2KBZA

Nmr structure of protein gp15 of bacteriophage spp1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
QRVKRLLSITNDKHDEYLTEMVPLLVEFAKDECHNPFIDKDGNESIPSGVLIFVAKAAQFYMTNAGLTGRSMDTVSYNFATEIPSTILKKLNPYRKMAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 15 protein (Bacteriophage SPP1 complete nucleotide sequence)
publication title Structure of bacteriophage SPP1 head-to-tail connection reveals mechanism for viral DNA gating
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.150 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2kbzA00
2KBZA
chains in the Genus database with same CATH superfamily
1LOTA 3KIKA 2QHBA 1TXUA 3WHRA 4S1YA 1SB0A 2QMCA 4OTUA 5ID9A 3UIVA 3VQIA 1KW2A 4FIPB 4Z9OA 3A75A 4J2VA 3NVIA 3JRYA 1KXPD 2AJEA 1MUHA 4LUFA 5B5TA 3BPJA 1N5UA 2E0YA 2EFDA 2QM6A 3GA9L 3FNMA 4Z69A 4G03A 1NT2B 4M70B 3G9KD 3A73A 4F5VA 1H9ZA 2DYOA 3M99C 2KBZA 4W4UB 2Z8JA 3MHSB 2NQOA 4TQ0A 5IIHA 3V09A 1IJGA 4LB9A 2XSIA 1MIWA 5DBYA 4NAWB 2XVVA 1UORA 4F5SA 1JNBA 4IW2A 2CKXA 5BPKA 2LQHA 3V03A 2VUEA 2Z8IA 2OZBB 2EFCA 1GNIA 5IFOA 2BXHA 4BY9C 2VDBA 2VUFA 2GUTA 2BXNA 1E7GA 2OT3A 3V08A 2Z8KA 4G04A 4FK5B 3NVMA 3ICXA 2BX8A 3FWCC 1E7CA 2XVQA 2XVWA 1HK5A 3H37A 3LU8A 4GDLB 1TF0A 1FOUA 1MA9A 1MUSA 1J7EA 3B9MA 3GQXA 3LU7A 2XW1A 4LUHA 5HOZA 3WHSA 3MHHB 4ZBKA 4F5TA 4L9QA 2BXGA 1E7HA 3CX9A 4K71A 1AO6A 4ZCGA 4L8UA 3B9LA 1BJ5A 4N0UD 1HK3A 4G01A 1E7IA 1E7EA 1BKEA 2DBXA 4ZC6A 3SIVB 1HK1A 2DYMA 3GQUA 2DBUA 5IIUA 2LXSA 4ZBRA 4PO0A 3PLAA 2I2ZA 2YDFA 4LB2A 5IJFA 1J78A 2BXOA 4FJCB 2EFEA 3NVKA 4GDKB 2NNWA 3KJLA 1KDXA 2EFHA 2XVUA 2BXMA 3LU6A 4OR0A 2BXCA 2DBWA 2LQIA 3WHQA 5FUOA 4I9OA 1GNJA 2XW0A 2KWFA 4ZBQA 4WA6B 2K0NA 4OTTA 3TDLA 2E0XA 4MBEC 4OT2A 3W1SA 1O9XA 2V36A 2AGHB 2DG5A 2BXKA 2I30A 5IJ5A 2BXFA 2BXAA 1E7BA 4DM0A 1H5WA 5IIXA 1HK4A 4IW1A 4HGMB 4K2CA 5GIOA 1VFIA 1MIVA 2JUHA 5GINA 1HK2A 4N3ZA 5ID7A 4F5UA 4N0FD 4DHXB 1BM0A 5DQFA 2XMOA 3NMUA 3FWBC 4HGKA 4JK4A 4EMXA 2BXEA 1MM8A 4C31B 2BXQA 2BXBA 4L9KA 3SQJA 1VZSA 1MIYA 3SIUB 4GG2A 5GIPA 2LOQA 2BXDA 3H3AA 2ROHA 2BXLA 1E7FA 1E7AA 4D7XA 4ZUXV 2BXIA 5D7GA 4TQ1A 3ECPA 5IJEA 5GHKA 1HA2A 2BXPA 3JQZA 1E78A 1LNSA 4GDXA 4BKEA 4LA0A 4E99A 2LXTA
