2KC2A

Nmr structure of the f1 domain (residues 86-202) of the talin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
128
structure length
128
Chain Sequence
b'SSGLVPRGSHMRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin-1
publication title Structure of a double ubiquitin-like domain in the talin head: a role in integrin activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 17
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2008-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kc2A00
4W9FA 2EMTA 3VHTC 1K8RB 2LZ6A 2LASA 2RD0A 3ZNGC 4DK5A 1E7UA 1WJ6A 2J0KA 2KVRA 4BBNF 4YL8A 1WJNA 3PTFC 3UINB 1WYWB 1R4MI 4IWQA 4MM3A 2PE6B 2NR2A 4DXAB 3RCZA 1E8YA 2FUHB 4EOYA 1P98A 3RULA 1EO6A 3L17A 1WGHA 1IPGA 1GG3A 4ZRJA 4WJNA 2N7DA 2PJHA 4BKSA 2D10A 4KZ0A 4PS7A 5J17A 3AULA 4AWJA 3K9PB 5D2MB 1KOTA 5J2RA 1SIFA 2R2OA 3DBSA 5G55A 3WALA 2DYBA 1L7YA 3IFWB 2KDFB 4I6NB 2BWFA 5E6OA 3R7QA 3VH3B 2NBWB 2EMSA 2K1FA 2ZPNA 2NPTA 2K6DB 3DOWA 1LFDA 2LVOA 4IM0A 2GBJA 3RT3B 4LJPB 4AOFA 2DX5B 1WX9A 3AU4A 4RMAA 1JRUA 1WZ3A 3MHSD 3PPAA 2MQJA 2DHZA 3T8MA 2CU1A 3M63B 1XQQA 2ZVNA 2J0MA 2KANA 3OJ4B 4B95A 3DBRI 3QQ8B 4ZRKA 1EF5A 2DYOA 1WFYA 2FCNA 3NY5A 1WX8A 4KV2A 1WRDB 2MBBB 2DYMA 1WGGA 2RPQA 2LI5A 3APFA 3NZSA 5E6PA 4DWFA 4W9DA 1E8XA 2DZKA 2AL6A 3JSVB 2A5UA 4FHJA 4IWOA 4RM8A 1IP9A 1GUAB 4A20A 5AEKB 1UH6A 4M8MA 3TMPB 4HWIB 1GC7A 2FAZA 3R7RA 2CKHB 1YD8U 4GOCA 2BYFA 3LJ3A 5DPSA 3QK0A 1I42A 2KTFA 3VFKA 3KUCB 3OAWA 4IM2A 1GNUA 3A9KB 1WIAA 2LD9A 4G50A 2KQ7A 4ZYNA 3PRPB 2MLBA 4FN2A 1WF9A 1WR1A 3RZWC 3DBLI 1VCBA 1Z2MA 2GBNA 3U8ZA 1WMHB 2CS4A 1ZKHA 2YVCA 4KIKA 3ZKJC 1KLVA 3B0AA 3TL5A 3ZW3A 2FCSA 2N9XA 3KYCD 1WJUA 3JW0X 4WWNA 2KWCA 1CMXB 2NBVB 4NPNA 5JH5C 1Q5WB 1Y8RC 3W1YA 1P0RA 3VVWB 3QARA 1I35A 2EKEC 5CHWA 1D3ZA 3KUZA 1E90A 3HM3A 3RUIB 3OLMD 2J7QB 2XBBC 2AEHA 3BINA 4IWPA 1UD7A 3KVFB 4EUTA 2G3QB 2IBIB 3PVLA 1QZEA 1J8CA 3U30A 4W9LA 3NHEB 1WE6A 5LLIA 3QCAA 1V5OA 1SGHA 3LDZE 2BWES 2KX3A 3VAWA 2LGDA 4ANWA 3N3KB 3PLUA 3PZDA 1S3SG 2GBRA 2M0XA 4PS8A 2ZCCA 1XD3B 4KVGB 4GXBA 5KHQA 3A9JB 1E8ZA 4JGHB 1OTRB 3C0RB 4BBNC 4DBGA 2W9NA 2O2VB 3N30A 4GU2A 3S2AA 5AZGA 2GMIC 4PYZA 1H8CA 3ZRFA 1EF1A 4GGQA 2DZJA 2IZVB 2UYZB 3QA8A 4NAWB 4W9JA 5DCNA 3M95A 2K25A 1WXVA 3APCA 1J19A 2C7MB 3GZNI 2L0TA 3NOBA 3JSVA 2V4LA 3TBLD 2REXA 1V6EA 2KJ6A 4MELA 1C3TA 3CSTA 4K7WA 4ZRIA 4MDKE 1NBFC 4W9EA 2QHOA 3L13A 4E71A 3DBHI 3B1LX 5CHFA 1WI0A 2LGXA 4N9F4 2IYDB 3L16A 4EZLA 2N7EA 1MG8A 2KOXA 4WWPA 5DPRA 2BPSA 2WYQA 3UQAA 3K9OB 3ZNZB 3WIMA 