC A;  2K8C A;  2IY1 B;  4KV2 A;  1I4R A;  4GN1 A;  4W9H A;  1TJE A;  1JWU D;  3MFG A;  2BQQ A;  5CTR C;  3VFK A;  4YWG G;  2BKR B;  2LXA A;  1EF1 A;  1WX8 A;  5J2R A;  2Q5W D;  4RGN A;  4XGA B;  1P98 A;  1TZ1 A;  1YD8 U;  3MJ5 A;  4RGT A;  2D2Q A;  2LZ6 A;  3M62 B;  2YEP B;  2JWU A;  1QQR A;  3JYU A;  1GB4 A;  2D5G A;  4YTM B;  3ONS A;  1V8C A;  1WXM A;  1JWM D;  1TS3 A;  2GI9 A;  2HE7 A;  1WWT A;  2RGF A;  1YX5 B;  2KWU B;  1GPX A;  2RMM A;  4C4V B;  3RNC C;  5DPW A;  1TZO A;  1Q1O A;  2KMC A;  3C8Y A;  2BVC A;  1I4Q A;  2O2V B;  3TL5 A;  4PK1 A;  4BKS D;  4NQK E;  4KSL C;  3NVV A;  3EUB 2;  3UI3 A;  2LGS A;  5L95 C;  4ARC A;  4KGT A;  2DYB A;  4XYC A;  1I4X A;  5BMH A;  2KHW B;  2O6V A;  3VQI A;  3V6E B;  4RGM A;  4GU2 A;  3VXW A;  2KC1 A;  4ITK A;  2MJE A;  2KOX A;  4W9G A;  3H6N A;  3L08 A;  4JWU C;  2AWT A;  3R66 C;  3FIL A;  4ICV A;  2KD0 A;  2WXI A;  2PE6 B;  5H8Y E;  4C00 A;  1DYQ A;  2KX0 A;  4AWJ A;  3H7P B;  3LYY A;  3AEE B;  1ZE3 D;  2M1M A;  1WXA A;  4IUM B;  5TSS A;  3X0W A;  3NZS A;  1VDV A;  2MQJ A;  2PTL A;  1KTK A;  3P4P B;  2KFK A;  1F9J A;  3DBR B;  4WH4 A;  3ZLZ A;  2HJ8 A;  4MGZ E;  1HZ6 A;  2JUO A;  1HEZ E;  3ZXR A;  2WXL A;  3SR6 A;  2RR9 A;  1S3S G;  2MJ3 A;  5LXH A;  3TJP A;  4FAD A;  2LVO A;  3EFC A;  1CMX B;  2B3A A;  3W2D A;  2OJR A;  2QCZ A;  2H88 B;  1NEK B;  3NS1 A;  4WAF A;  4B0M A;  4NPN A;  1L6V A;  3PLU A;  4MT5 A;  2KDM A;  1D6E C;  4ZYN A;  1D5Z C;  5IOI A;  4BKS A;  1WX9 A;  2LEK A;  5HI1 A;  2FE8 A;  3LB8 C;  4EZK A;  3AEB B;  1CZP A;  4DDG D;  2L32 A;  2L3Z A;  2JRH A;  3AE5 B;  5FR3 A;  2MBH A;  2PVO D;  1UH6 A;  2ICI A;  2WXG A;  4MSM B;  3KH0 A;  1SE9 A;  4IW0 A;  2JYT A;  2AQ3 B;  3ZDM C;  3AE7 B;  5CHF A;  4A3P A;  1V80 A;  2MX2 A;  3JSV A;  3TEY A;  1FCL A;  2MCN B;  1V1O A;  4LNN A;  2LWP A;  4P7I A;  2YVC A;  4EFO A;  2MBB B;  4HXD A;  1QOB A;  1ACC A;  1T0R C;  2AL6 A;  3AEF B;  4KIK B;  4DHZ E;  3QC8 B;  2KNB A;  3T3N A;  1SF0 A;  1VR9 A;  4E71 A;  4A55 