chains in the Genus database with same CATH topology
1LOTA 3KIKA 2QHBA 1TXUA 3WHRA 4S1YA 2QMCA 4OTUA 5ID9A 3UIVA 3VQIA 1KW2A 4FIPB 4Z9OA 3A75A 4J2VA 3NVIA 3JRYA 1KXPD 2AJEA 4LUFA 5B5TA 1N5UA 2E0YA 2EFDA 2QM6A 3GA9L 3FNMA 4Z69A 4G03A 1NT2B 4M70B 3G9KD 3A73A 4F5VA 1H9ZA 2DYOA 3M99C 2KBZA 4W4UB 2Z8JA 3MHSB 2NQOA 4TQ0A 5IIHA 3V09A 1IJGA 4LB9A 2XSIA 1MIWA 5DBYA 4NAWB 2XVVA 1UORA 4F5SA 1JNBA 4IW2A 2CKXA 5BPKA 3V03A 2VUEA 2Z8IA 2OZBB 2EFCA 1GNIA 5IFOA 2BXHA 4BY9C 2VDBA 2VUFA 2BXNA 1E7GA 2OT3A 3V08A 2Z8KA 4G04A 4FK5B 3NVMA 3ICXA 2BX8A 3FWCC 1E7CA 2XVQA 2XVWA 1HK5A 3H37A 3LU8A 4GDLB 1TF0A 1FOUA 1MA9A 1J7EA 3B9MA 3GQXA 3LU7A 2XW1A 4LUHA 5HOZA 3WHSA 3MHHB 4ZBKA 4F5TA 4L9QA 2BXGA 1E7HA 3CX9A 4K71A 1AO6A 4ZCGA 4L8UA 3B9LA 1BJ5A 4N0UD 1HK3A 4G01A 1E7IA 1E7EA 1BKEA 2DBXA 4ZC6A 3SIVB 1HK1A 2DYMA 3GQUA 2DBUA 5IIUA 4ZBRA 4PO0A 3PLAA 2I2ZA 2YDFA 4LB2A 5IJFA 1J78A 2BXOA 4FJCB 2EFEA 3NVKA 4GDKB 2NNWA 3KJLA 2EFHA 2XVUA 2BXMA 3LU6A 4OR0A 2BXCA 2DBWA 3WHQA 5FUOA 1GNJA 2XW0A 4ZBQA 4WA6B 4OTTA 3TDLA 2E0XA 4MBEC 4OT2A 3W1SA 1O9XA 2V36A 2BXKA 2I30A 2DG5A 5IJ5A 2BXFA 2BXAA 1E7BA 1H5WA 5IIXA 1HK4A 4IW1A 4HGMB 4K2CA 5GIOA 1VFIA 1MIVA 2JUHA 5GINA 1HK2A 4N3ZA 5ID7A 4F5UA 4N0FD 4DHXB 1BM0A 5DQFA 2XMOA 3NMUA 3FWBC 4HGKA 4JK4A 4EMXA 2BXEA 4C31B 2BXQA 2BXBA 4L9KA 3SQJA 1VZSA 1MIYA 3SIUB 4GG2A 5GIPA 2LOQA 2BXDA 3H3AA 2ROHA 2BXLA 1E7FA 1E7AA 4ZUXV 2BXIA 5D7GA 4TQ1A 5IJEA 5GHKA 1HA2A 2BXPA 3JQZA 1E78A 1LNSA 4GDXA 4BKEA 4LA0A 4E99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBZ A; 
#chains in the Genus database with same CATH topology
 1LOT A;  3KIK A;  2QHB A;  1TXU A;  3WHR A;  4S1Y A;  1SB0 A;  2QMC A;  4OTU A;  5ID9 A;  3UIV A;  3VQI A;  1KW2 A;  4FIP B;  4Z9O A;  3A75 A;  4J2V A;  3NVI A;  3JRY A;  1KXP D;  2AJE A;  1MUH A;  4LUF A;  5B5T A;  3BPJ A;  1N5U A;  2E0Y A;  2EFD A;  2QM6 A;  3GA9 L;  3FNM A;  4Z69 A;  4G03 A;  1NT2 B;  4M70 B;  3G9K D;  3A73 A;  4F5V A;  1H9Z A;  2DYO A;  3M99 C;  