2MSED 2KN5A 2IO3B 1XT9B 3A9KA 1OQYA 3M3JA 4LCDE 5CHVC 4TKNA 2KO3A 4FHKA 2DENB 2BKFA 3TCAA 3ZNHB 1UELA 4BKGA 4II3B 1YX6B 4WAAA 1WZ0A 3V60A 4MGYE 3VUYA 5LXHA 1WMHA 1IYFA 3DVNV 4DDID 5IAAC 3PLVA 2KWUB 2JWZA 4DHZE 3KYDD 5L95C 1TBEA 2WDTB 4WJPA 4FLHA 2L00B 1T0YA 3I3TB 1ZGUB 1P3QU 5TR5A 4BKTA 2K8HA 1NDDA 1YX5B 2MP2B 3EHVA 3PREA 1E8WA 2NVUI 4LJOB 5G2NA 1OGWA 2L76A 4URKA 2HTHA 2L0FA 4FADA 3M62B 1V81A 3SU8X 4B6WA 1E5WA 2KHWB 2N4FA 5JHBA 1YJ1A 2CHWA 5E6NA 1KM7A 3VTUA 2XEWA 2LGYA 3CF6E 1P9DU 4E74A 3SDLC 5C1ZA 3H9DA 5D7GA 3ZDMC 1RAXA 2LJ5A 4IM3A 2A4ZA 3W1SC 1Q0WB 3X0WA 4EFOA 4KSLC 1M94A 4ZDVA 1R4NI 4HCNB 2VRRB 2G45B 4JL9A 5LXIB 1V49A 3PT2B 2O6VD 3DVGY 3KH0A 3A4RA 4HDOA 4K81A 2BF8B 3DVGX 3WA0A 3NS8A 4OVVA 3QWZB 1V80A 3A9JA 2LXCA 5L83A 3ENEA 2KLGA 2O2VA 5D6JB 3A1QB 2G4SA 2DZMA 1U4AA 4IG7B 2C7NB 1NI2A 3NZUA 2HJ8A 3MJWA 1V5TA 2KC2A 2WX1A 4HPMB 4M0WB 4NAWA 3ZIMA 3KUDB 2KDIA 2KMCA 2KK8A 3QJZA 3UIOB 2KZRA 4RM9A 2K8CA 4TQ1A 3RD2A 1ZW7A 3ZUNA 5J18A 4WJOA 4NQLB 2N1VA 4F8CB 4W9GA 2WWZA 4CYEA 2JVCA 3HIZA 2N9EB 2KJRA 2CR5A 2KWVB 3L10B 2KFJA 4II2B 2KDEB 2MBHA 1S1QB 4KDLB 4W9IA 4J6IA 3U7DA 2IY0B 4DHJB 3H7SA 2K6QA 1WXAA 4TV3A 4LDTB 4ICUA 3ALBA 4FA6A 1GC6A 1VD2A 1WJ4A 3KW5B 1V2YA 3VTWA 2L7RA 3TIXA 3D32A 3L54A 4XZ4A 4A3OA 4I6PA 2C9WB 4BOSC 1UBQA 1WM3A 4WQOB 3V61A 1OEYA 2IO1B 2ZEQA 1WE7A 2RR9A 3PHWB 3ZDTA 3UIPB 4GDLB 4CHKA 1PQSA 4NNJB 1V9JA 1UBIA 2IO2B 1UGMA 2MP2A 1ISNA 2M4NA 2YLMA 4ASWC 4MGIE 4ICVA 3WAOA 3AI5A 4AJWA 2LRUA 3PGEA 1A5RA 3H6NA 2JXXA 3PHXB 1C1YB 1P1AA 2JRIB 3DCGA 2L05A 1FXTB 5AZFA 3SD5A 1RFAA 4HJKA 3VTVA 4FULA 1G6JA 4NJ6A 1Q1OA 2O6VB 4K1RB 4NJ7A 1WH3A 4X57B 3V62A 4IW0A 4K7SA 4MSMB 2MBOA 3TJPA 2JUOA 1WXMA 3BY4B 4HCPB 4M8NA 1YIWA 2FCQA 2LRWA 2C5LC 2GOWA 2KDBA 2NCNA 3W1SA 4DDGD 2JZ3B 1X1MA 4FJYA 2MX2A 2C7HA 2C60A 2KX0A 1GJZA 2MCNB 2ZNVC 2V3SA 3O65B 4TUUA 2DAFA 4ANXA 2HD5B 4WWOA 3A1QA 2ZNVB 4B9KA 1WX7A 1RRBA 3VDZA 3H7PB 3DDCB 2KTRB 2KXJA 5KHOA 2G4DB 2BYEA 2HE7A 3EC8A 4EKUA 1Z5SB 4HPLB 2LVPA 2M8SA 2KLCA 2AYOB 3Q3FA 4DHJD 2UWQA 1BT0A 4P7IA 2WX0A 4EEWA 4KSKC 4MH0E 5IA7A 4LDTD 1LM8B 3ZO5B 3QX1A 2LXAA 4GMVA 4KDIC 4XX5A 5CTRC 3WAPA 2PEAA 2Y5BB 4KZCA 2Z59B 4G3XB 3JVZX 3VUXA 2JF5A 2MRPA 2CHXA 2KJHB 4GDKB 4BKSD 2N1WA 2Z0EB 4JQWC 2KFKB 4HXDA 4TQ0A 3PV1A 3QIJA 3CMMB 3DVNU 3ZTDA 5EDSA 2FCMA 4I6LB 3ZTCA 4BOZB 4GDLA 3ECIA 5CX3A 1RLFA 3WANA 1AARA 2BKRB 1TTNA 2JT4B 3QHTA 3Q3JA 2R2QA 3H1UA 5C23A 3V6CB 2KQSA 2PPHA 3IVFA 4DHZB 4JIOU 4OVUA 2GBMA 4XC2A 1LXDA 2MW5A 3DQVA 3MTNB 1HE8A 2AWTA 1TZ1A 3A4SC 3AU5A 