A;  5G55 A;  3KUC B;  1OEY A;  5L83 A;  1T0Q C;  1NI3 A;  5BMG A;  1MJD A;  4DHJ B;  2M19 A;  1HQR D;  3HK0 A;  3EA6 A;  2NS5 A;  4M8N A;  3A9J A;  2DLB A;  2QIE B;  1BT0 A;  3RZF A;  3AM9 A;  2RDB C;  1GNU A;  3UGB B;  2IPK D;  2IGH A;  3MTN B;  2V3P A;  4MAC A;  2INP E;  2WX1 A;  4DXF A;  1P3Q U;  5JH5 C;  1AAR A;  3VR8 B;  1XCT L;  1FXI A;  1RWS A;  2JWZ A;  1SE4 A;  3U4E G;  3IXS A;  4EE2 A;  1EU3 A;  1YIW A;  2FCQ A;  1YN5 A;  2KDF B;  1C4P A;  2Z8L A;  4K3B A;  1J7C A;  1FNV A;  2NR2 A;  2IO2 B;  2KWV B;  2L52 A;  4XC2 A;  4P6V F;  5HKH A;  2WXN A;  2J7Q B;  1L0X B;  1P0R A;  3ZW3 A;  1NI2 A;  1ZXI A;  3U7D A;  1ET6 A;  1F77 A;  2KK8 A;  5BYQ A;  3R8B A;  2WYQ A;  2UWQ A;  2FUG 1;  2I38 A;  2M8S A;  1ZPS A;  3ZQ4 A;  2IZV B;  2WXQ A;  4C7Z A;  1KLU D;  4BAX A;  1VZ7 A;  3TEZ A;  4LLG M;  2V1Y A;  2IO1 B;  3PZ8 A;  2BS4 B;  4PYU A;  4GIV A;  2FCN A;  3UIO B;  1FXT B;  1QKZ A;  3RMK C;  3B0A A;  3MHZ A;  2QSD A;  3ABV B;  4EKU A;  3E9S A;  3K9P B;  4WWN A;  3OG5 A;  5JHA A;  1PUT A;  2KT7 A;  5E6P A;  2LVQ A;  4C56 C;  3AE1 B;  4GDK B;  3ZNI D;  2MEK A;  2IND C;  4IM3 A;  5J17 A;  1QLB B;  4KGR A;  3FC4 A;  2PIA A;  1E7U A;  4KZC A;  2KAN A;  1Q10 A;  1YQ4 B;  2DAF A;  5MPO A;  3RNG C;  3EEC A;  2BB6 A;  3WAP A;  1OQR A;  5TR5 A;  3AXC A;  1R4N I;  3Q8C A;  2WDQ B;  4GDL B;  2MA9 B;  3S2A A;  1GC6 A;  3PT2 B;  4M02 A;  1ZUD 2;  4K7W A;  2INN E;  1WZ3 A;  2I2Y A;  4ICU A;  2FCS A;  2KQ7 A;  3NZ3 A;  2J42 A;  3TUO A;  2WXO A;  4MM3 A;  2WWZ A;  1HXY D;  2PMV A;  3HVD A;  2UYZ B;  4HDQ A;  1ZDX A;  2IGG A;  3Q3N C;  4ZOH C;  3PSE B;  1VD2 A;  2DBY A;  3ZRF A;  3PTF C;  3Q3J A;  1WYG A;  4E74 A;  1XXG A;  2GBM A;  2QMT A;  4HJG E;  4BKG A;  1V9J A;  4IG7 B;  3ZJV A;  2VH2 A;  4ZRJ A;  3RNE C;  3A1Q A;  4MGI E;  3PO0 A;  2Y5B B;  2B76 B;  3HHM A;  1GG3 A;  3U52 E;  2MJD A;  3SEB A;  3U7Z A;  1TGZ B;  2BT6 A;  1KRH A;  4MGY E;  4LDT B;  4CO7 A;  4REZ A;  3GE3 C;  4AUQ C;  4TUU A;  3WAO A;  2K6D B;  4RNA A;  