2KBZ A;  4W4U B;  2Z8J A;  3MHS B;  2NQO A;  4TQ0 A;  5IIH A;  3V09 A;  1IJG A;  4LB9 A;  2XSI A;  1MIW A;  5DBY A;  4NAW B;  2XVV A;  1UOR A;  4F5S A;  1JNB A;  4IW2 A;  2CKX A;  5BPK A;  2LQH A;  3V03 A;  2VUE A;  2Z8I A;  2OZB B;  2EFC A;  1GNI A;  5IFO A;  2BXH A;  4BY9 C;  2VDB A;  2VUF A;  2GUT A;  2BXN A;  1E7G A;  2OT3 A;  3V08 A;  2Z8K A;  4G04 A;  4FK5 B;  3NVM A;  3ICX A;  2BX8 A;  3FWC C;  1E7C A;  2XVQ A;  2XVW A;  1HK5 A;  3H37 A;  3LU8 A;  4GDL B;  1TF0 A;  1FOU A;  1MA9 A;  1MUS A;  1J7E A;  3B9M A;  3GQX A;  3LU7 A;  2XW1 A;  4LUH A;  5HOZ A;  3WHS A;  3MHH B;  4ZBK A;  4F5T A;  4L9Q A;  2BXG A;  1E7H A;  3CX9 A;  4K71 A;  1AO6 A;  4ZCG A;  4L8U A;  3B9L A;  1BJ5 A;  4N0U D;  1HK3 A;  4G01 A;  1E7I A;  1E7E A;  1BKE A;  2DBX A;  4ZC6 A;  3SIV B;  1HK1 A;  2DYM A;  3GQU A;  2DBU A;  5IIU A;  2LXS A;  4ZBR A;  4PO0 A;  3PLA A;  2I2Z A;  2YDF A;  4LB2 A;  5IJF A;  1J78 A;  2BXO A;  4FJC B;  2EFE A;  3NVK A;  4GDK B;  2NNW A;  3KJL A;  1KDX A;  2EFH A;  2XVU A;  2BXM A;  3LU6 A;  4OR0 A;  2BXC A;  2DBW A;  2LQI A;  3WHQ A;  5FUO A;  4I9O A;  1GNJ A;  2XW0 A;  2KWF A;  4ZBQ A;  4WA6 B;  2K0N A;  4OTT A;  3TDL A;  2E0X A;  4MBE C;  4OT2 A;  3W1S A;  1O9X A;  2V36 A;  2AGH B;  2DG5 A;  2BXK A;  2I30 A;  5IJ5 A;  2BXF A;  2BXA A;  1E7B A;  4DM0 A;  1H5W A;  5IIX A;  1HK4 A;  4IW1 A;  4HGM B;  4K2C A;  5GIO A;  1VFI A;  1MIV A;  2JUH A;  5GIN A;  1HK2 A;  4N3Z A;  5ID7 A;  4F5U A;  4N0F D;  4DHX B;  1BM0 A;  5DQF A;  2XMO A;  3NMU A;  3FWB C;  4HGK A;  4JK4 A;  4EMX A;  2BXE A;  1MM8 A;  4C31 B;  2BXQ A;  2BXB A;  4L9K A;  3SQJ A;  1VZS A;  1MIY A;  3SIU B;  4GG2 A;  5GIP A;  2LOQ A;  2BXD A;  3H3A A;  2ROH A;  2BXL A;  1E7F A;  1E7A A;  4D7X A;  4ZUX V;  2BXI A;  5D7G A;  4TQ1 A;  3ECP A;  5IJE A;  5GHK A;  1HA2 A;  2BXP A;  3JQZ A;  1E78 A;  1LNS A;  4GDX A;  4BKE A;  4LA0 A;  4E99 A;  2LXT A; 
#chains in the Genus database with same CATH homology