2O6VA 4FJZA 3QC8B 4AUQC 2PE9A 4IC7B 4MJSB 4ANUA 3EFUA 4HVBA 3HHMA 2DZIA 2KKCA 2IY1B 2D2QA 4BVUC 2JY6A 2NBUA 2ZZPB 1WR6E 4G11A 3ZLZA 1OEYJ 4IUMB 5AZHA 4MSQB 3N32A 1WXSA 2V1YA 2OJRA 3APDA 3UQBA 3DPDA 4ANVA 1UZXB 2L8JA 2LVQA 2FNJB 2AL3A 2K39A 5GMVA 2CHZA 3X23A 2XK5B 4HDQA 1SE9A 3JYUA 4WJQA 3HM6X 2L3ZA 2ZJDA 3HK0A 4G0NB 1WGRA 5D94A 2MBQA 3ZRCA 3EECA 3H7PA 2LWPA 4AP4C 2KTRA 2ZVOA 3CSFA 3GOEA 2B3AA 4GB9A 3UF8A 4NY0A 2DAJA 4EZKA 1EUVB 2KNBA 2MA9B 4GSWA 2JRHA 5BO4B 5JHAA 3VUWA 4MGKE 1F9JA 3OJ3A 2M17A 1WM2A 5HKHA 3PRZA 2BGFA 4HK2A 3ML8A 2ASQA 2JPHA 2OOBB 3B08A 1TGZB 2BYVE 1KJTA 3ML9A 3PRMB 2NPTB 3A33B 3ZNID 4CO7A 2FIFA 2ZCBA 3V6EB 4GDKA 3RZFA 4GIVA 3IHPC 1WGYA 2FIDA 2KFKA 3WAMA 5DPWA 3QAQA 2M1MA 3P2BA 2JZZA 4FJVB 3SHQA 4HLEA 4NQKE 3R3MA 2KC1A 2D07B 2MBEA 4E3CA 5FR6A 4MGZE 3ZVVA 3PSEB 4PYUA 1WY8A 1LQBA 4FBJB 3T9LA 1H4RA 4F1SA 4W9HA 2I1JA 5DPTA 3RYTA 1J0GA 3VQIA 2J0JA 2MWSB 2RGFA 3VH4B 2LUEA 3ONSA 4AJYB 1E7VA 2D3GA 2NS5A 4F7ZA 1YQBA 4W9KA 4PS3A 3L08A 2ZPYA 4K7UA 2IO0B 2Z0DB 4W9CA 4MJSA 4BFRA 2N9PC 1L2NA 2KD0A 2KMAA 4A3PA 2RSUA 4MEMA 2I1KA 3IG3A 3IBEA 4JLCA 3PS6A 2GBKA 1WGDA 4EZJA 3AXCA 3VXWA 4GN1A 5JZEB 2K8BA 4KIKB 2XK5A 3L0WB 3UGBB 3R66C 2D11A 1V86A
chains in the Genus database with same CATH superfamily
2EMTA 3VHTC 2LASA 1WJNA 2NR2A 2ON8A 2D5GA 2FUHB 4LNNA 1K53A 2GI9A 3MHZA 2N7DA 4PS7A 4AWJA 3K9PB 1KOTA 1SIFA 5G55A 3WALA 1E9MA 3HVZA 2LHEA 3V3XA 2KDFB 1GPXA 2NBWB 2K1FA 2ZPNA 2Z8LA 1C4AA 1LFDA 3Q2AC 3RT3B 2DX5B 1WX9A 3MHSD 3PPAA 3RNBC 2IGGA 3T8MA 3M63B 2ZVNA 1JALA 2J0MA 2WXRA 1XO3A 4B95A 1ZPSA 4K3BA 1EF5A 4ZRKA 1QOFA 2DYMA 3APFA 3HVDA 1MJDA 3JSVB 1IP9A 4A20A 4IDIA 1T0RC 2KDMA 1UH6A 2LFIA 2QEJC 4M8MA 1SIJA 4L2YA 1UUPA 1KLUD 3LJ3A 5DPSA 4CQNA 1I42A 3R2IA 2RDHA 3OAWA 2QC8A 2MLBA 2RMMA 1YN5A 2YVCA 1E0ZA 2MH7A 1QILA 4RNAA 3ZW3A 3KYCD 2KWCA 2SEBD 2FUG1 3W1YA 3U52E 4YTMB 5CHWA 2NMQA 1PYWD 3OLMD 3BINA 4IWPA 2AEHA 1FFUA 3W2DA 1UD7A 3KVFB 2G3QB 2IBIB 5JXVA 1J8CA 3U30A 3AN1A 4HRSA 2BS4B 1SGHA 2KX3A 1YN3A 1XLOA 3I57A 2D3CA 1S3SG 2LUMA 2M0XA 2ZCCA 4KVGB 2FE8A 1YN4A 4DBGA 3C0RB 2W9NA 3S2AA 4GU2A 1SE2A 1H8CA 3ZRFA 4GGQA 1Q10A 2UYZB 3QA8A 1PUTA 3JSVA 1QT9A 4M02A 4L1BA 3TBLD 1C3TA 4K7WA 4MDKE 1J7AA 3BVMA 5CHFA 2IYDB 3L16A 2N7EA 4NAMA 1MG8A 1ET9A 1F2RI 4WWPA 5DPRA 2BPSA 2JSVX 3U7ZA 1XT9B 2VH1A 2KO3A 4FHKA 2DENB 2BKFA 4ARCA 4II3B 1TS2A 1TY2A 1GAQB 3B2FA 1IYFA 4DDID 3PLVA 2KWUB 4DHZE 4FLHA 2MP2B 1YX5B 3PREA 1E8WA 2NVUI 4P6VF 1OGWA 2L0FA 2KHWB 2N4FA 2BS2B 1KM7A 4JWSC 4E74A 5D7GA 3ZDMC 2LJ5A 3W1SC 