1IGC A;  5IN7 A;  1ENF A;  1OFF A;  3EHV A;  2WDV B;  3N32 A;  5C1Z A;  1WGG A;  2GLS A;  4OZA A;  1I4P A;  5IA7 A;  5J18 A;  4I6L B;  5LLI A;  2NBU A;  1TYG B;  2IGD A;  1WZ0 A;  3VHT C;  1JRU A;  3A9K A;  2WGS A;  2WXJ A;  2ZZP B;  1F1H A;  4N6E B;  2D07 B;  4W9J A;  4F1S A;  4PS8 A;  3PLV A;  1OEY J;  2IY0 B;  3A4R A;  3Q6B A;  3NY5 A;  3P4Q B;  2BYT A;  2L0T A;  3SFD B;  2Z0E B;  2EEL A;  2EKE C;  2ON8 A;  5JXV A;  2MLB A;  1WYW B;  3DVN U;  3W5U B;  1I42 A;  3B2G A;  3R7R A;  1GB1 A;  2YEP F;  4ANW A;  1EF5 A;  1KFY B;  1MVK A;  2X38 A;  2DEN B;  1SJH D;  1NVI D;  4OZC A;  1SSN A;  1Q5W B;  1L0V B;  4FJV B;  1YN4 A;  1MG4 A;  4FJZ A;  1Z5S B;  2BW2 A;  1MHX A;  2KC2 A;  1B1Z A;  5G5H A;  1NYR A;  1JCK B;  2CJO A;  1N61 A;  1IPG A;  4HCN B;  5D3D A;  4EOY A;  4FBJ B;  3QQ8 B;  1WXV A;  4MH0 E;  2IJ0 A;  2DZI A;  3TEX A;  3AN1 A;  4ZDV A;  2WXP A;  3C19 A;  3TBL D;  2JXT A;  4IWQ A;  3QJZ A;  4XX5 A;  3ZTC A;  4WWO A;  4YTP B;  5AZG A;  3B08 A;  3BII D;  4W9F A;  1FM0 D;  1QOF A;  3OLM D;  4K1R B;  1HTO A;  4M8M A;  4K81 A;  4PS7 A;  2H89 B;  2LRW A;  2ZVN A;  2NVU I;  1I4G A;  4ZRK A;  2WQY B;  3IAM 1;  3U30 A;  2JZP A;  4ARI A;  3NZU A;  3KYD D;  2WXH A;  3W1S C;  4MH8 A;  3DBR I;  2CS4 A;  1V6E A;  4XE0 A;  3H8H A;  1E0Z A;  1XEE A;  3RT3 B;  4C7Y A;  3NJT A;  3KVF B;  1JWS D;  3GS2 A;  4C4V A;  2E6X A;  3PRE A;  4XDD A;  3QIJ A;  3GZN B;  4FA6 A;  2O2V A;  2J0M A; 
#chains in the Genus database with same CATH homology
 3PLU A;  2KTR B;  4M0W B;  1XT9 B;  4YL8 A;  3KUD B;  4HWI B;  3H1U A;  4NAW B;  4WJP A;  4ZYN A;  3GZN I;  4CHK A;  1L2N A;  2BKF A;  3AI5 A;  1WX9 A;  4BKS A;  4KZ0 A;  3IFW B;  3BY4 B;  3ECI A;  3VVW B;  3PHW B;  2ZNV C;  2CHZ A;  3L13 A;  3EC8 A;  2QHO A;  2KDB A;  4W9L A;  4EZK A;  1WGR A;  1E8X A;  3DCG A;  1VCB A;  3R3M A;  4DDG D;  1UBI A;  2L3Z A;  2JRH A;  3DVG Y;  3ZVV A;  3KW5 B;  4JQW C;  3W1Y A;  3CMM B;  1OGW A;  2MBH A;  3RYT A;  2MWS B;  3JVZ X;  4ANV A;  1UH6 A;  