 1LOT A;  3KIK A;  2QHB A;  1TXU A;  3WHR A;  4S1Y A;  2QMC A;  4OTU A;  5ID9 A;  3UIV A;  3VQI A;  1KW2 A;  4FIP B;  4Z9O A;  3A75 A;  4J2V A;  3NVI A;  3JRY A;  1KXP D;  2AJE A;  4LUF A;  5B5T A;  1N5U A;  2E0Y A;  2EFD A;  2QM6 A;  3GA9 L;  3FNM A;  4Z69 A;  4G03 A;  1NT2 B;  4M70 B;  3G9K D;  3A73 A;  4F5V A;  1H9Z A;  2DYO A;  3M99 C;  2KBZ A;  4W4U B;  2Z8J A;  3MHS B;  2NQO A;  4TQ0 A;  5IIH A;  3V09 A;  1IJG A;  4LB9 A;  2XSI A;  1MIW A;  5DBY A;  4NAW B;  2XVV A;  1UOR A;  4F5S A;  1JNB A;  4IW2 A;  2CKX A;  5BPK A;  3V03 A;  2VUE A;  2Z8I A;  2OZB B;  2EFC A;  1GNI A;  5IFO A;  2BXH A;  4BY9 C;  2VDB A;  2VUF A;  2BXN A;  1E7G A;  2OT3 A;  3V08 A;  2Z8K A;  4G04 A;  4FK5 B;  3NVM A;  3ICX A;  2BX8 A;  3FWC C;  1E7C A;  2XVQ A;  2XVW A;  1HK5 A;  3H37 A;  3LU8 A;  4GDL B;  1TF0 A;  1FOU A;  1MA9 A;  1J7E A;  3B9M A;  3GQX A;  3LU7 A;  2XW1 A;  4LUH A;  5HOZ A;  3WHS A;  3MHH B;  4ZBK A;  4F5T A;  4L9Q A;  2BXG A;  1E7H A;  3CX9 A;  4K71 A;  1AO6 A;  4ZCG A;  4L8U A;  3B9L A;  1BJ5 A;  4N0U D;  1HK3 A;  4G01 A;  1E7I A;  1E7E A;  1BKE A;  2DBX A;  4ZC6 A;  3SIV B;  1HK1 A;  2DYM A;  3GQU A;  2DBU A;  5IIU A;  4ZBR A;  4PO0 A;  3PLA A;  2I2Z A;  2YDF A;  4LB2 A;  5IJF A;  1J78 A;  2BXO A;  4FJC B;  2EFE A;  3NVK A;  4GDK B;  2NNW A;  3KJL A;  2EFH A;  2XVU A;  2BXM A;  3LU6 A;  4OR0 A;  2BXC A;  2DBW A;  3WHQ A;  5FUO A;  1GNJ A;  2XW0 A;  4ZBQ A;  4WA6 B;  4OTT A;  3TDL A;  2E0X A;  4MBE C;  4OT2 A;  3W1S A;  1O9X A;  2V36 A;  2BXK A;  2I30 A;  2DG5 A;  5IJ5 A;  2BXF A;  2BXA A;  1E7B A;  1H5W A;  5IIX A;  1HK4 A;  4IW1 A;  4HGM B;  4K2C A;  5GIO A;  1VFI A;  1MIV A;  2JUH A;  5GIN A;  1HK2 A;  4N3Z A;  5ID7 A;  4F5U A;  4N0F D;  4DHX B;  1BM0 A;  5DQF A;  2XMO A;  3NMU A;  3FWB C;  4HGK A;  4JK4 A;  4EMX A;  2BXE A;  4C31 B;  2BXQ A;  2BXB A;  4L9K A;  3SQJ A;  1VZS A;  1MIY A;  3SIU B;  4GG2 A;  5GIP A;  2LOQ A;  2BXD A;  3H3A A;  2ROH A;  2BXL A;  1E7F A;  1E7A A;  4ZUX V;  2BXI A;  5D7G A;  4TQ1 A;  5IJE A;  5GHK A;  1HA2 A;  2BXP A;  3JQZ A;  1E78 A;  1LNS A;  4GDX A;  4BKE A;  4LA0 A;  4E99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...