2KQ4X 4EFOA 4ZDVA 1R4NI 2QDFA 2JX5A 3PZ8A 5LXIB 1V49A 3PT2B 2O6VD 3DVGY 3KH0A 4OVVA 1NENB 3QWZB 2GRIA 3C8YA 3I5JC 2DWQA 1PGBA 2DZMA 2C7NB 1N6ZA 2HJ8A 3AEAB 3ZIMA 1JQ4A 3GB1A 2KDIA 3I63C 3UIOB 2KZRA 5J18A 1ZW7A 2AQ2B 1ENFA 2GB1A 2JVCA 2ZW0A 1FRDA 2KFJA 2KDEB 4J6IA 4YT0B 2WXFA 1TKGA 2KACA 4JE3B 4WQOB 3AEDB 2XN9C 2KWDA 4XE0A 3AMZA 2RR9A 3PHWB 3UIPB 1KLGD 2MP2A 1ISNA 2M4NA 1SSNA 3WAOA 3N20C 2JXXA 3BZDB 2WDVB 3DCGA 1FXTB 4N58A 2K9XA 3KWLA 1WH3A 3AEBB 4X57B 4K7SA 2MBOA 3FKYA 4P1CC 2JUOA 2WU2B 2INCC 2LRWA 3W1SA 1XLPA 2QMTA 2MX2A 2Y5PA 2KX0A 2IDYA 4DQOC 2K22A 3RPFC 4ANXA 4WWOA 2G4DB 2EKIA 1C79A 4YWGG 4AQ7A 2UWQA 4KSKC 3FC4A 1XCQL 5BMHA 1GB1A 2K3UA 3GE8C 2W82A 2WNMA 2Y5BB 2JZPA 4QAYA 3JVZX 4GDKB 4BKSD 4TQ0A 4HXDA 4KKIA 3ZTDA 2FCMA 2XNAC 2ICIA 3NG0A 3ECIA 5CX3A 3WANA 1V97A 3IXSA 1QQRA 2R2QA 2PPHA 4ZRQA 4ACFA 4LNFA 3BIID 2W55A 1NVID 4YSZB 4IC7B 1PGAA 2WGSA 1QF6A 4G11A 4IUMB 1WXSA 3APDA 2AX5A 2CHZA 1BMLC 2XK5B 3ZXVA 1PDXA 2PW9A 2WXJA 3AECB 2INPE 2MA9B 4GSWA 2CJNA 3OJ3A 1JRPA 5HKHA 2JPHA 3A33B 2FIFA 2HDEA 4RGTA 4GDKA 2N0SB 3RZFA 2NTTA 2M1MA 5BMIA 2JZZA 4FJVB 5H92C 4OHJA 4FBJB 1LQBA 2PVGC 3IT6B 4F1SA 3RYTA 3VQIA 2J0JA 4ZHPA 2RGFA 1VZ7A 3ONSA 1E7VA 3L08A 4K7UA 2Z0DB 4BFRA 2N9PC 1TT5B 1P7FA 2GBKA 1V1OA 4EZJA 4ITKA 2LJIA 4YTNB 1CK1A 2XK5A 4KKJA 2D11A 4W9FA 1F0ZA 1E7UA 2J0KA 2KVRA 3EGRA 1HXYD 3RULA 1EO6A 1HZ5A 4ZRJA 2BVCA 1AW7A 1TKYA 2PJHA 1FXAA 3DBSA 5E6OA 3R7QA 3P4RB 4WURA 2K6DB 2LVOA 3SEBA 2BBCA 4HKZE 2GBJA 4M00A 4AOFA 5GXGB 2MQJA 3GE3C 1XQQA 1L6UA 1L5PA 1T0SC 2FCNA 3NY5A 1WRDB 3KWVA 5E6PA 2RPQA 3RN9C 4W9DA 1QKZA 1E8XA 2AL6A 4IWOA 2V0GA 4LNIA 4HWIB 1GC7A 1YD8U 4GOCA 2RPVA 1IGDA 3VFKA 4IM2A 3PO0A 2LD9A 2OEDA 4WQMA 2D3AA 1TIFA 2BTEA 2KT7A 1WF9A 3DBLI 1VCBA 5IO9A 3U8ZA 1WSPA 2WQYB 1KLVA 3ZKJC 4RGMA 3TL5A 2N9XA 1WJUA 1HA5A 4WWNA 2IGHA 3AEGB 4C7YA 4NPNA 1Q5WB 1Y8RC 1P0RA 3VVWB 3QARA 1I35A 2EKEC 1D3ZA 3KUZA 1RM6C 2WXQA 3MC0B 3PVLA 4W9LA 1VZ8A 5LLIA 3QCAA 1FXIA 3RMKC 2LGDA 3SR6A 3N3KB 3PLUA 3PZDA 2GBRA 1QOAA 1F52A 3Q6BA 3KQ4A 3A9JB 1E8ZA 3ZJUA 5E6JA 2O2VB 1FM0D 5AZGA 1EF1A 1JMLA 2IZVB 4NAWB 1HTOA 2VZKB 5DCNA 3M95A 3APCA 2C7MB 3GZNI 2L0TA 3NOBA 4W9EA 3L13A 4RFBA 3B1LX 5IOIA 2PLPA 3UQAA 3K9OB 4J3OD 2IO3B 1AWDA 4IOIE 4C4VB 4BKGA 4WAAA 3V60A 4MGYE 3VUYA 3DVNV 3KYDD 2WDTB 4WJPA 3EFCA 4C7ZA 1PGXA 4RCOA 4LJOB 2J42A 3W5VB 3M62B 1JROA 1V81A 4HROA 3URYA 5JHBA 1YJ1A 1CQVA 3AE4B 1P9DU 1V8CA 3SDLC 5C1ZA 1RAXA 2JYTA 4IM3A 2A4ZA 3X0WA 4KSLC 1SJHD 1QLBB 1YQ4B 1TJEA 1NYRA 4K81A 3WA0A 3DVGX 3NS8A 3Q8EA 