4EZJ A;  1IYF A;  4G3X B;  2KX3 A;  1V2Y A;  2LUE A;  4MSM B;  2DZJ A;  3KH0 A;  4F7Z A;  2N7D A;  2BYF A;  2LRU A;  2XEW A;  2KFJ A;  2GBK A;  1J19 A;  3H7P A;  3IVF A;  2R2Q A;  1SE9 A;  2L0F A;  2MRP A;  3PRZ A;  3W1S A;  3WAN A;  4DBG A;  1G6J A;  3DBH I;  4IW0 A;  2FCM A;  3ZDM C;  4PYZ A;  4G0N B;  3RD2 A;  3CST A;  2LXC A;  5CHF A;  3LDZ E;  4A3P A;  1V80 A;  2IBI B;  2MX2 A;  1WY8 A;  2LJ5 A;  3ZDT A;  1LM8 B;  2FIF A;  3JSV A;  1WMH B;  2MCN B;  2N4F A;  4B6W A;  1WGY A;  5DPS A;  3MHS D;  1NDD A;  1RAX A;  2LWP A;  2ZCC A;  3CF6 E;  4GOC A;  2YVC A;  4NNJ B;  2L7R A;  4P7I A;  4EFO A;  2NCN A;  2D11 A;  2MBB B;  4OVV A;  4DK5 A;  5CX3 A;  1V81 A;  4HXD A;  1H8C A;  1XD3 B;  1P9D U;  2CR5 A;  2K1F A;  3DBL I;  3O65 B;  3DVN V;  1X1M A;  3VUX A;  1WH3 A;  1WJU A;  2AL6 A;  4KIK B;  3V60 A;  4DHZ E;  3UQB A;  3QC8 B;  2KNB A;  3ZUN A;  3HM3 A;  3L54 A;  2KKC A;  4E71 A;  3UIP B;  1Z2M A;  5G55 A;  1UZX B;  3KUC B;  3APF A;  2HD5 B;  1OEY A;  2GBJ A;  5L83 A;  4BOZ B;  3TCA A;  5CHW A;  3ZIM A;  2VRR B;  3HIZ A;  4AOF A;  3L0W B;  4DHJ B;  3QHT A;  2MBO A;  4LJO B;  3HK0 A;  4MDK E;  1E8Z A;  2NS5 A;  3DBS A;  3Q3F A;  4M8N A;  3A9J A;  1TTN A;  3CSF A;  2KTR A;  1RFA A;  2D10 A;  4NAW A;  3P2B A;  1BT0 A;  2OOB B;  4FUL A;  3RZF A;  3GOE A;  1GNU A;  3UGB B;  3VDZ A;  2ZJD A;  4W9C A;  3ZO5 B;  3L17 A;  3APD A;  2EMS A;  3T9L A;  1K8R B;  3NHE B;  3UF8 A;  3MTN B;  5AZH A;  3ML8 A;  1C1Y B;  1E8Y A;  2A4Z A;  3PS6 A;  1E5W A;  3U8Z A;  2WX1 A;  3PVL A;  2K39 A;  3ALB A;  1P3Q U;  5JH5 C;  1AAR A;  4I6N B;  1Q0W B;  2PE9 A;  3VTU A;  3R7Q A;  2KN5 A;  2JWZ A;  4F8C B;  1ISN A;  4GMV A;  1YIW A;  2FCQ A;  1V5T A;  2N1V A;  2KDF B;  3UQA A;  4ASW C;  3OJ3 A;  3T8M A;  5DPR A;  2HTH A;  2DZK A;  2XBB C;  2C7M B;  2LGY A;  2BWE S;  4BFR A;  4URK A;  2NR2 A;  2IO2 B;  2V3S A;  1HE8 A;  2KWV B;  2GBN A;  3AUL A;  5D2M B;  2KQS A;  4XC2 A;  5C23 A;  5HKH A;  4HVB A;  2MBE A;  4PS3 A;  3RUL A;  1TBE A;  2NPT