1V80A 2VZKD 2H89B 3A9JA 2K0PA 3DWGC 5L83A 3BYTB 3ENEA 2O2VA 2G4SA 4IG7B 2RDBC 4NAWA 1B1ZA 1V5TA 2KC2A 2WX1A 5AUIA 3AEEB 2KMCA 2JXTA 2KK8A 3EA6A 4TQ1A 3ZUNA 3IT4B 4HJGE 1HZ6A 3E56A 4W9GA 2N9EB 2KWVB 2MBHA 1MHHE 1S1QB 2MEKA 3ZGZA 3U7DA 4TV3A 1VD2A 2RDGA 1V2YA 4C4VA 1SBBB 3VTWA 3L54A 4I6PA 3V61A 2W3SA 2IO1B 2ZEQA 1WE7A 1VLBA 1K51A 3RNGC 2TSSA 4TMAB 3H8HA 1UBIA 4ASWC 1BUIC 3PGEA 3PHXB 1GOZA 2L05A 5AZFA 1RFAA 1G6JA 4LTUA 2O6VB 5HG2A 1ZDVA 2LMCA 4MSMB 3Q3NC 1E7PB 3BY4B 3MFGA 4M8NA 2WU5B 3MC9A 5TSSA 4DDGD 1X1MA 4D2KA 4FJYA 2C7HA 3TSSA 2MCNB 2PKOA 2V3SA 1F77A 1RYJA 4XGAB 1RRBA 1WRIA 3VDZA 3H7PB 5C2TB 2KTRB 5KHOA 2HE7A 2BYEA 1Z5SB 3Q8BA 1TS3A 2KLCA 4HPPA 3Q3FA 3QX1A 2LXAA 4GMVA 3LB8C 1WGKA 2PEAA 4G3XB 1HTQA 3AB5A 2KJHB 4GLSC 4N59A 2Z0EB 1FMAD 3PV1A 3CMMB 4JPSA 2L32A 1ZUD2 3ZTCA 3BVGA 2BKRB 3QHTA 1JWAD 3N1XC 3N1YC 3MJ5A 4Q2JA 4DHZB 2GBMA 2HTME 4LNOA 1TZ1A 3NVYA 2O6VA 4AUQC 2B76B 4MJSB 3GZNB 4YXDB 2QCZA 2IY1B 2NBUA 1WR6E 3B9JA 4ZOHC 3P63A 2K39A 4S0RA 5IP4D 2LEKA 1AYFA 1VJKA 4AS1A 4TSSA 4WAFA 3JYUA 4NJCA 3HK0A 4G0NB 2L1AA 3EECA 1ZXIA 3H7PA 2LWPA 3Q8CA 2Y3AA 2KTRA 2ZVOA 4GB9A 2DAJA 2BT6A 4A55A 2JRHA 2I38A 3VUWA 2QILA 4OVZA 4MGKE 1IUEA 4WWMA 3PRZA 2BGFA 3ML8A 2ASQA 1DOIA 1KJTA 3ZNID 2ZCBA 2OHFA 3KLSX 1WGYA 1D6EC 1T3QA 1ZDXA 1HEZE 2VH2A 5FR6A 4MGZE 2G1EA 1YOVB 4PYUA 3T3OA 1ZXHA 3T9LA 3NVVA 2I1JA 5AUKA 3AE5B 1LO5D 2H88B 2LUEA 4LK0M 1YQBA 4C80A 4W9KA 4F7ZA 3TEWA 2ZPYA 4MJSA 1AN8A 4OZBA 3V05A 1L2NA 2KD0A 4LLGM 2KMAA 4A3PA 2RSUA 4MEMA 3IBEA 3DHHC 1L0YB 1WGDA 3AXCA 3VXWA 1UNSA 5JZEB 2K8BA 4KIKB 3UGBB 1V86A 4DK5A 1PFDA 1WJ6A 4BBNF 3CIRB 1NYQA 3PTFC 1C4CA 4IWQA 1VDVA 1MG4A 1WGHA 2EELA 1GG3A 2WDQB 1JWMD 1MVKA 4WJNA 4BKSA 2D10A 5D2MB 1KH0A 2IGDA 2R2OA 2DYBA 3IFWB 3VR9B 4I6NB 4A8XC 2BWFA 3VH3B 4IM0A 4KGSA 4C56C 2CU1A 3OJ4B 3QQ8B 2DYOA 1WFYA 3NZSA 4DWFA 1WGGA 2N9KA 5BYRA 4RM8A 2A5UA 4FHJA 1F2RC 2W3RA 2D3BA 1C78A 3TMPB 2FAZA 3R7RA 2CKHB 2WP9B 1N60A 1J7CA 3O13A 3RNEC 2KTFA 2BQQA 2DNFA 1GNUA 3FILB 2KQ7A 1HQRD 4FN2A 1T6BX 1Z2MA 2GBNA 4KIKA 1RWSA 3P4PB 1TS5A 1KFYB 2NBVB 1B9RA 3U4EG 1P7EA 3ZQ4A 3HM3A 2J7QB 1MFWA 1QZEA 2E6XA 4XWTA 3NZ3A 1R4NB 1WE6A 1V5OA 2BB6A 4ZHOA 4WIPA 3P42A 1XD3B 4GXBA 5KHQA 4BBNC 1OTRB 1JWUD 3B2GA 2GMIC 2DZJA 2N9LA 4W9JA 2K25A 1J19A 2REXA 2KJ6A 2V3PA 4ZRIA 2QHOA 3E9SA 3DBHI 2LGXA 3AE9B 4EZLA 2I2YA 1XF5L 2PIAA 3RNFC 3FILA 4LCDE 1V1PB 3TCAA 3ZNHB 2R61A 4PT5A 1WZ0A 3NJTA 5LXHA 1FNVA 1DOYA 1JCKB 3BYYB 2JWZA 1MPEA 5L95C 1T0YA 1P3QU 5TR5A 2K8HA 1NDDA 3EHVA 3GP7A 2L76A 2WHIA 2HTHA 