B;  2XK5 B;  4GXB A;  5AEK B;  2J7Q B;  2KDE B;  4A20 A;  3PPA A;  4AP4 C;  1LXD A;  1P0R A;  3VH3 B;  3ZW3 A;  2Z59 B;  1NI2 A;  1WMH A;  3U7D A;  3ZKJ C;  4X57 B;  3VH4 B;  2KK8 A;  4G11 A;  2C5L C;  2G3Q B;  2CHW A;  2WYQ A;  1WJN A;  1RRB A;  2UWQ A;  4II2 B;  1U4A A;  2M8S A;  4HPL B;  4FLH A;  1WR6 E;  3QAR A;  4TKN A;  3B1L X;  1MG8 A;  5DPT A;  1EUV B;  2W9N A;  3OJ4 B;  2IZV B;  2K8B A;  2NBV B;  3TIX A;  4EEW A;  4JL9 A;  2JF5 A;  1ZW7 A;  3L10 B;  4MJS B;  2KXJ A;  3DQV A;  4JIO U;  2GBR A;  5LXI B;  2N7E A;  3EFU A;  3A4S C;  4DWF A;  1UD7 A;  3ZNZ B;  3X23 A;  3H7S A;  2L76 A;  4ZRI A;  2V1Y A;  2IO1 B;  3DVG X;  1V49 A;  2KVR A;  3IBE A;  3QCA A;  1WGH A;  2MP2 A;  2MSE D;  5JZE B;  1ZKH A;  1YX6 B;  2REX A;  4PYU A;  3ZNG C;  2BPS A;  3QAQ A;  4GIV A;  4XZ4 A;  2NBW B;  2M17 A;  1D3Z A;  2FCN A;  3A1Q B;  3ENE A;  2C7H A;  3UIO B;  4ANX A;  1UBQ A;  1WE6 A;  2MBQ A;  4TV3 A;  1FXT B;  4EZL A;  4W9I A;  2LAS A;  2M0X A;  3B0A A;  3VUY A;  4BOS C;  1WFY A;  1KJT A;  3V6C B;  4EKU A;  4N9F 4;  3K9P B;  4WWN A;  1GJZ A;  3MJW A;  2IO0 B;  5JHA A;  5E6P A;  2LVQ A;  4BVU C;  1WF9 A;  5E6N A;  4GDK B;  1WR1 A;  1WIA A;  3ZNI D;  2MW5 A;  1SGH A;  2IO3 B;  5J17 A;  4IM3 A;  1L7Y A;  2CU1 A;  2K6Q A;  2LGD A;  3M95 A;  4KDI C;  4MSQ B;  1A5R A;  1I35 A;  1E7U A;  4KZC A;  2PPH A;  4NJ7 A;  1LFD A;  4FHJ A;  2KAN A;  2DAF A;  3EEC A;  3WAP A;  3ML9 A;  3QA8 A;  4K7U A;  4LCD E;  3SD5 A;  4DHJ D;  5TR5 A;  3A9K B;  4DXA B;  3AXC A;  3OAW A;  1R4N I;  3SDL C;  2I1J A;  2KTF A;  2ASQ A;  2MA9 B;  4GDL B;  1R4M I;  4EUT A;  2G4D B;  3DPD A;  3S2A A;  2N9P C;  1GC6 A;  3PT2 B;  2N1W A;  2NPT A;  2XK5 A;  3WA0 A;  2JT4 B;  3WAL A;  2CKH B;  2KJ6 A;  4K7W A;  4A3O A;  2FID A;  3K9O B;  1C3T A;  2RD0 A;  4OVU A;  4CYE A;  2D3G A;  1WZ3 A;  4KVG B;  4GGQ A;  4RMA A;  3WIM A;  1WX7 A;  4IWO A;  4RM9 A;  2L05 A;  3N30 A;  4WQO B;  2WDT B;  1WJ4 A;  4ICU A;  2FCS A;  2I1K A;  3I3T B;  2KQ7 A;  2LVP A;  2ZPY A;  