2JWUA 1JWSD 1Y56A 3SU8X 1E5WA 2CHWA 1YJIA 5E6NA 2XEWA 2LGYA 2GLSA 3HUIA 3H9DA 1TZOA 1FIQA 1M94A 1SEBD 2G45B 4HEA1 1I4RA 2BF8B 1FCLA 2NTSA 4ARIA 2LXCA 2KLGA 2V4IB 4YSYB 5D6JB 3A1QB 1D5ZC 3ETRA 3NZUA 4M0WB 4HPMB 3BWUD 3KUDB 3DHGC 2IJ0A 3BVZA 3QJZA 3RD2A 3RI7C 4JX1C 4F8CB 1VZ6A 2CR5A 4KDLB 3L10B 4DHJB 5D3IB 2K6QA 4ICUA 3ALBA 3Q8AA 1GC6A 2AQ1B 3KW5B 1K50A 3DWMA 3TIXA 3I9V1 1V1PA 3SFEB 3Q3OC 2SAKA 3RNCC 2BYTA 4BOSC 2WXKA 1WM3A 4YTPB 3ZDTA 4GDLB 4CHKA 1PQSA 1V9JA 1UGMA 1C77A 1STEA 5FR3A 5BYQA 3AI5A 4A6QA 2LRUA 4AJWA 1A5RA 1SE4A 1P1AA 4US8A 2WXIA 4YSXB 2DLBA 3VTVA 4FULA 4OZAA 4K1RB 1WXMA 4HCPB 2LHDA 4KGTA 2GOWA 2KDBA 1ZE3D 1XEEA 1L4DB 4RH6A 1TS4A 1EWYC 3ZJTA 2X8XX 2OJWA 3W5UB 4TUUA 2DAFA 1DGJA 2HD5B 2QSDA 3A1QA 1I7HA 1FNUA 2J4XA 2WS3B 2KXJA 3LYYA 4FXCA 2LVPA 3MC8A 1L4ZB 4REZA 4DHJD 2LGSA 4RF0A 4P7IA 1OFFA 4MH0E 5IA7A 2LGIA 3ZO5B 4XX5A 3WAPA 3N1ZC 4M01A 3WCQA 2Z59B 1E10A 2PMVA 2CHXA 2N1WA 1ACCA 4LNKA 3T3NA 5LNK1 4B0EA 1T0QC 1EM7A 4BOZB 3AH7A 4GDLA 2E3TA 2QJLA 1FCCC 1OQRA 3Q3JA 5FK9C 1N5XA 3IVFA 4DXGA 4JIOU 3NVZA 2KYWA 2MW5A 3DQVA 1HE8A 3VRAB 2WXHA 1RFKA 4OW0A 1N63A 1SB3C 3BK2A 3QC8B 2PE9A 4ANUA 3TEZA 2D2QA 1GB4A 1OEYJ 5IKCM 3N32A 3DBHB 3UQBA 3DPDA 4ANVA 1UZXB 2L8JA 2LVQA 2MJDA 2AL3A 2L52A 2J53A 1FD6A 5D94A 2JQRB 4MM3B 1LGRA 2WXNA 3GOEA 2B3AA 5BO4B 5JHAA 4US9A 1KF6B 1F9JA 2YEPB 4MACA 4MT5A 2CJOA 1WM2A 3Q14C 4HK2A 2BB5A 2OOBB 3B08A 2BYVE 1IGCA 3ML9A 2NPTB 4CO7A 4PK1A 3V6EB 3DHIC 1N5WA 3QAQA 3P2BA 3GS2A 1L0VB 4C00A 2ZW1A 3R3MA 4NQKE 2KC1A 3U2SC 2D07B 2MBEA 1ZOYB 1H4RA 4W9HA 4XDDA 1J0GA 3UI3A 2MWSB 1I4GA 2INNE 2CU3A 1XXGA 4AJYB 2NS5A 1FFVA 1WYGA 4H2AA 3IG3A 5HFYA 4JLCA 3DBLB 4UDUC 2BS3B 3MP9A 2WXGA 2WXLA 4GN1A 2KN4A 1EU4A 3L0WB 3SFDB 3TEYA 1K8RB 2LZ6A 2RD0A 3ZNGC 4YL8A 1N62A 3UINB 3R8BA 1WYWB 3C19A 1R4MI 4MM3A 2PE6B 4DXAB 1D5XC 1E8YA 3RCZA 4EOYA 1P98A 2IPKD 1SF0A 3L17A 3TUOA 1IPGA 4KZ0A 5J17A 3AULA 5J2RA 4BAXA 1I4PA 1L7YA 3EUB2 1F1HA 1C76A 2EMSA 4KX6B 2NPTA 3NS1A 3DOWA 4XWWA 1ESFA 2INDC 4LJPB 3AU4A 4P1BC 4RMAA 1JRUA 4B0MA 1WZ3A 1ZP0B 2DHZA 2WLBA 1D5MC 1UF0A 2KANA 3DBRI 2Q5WD 4KV2A 1WX8A 4ZRPA 2MBBB 2LI5A 1I4XA 2KAJA 2L83A 5I4DA 1VRAB 2DZKA 2WXMA 3IAM1 1GUAB 2FBWB 3LXFA 4USAA 5AEKB 2W54A 1IBXB 2PVOD 5H8YE 2BYFA 2KMMA 3OWEB 3QK0A 5IN7A 4L23A 3KUCB 4S17A 3A9KB 1WIAA 4G50A 3TEXA 4ZYNA 3PRPB 1WR1A 3RZWC 1WMHB 2CS4A 1ZKHA 3VR8B 1FNWA 3B0AA 2FCSA 3Q8FA 3JW0X 1CMXB 5JH5C 1UWXA 4MH8A 4N6EB 1CZPA 1E90A 3FAHA 3RUIB 2XBBC 3PZ7A 3L4PA 4EUTA 3NHEB 3IAS1 1L0XB 3LDZE 2BWES 4XDCA 5HHDG 3VAWA 4ANWA 2QIEB 4PS8A 3W9CB 3AE1B 4JGHB 1QOGA 3N30A 2ACZB 1FRRA 5EE0A 4PYZA 2MHJA 1WXVA 2KVZA 4JWUC 2PTLA 2V4LA 1V6EA 4MELA 3CSTA 1NBFC 4E71A 2DBYA 1IBXA 1SXTA 1WI0A 1J7BA 4N9F4 1TKEA 2KOXA 2WYQA 3ZNZB 3WIMA 4R3DA 2MSED 2KN5A 3A9KA 1OQYA 2G9HD 3M3JA 5CHVC 4TKNA 4RGNA 4IKGA 1UELA 1CJEA 1YX6B 1WMHA 3AE8B 5IAAC 1TBEA 1NEKB 2L00B 3I3TB 1ZGUB 5D3DA 1DOXA 4BKTA 1R7SA 5G5HA 1M4VA 2N7JA 5G2NA 4URKA 4A9AA 2BW2A 4FADA 3P1MA 4B6WA 3ZXRA 3VTUA 3CF6E 1N61A 3ZYYX 2JU6X 5EE1A 5EE9A 4NZLB 1DYQA 1Q0WB 4RGOS 4HCNB 2VRRB 4JL9A 2M56B 3A4RA 4HDOA 3BK1A 3AEFB 3N9YC 1K52A 1U4AA 1A70A 1NI2A 3MJWA 2ONQA 4RM9A 2K8CA 4WJOA 4NQLB 2N1VA 3NVWA 4O1NA 2WWZA 4CYEA 2WXPA 3HIZA 2KJRA 4II2B 4W9IA 1R4MB 2IY0B 3H7SA 4ZYSA 1WXAA 4LDTB 4FA6A 1WJ4A 4DXFA 1VR9A 2L7RA 2UU7A 3D32A 4XZ4A 4A3OA 2C9WB 1UBQA 4EE2A 1OEYA 2MJ3A 3AV8A 4NNJB 2IO2B 2YLMA 3AE2B 1ET6A 4WH4A 4MGIE 4ICVA 3H6NA 2WDRB 1D4BA 1C1YB 2JRIB 1XLNA 3SD5A 2JYEA 3RFZB 3DBRB 4HJKA 4NJ6A 1Q1OA 1XLQA 4HKQA 4NJ7A 3V62A 4IW0A 2X38A 3TJPA 1C4PA 1YIWA 1WXQA 1YMHE 2FCQA 2C5LC 1MI0A 2NCNA 2J52A 2JZ3B 3ABVB 2C60A 3OG5A 1GJZA 2ZNVC 3O65B 2ZNVB 1YNTE 1QOBA 4P16A 4B9KA 3NRZA 1WX7A 3DDCB 1UGJA 3EC8A 4EKUA 2V9HA 4HPLB 3VRBB 2HJ1A 3CWIA 2M8SA 5G5GA 2AYOB 1BT0A 2WX0A 4EEWA 4LDTD 1LM8B 2M0AA 4KDIC 5CTRC 4KZCA 4RF1A 5HI1A 3VUXA 2JF5A 2MRPA 4JQWC 2KFKB 3R2TA 3AE7B 3QIJA 1FEHA 3DVNU 1BXTA 5EDSA 4I6LB 1WWTA 1RLFA 1AARA 1JWBD 1TTNA 2JT4B 5FKAC 3H1UA 5C23A 3V6CB 2KQSA 3AE6B 1TY0A 4K3CA 1FO4A 1SJED 4OVUA 4XC2A 5BYSA 1LXDA 3MTNB 2AWTA 3A4SC 3AU5A 4BZAA 4FJZA 4A90A 3Q69A 3EFUA 4HVBA 5BMGA 3HHMA 2DZIA 1NI3A 2KKCA 4BVUC 2JY6A 2ZZPB 1EWCA 3ZLZA 5AZHA 4MSQB 2V1YA 2OJRA 2FNJB 5GMVA 3X23A 1T5XD 4HDQA 1SE9A 5MPOA 4WJQA 3HM6X 2L3ZA 2ZJDA 1WGRA 2MBQA 4XYCA 3ZRCA 1FPYA 1OQQA 3AE3B 1EU3A 3NUHB 2WXOA 4AP4C 2AQ3B 3CSFA 3UF8A 5C3JB 4EZKA 4NY0A 1EUVB 1I4HA 2KNBA 2M19A 3Q3MC 2M17A 4KGRA 2MJEA 3AM9A 1TGZB 3PRMB 4GIVA 3IHPC 2FIDA 2KFKA 3WAMA 5DPWA 3SHQA 4HLEA 2YEPF 3P4SB 1TYGB 5T8IA 4E3CA 3ZVVA 1KRHA 3PSEB 1WY8A 3RNAC 1E6EB 5DPTA 3J9CA 3VH4B 2K5PA 5EE3A 1L6VA 2D3GA 2Y5CA 3ZJVA 1JW9D 4PS3A 1C9FA 4W9CA 2IO0B 4M0WA 4OZCA 1KTKA 1MHXA 3P4QB 2I1KA 1ROEA 2V3NA 3PS6A 1XCTL 3HRDD 1YJJA 1I4QA 1YQ3B 1UWMA 1SE3A 3R66C
chains in the Genus database with same CATH topology