5EDS A;  3VTW A;  1H4R A;  2C7N B;  2Z0D B;  3UIN B;  1Y8R C;  2C60 A;  3H9D A;  3ZRC A;  1QZE A;  2ZVO A;  4MM3 A;  2WWZ A;  5G2N A;  4LJP B;  4AJW A;  2GMI C;  4HDO A;  2UYZ B;  4HDQ A;  5D7G A;  2JPH A;  2GOW A;  1OTR B;  2BYV E;  2KLC A;  3VTV A;  4MJS A;  2K8H A;  2FNJ B;  3IG3 A;  4JGH B;  3PSE B;  4WAA A;  1VD2 A;  3ZRF A;  5KHQ A;  3PTF C;  1WE7 A;  2AEH A;  2JVC A;  2K25 A;  4HJK A;  4E3C A;  3M63 B;  3Q3J A;  5CHV C;  4E74 A;  3NS8 A;  5D6J B;  2GBM A;  3ZNH B;  4BKG A;  1V9J A;  1E90 A;  2WX0 A;  4IG7 B;  3PZD A;  5BO4 B;  1WI0 A;  4ZRJ A;  3A1Q A;  4DHZ B;  4MGI E;  2Y5B B;  4JLC A;  2KLG A;  3RCZ A;  3HHM A;  1GG3 A;  5E6O A;  1S1Q B;  4WJN A;  2DYM A;  1TGZ B;  4LDT D;  4NQL B;  1KLV A;  2O6V D;  4II3 B;  4W9E A;  5GMV A;  4MGY E;  4CO7 A;  4LDT B;  4BBN F;  2O6V B;  2LD9 A;  2LI5 A;  2C9W B;  4AUQ C;  4TUU A;  3WAO A;  4BBN C;  2IYD B;  4IM0 A;  2K6D B;  4NY0 A;  5DCN A;  2BF8 B;  1V5O A;  2RSU A;  1E7V A;  4GDK A;  3EHV A;  3NOB A;  2N9E B;  2ZNV B;  4KSK C;  1LQB A;  1WJ6 A;  4IM2 A;  1P1A A;  1UEL A;  3N32 A;  4FJY A;  5C1Z A;  1WGG A;  2K8C A;  2JZZ A;  3QX1 A;  1YQB A;  4HPM B;  2IY1 B;  4KV2 A;  2JXX A;  4GN1 A;  4W9H A;  5IA7 A;  3A9J B;  5J18 A;  4KIK A;  4I6L B;  5LLI A;  2NBU A;  3HM6 X;  1WGD A;  1WZ0 A;  4DDI D;  2KO3 A;  5CTR C;  3VFK A;  3VHT C;  1JRU A;  4ANU A;  3A9K A;  2DZM A;  2ZZP B;  1E8W A;  3N3K B;  2BKR B;  2LXA A;  3PRM B;  4KDL B;  3DDC B;  4GDL A;  2G4S A;  1EF1 A;  2D07 B;  3QWZ B;  3DOW A;  4IWP A;  4W9J A;  4F1S A;  1NBF C;  1WRD B;  1WX8 A;  5J2R A;  3SHQ A;  4HCP B;  4PS8 A;  5D94 A;  2KFK B;  3VAW A;  1P98 A;  1TZ1 A;  1YD8 U;  3M3J A;  3PLV A;  1OEY J;  2BYE A;  2D2Q A;  2IY0 B;  2LZ6 A;  3A4R A;  3M62 B;  3PHX B;  3JYU A;  3QK0 A;  4TQ0 A;  3NY5 A;  3KYC D;  3PRP B;  2L0T A;  2KZR A;  3ONS A;  1GC7 A;  1WXM A;  2Z0E B;  1WM2 A;  2A5U A;  2EKE C;  2LGX A;  2MLB A;  2HE7 A;  3JW0 X;  2J0K A;  1WYW B;  2KWC A;  3BIN A;  4K7S A;  1RLF A;  2ZPN A;  3DVN U;  2RGF A;  1SIF A;  1YX5 B;  2J0J A;  2KWU B;  4HK2 A;  1I42 A;  5IAA C;  3R7R A;  2RPQ A;  5DPW A;  1EO6 A;  2KJR A;  4ANW A;  3AU4 A;  4FHK A;  1Q1O A;  2FUH B;  2KMC A;  2R2O A;  4W9D A;  2O2V B;  1EF5 A;  3TL5 A;  4WJQ A;  3V62 A;  2V4L A;  2DEN B;  4BKS D;  3APC A;  2DHZ A;  4NQK E;  5FR6 A;  4KSL C;  4FJV B;  1Q5W B;  2AL3 A;  2BWF A;  2FAZ A;  3C0R B;  5AZF A;  4MGK E;  4WJO A;  5L95 C;  3D32 A;  2DYB A;  4GB9 A;  4FJZ A;  1V86 A;  2JY6 A;  1Z5S B;  4NJ6 A;  2KC2 A;  3PGE A;  2KHW B;  2O6V A;  2YLM A;  3V61 A;  3VQI A;  3V6E B;  3AU5 A;  4I6P A;  4GU2 A;  3VXW A;  4HLE A;  2JZ3 B;  1IPG A;  4HCN B;  4W9K A;  3A33 B;  4FA6 A;  2KC1 A;  4EOY A;  4FBJ B;  2BGF A;  3WAM A;  2KOX A;  4W9G A;  3H6N A;  4RM8 A;  3L08 A;  2AWT A;  3QQ8 B;  1WXV A;  3R66 C;  4ICV A;  2AYO B;  2KD0 A;  4MH0 E;  4GSW A;  2DX5 B;  2PE6 B;  2DZI A;  4ZDV A;  2PEA A;  5KHO A;  4FN2 A;  1M94 A;  2MP2 B;  2KX0 A;  4AWJ A;  3H7P B;  3TBL D;  2L00 B;  4IWQ A;  4B9K A;  3QJZ A;  4XX5 A;  3VUW A;  3ZTC A;  1XQQ A;  2M1M A;  4WWO A;  4BKT A;  2DAJ A;  1KM7 A;  1WXA A;  5AZG A;  3B08 A;  5JHB A;  4IUM B;  2G45 B;  4W9F A;  2L8J A;  3OLM D;  2DYO A;  4K1R B;  1ZGU B;  4M8M A;  4K81 A;  3X0W A;  3NZS A;  1T0Y A;  2MQJ A;  4PS7 A;  3IHP C;  1OQY A;  2LRW A;  2ZVN A;  1WM3 A;  2NVU I;  3JSV B;  3PV1 A;  4MEL A;  2KFK A;  4ZRK A;  3SU8 X;  1F9J A;  3L16 A;  4G50 A;  2HJ8 A;  2PJH A;  4MGZ E;  3U30 A;  3ZLZ A;  4AJY B;  2EMT A;  3NZU A;  2JUO A;  3KUZ A;  3KYD D;  1WXS A;  4J6I A;  3RUI B;  3W1S C;  3DBR I;  2CS4 A;  1V6E A;  2RR9 A;  1S3S G;  4MEM A;  1J8C A;  3RT3 B;  5LXH A;  1IP9 A;  2ZCB A;  3TJP A;  4IC7 B;  2JRI B;  2KDI A;  4B95 A;  4FAD A;  1J0G A;  2LVO A;  1CMX B;  3KVF B;  1PQS A;  4TQ1 A;  3TMP B;  2CHX A;  2B3A A;  1GUA B;  1UGM A;  3RZW C;  4WWP A;  2OJR A;  1YJ1 A;  2ZEQ A;  2M4N A;  3PRE A;  3LJ3 A;  3QIJ A;  2N9X A;  2KMA A;  1KOT A;  2KJH B;  4NPN A;  2O2V A;  3ZTD A;  2J0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...