4W9FA 2EMTA 3VHTC 1K8RB 2LZ6A 2LASA 2RD0A 3ZNGC 4DK5A 1E7UA 1WJ6A 2J0KA 2KVRA 4BBNF 4YL8A 1WJNA 3PTFC 3UINB 1WYWB 1R4MI 4IWQA 4MM3A 2PE6B 2NR2A 4DXAB 3RCZA 1E8YA 2FUHB 4EOYA 1P98A 3RULA 1EO6A 3L17A 1WGHA 1IPGA 1GG3A 4ZRJA 4WJNA 2N7DA 2PJHA 4BKSA 2D10A 4KZ0A 4PS7A 5J17A 3AULA 4AWJA 3K9PB 5D2MB 1KOTA 5J2RA 1SIFA 2R2OA 3DBSA 5G55A 3WALA 2DYBA 1L7YA 3IFWB 2KDFB 4I6NB 2BWFA 5E6OA 3R7QA 3VH3B 2NBWB 2EMSA 2K1FA 2ZPNA 2NPTA 2K6DB 3DOWA 1LFDA 2LVOA 4IM0A 2GBJA 3RT3B 4LJPB 4AOFA 2DX5B 1WX9A 3AU4A 4RMAA 1JRUA 1WZ3A 3MHSD 3PPAA 2MQJA 2DHZA 3T8MA 2CU1A 3M63B 1XQQA 2ZVNA 2J0MA 2KANA 3OJ4B 4B95A 3DBRI 3QQ8B 4ZRKA 1EF5A 2DYOA 1WFYA 2FCNA 3NY5A 1WX8A 4KV2A 1WRDB 2MBBB 2DYMA 1WGGA 2RPQA 2LI5A 3APFA 3NZSA 5E6PA 4DWFA 4W9DA 1E8XA 2DZKA 2AL6A 3JSVB 2A5UA 4FHJA 4IWOA 4RM8A 1IP9A 1GUAB 4A20A 5AEKB 1UH6A 4M8MA 3TMPB 4HWIB 1GC7A 2FAZA 3R7RA 2CKHB 1YD8U 4GOCA 2BYFA 3LJ3A 5DPSA 3QK0A 1I42A 2KTFA 3VFKA 3KUCB 3OAWA 4IM2A 1GNUA 3A9KB 1WIAA 2LD9A 4G50A 2KQ7A 4ZYNA 3PRPB 2MLBA 4FN2A 1WF9A 1WR1A 3RZWC 3DBLI 1VCBA 1Z2MA 2GBNA 3U8ZA 1WMHB 2CS4A 1ZKHA 2YVCA 4KIKA 3ZKJC 1KLVA 3B0AA 3TL5A 3ZW3A 2FCSA 2N9XA 3KYCD 1WJUA 3JW0X 4WWNA 2KWCA 1CMXB 2NBVB 4NPNA 5JH5C 1Q5WB 1Y8RC 3W1YA 1P0RA 3VVWB 3QARA 1I35A 2EKEC 5CHWA 1D3ZA 3KUZA 1E90A 3HM3A 3RUIB 3OLMD 2J7QB 2XBBC 2AEHA 3BINA 4IWPA 1UD7A 3KVFB 4EUTA 2G3QB 2IBIB 3PVLA 1QZEA 1J8CA 3U30A 4W9LA 3NHEB 1WE6A 5LLIA 3QCAA 1V5OA 1SGHA 3LDZE 2BWES 2KX3A 3VAWA 2LGDA 4ANWA 3N3KB 3PLUA 3PZDA 1S3SG 2GBRA 2M0XA 4PS8A 2ZCCA 1XD3B 4KVGB 4GXBA 5KHQA 3A9JB 1E8ZA 4JGHB 1OTRB 3C0RB 4BBNC 4DBGA 2W9NA 2O2VB 3N30A 4GU2A 3S2AA 5AZGA 2GMIC 4PYZA 1H8CA 3ZRFA 1EF1A 4GGQA 2DZJA 2IZVB 2UYZB 3QA8A 4NAWB 4W9JA 5DCNA 3M95A 2K25A 1WXVA 3APCA 1J19A 2C7MB 3GZNI 2L0TA 3NOBA 3JSVA 2V4LA 3TBLD 2REXA 1V6EA 2KJ6A 4MELA 1C3TA 3CSTA 4K7WA 4ZRIA 4MDKE 1NBFC 4W9EA 2QHOA 3L13A 4E71A 3DBHI 3B1LX 5CHFA 1WI0A 2LGXA 4N9F4 2IYDB 3L16A 4EZLA 2N7EA 1MG8A 2KOXA 4WWPA 5DPRA 2BPSA 2WYQA 3UQAA 3K9OB 3ZNZB 3WIMA 2MSED 2KN5A 2IO3B 1XT9B 3A9KA 1OQYA 3M3JA 4LCDE 5CHVC 4TKNA 2KO3A 4FHKA 2DENB 2BKFA 3TCAA 3ZNHB 1UELA 4BKGA 4II3B 1YX6B 4WAAA 1WZ0A 3V60A 4MGYE 3VUYA 5LXHA 1WMHA 1IYFA 3DVNV 4DDID 5IAAC 3PLVA 2KWUB 2JWZA 4DHZE 3KYDD 5L95C 1TBEA 2WDTB 4WJPA 4FLHA 2L00B 1T0YA 3I3TB 1ZGUB 1P3QU 5TR5A 4BKTA 2K8HA 1NDDA 1YX5B 2MP2B 3EHVA 3PREA 1E8WA 2NVUI 4LJOB 5G2NA 1OGWA 2L76A 4URKA 2HTHA 2L0FA 4FADA 3M62B 1V81A 3SU8X 4B6WA 1E5WA 2KHWB 2N4FA 5JHBA 1YJ1A 2CHWA 5E6NA 1KM7A 3VTUA 2XEWA 2LGYA 3CF6E 1P9DU 4E74A 3SDLC 5C1ZA 3H9DA 5D7GA 3ZDMC 1RAXA 2LJ5A 4IM3A 2A4ZA 3W1SC 1Q0WB 3X0WA 4EFOA 4KSLC 1M94A 4ZDVA 1R4NI 4HCNB 2VRRB 2G45B 4JL9A 5LXIB 1V49A 3PT2B 2O6VD 3DVGY 3KH0A 3A4RA 4HDOA 4K81A 2BF8B 3DVGX 3WA0A 3NS8A 4OVVA 3QWZB 1V80A 3A9JA 2LXCA 5L83A 3ENEA 2KLGA 2O2VA 5D6JB 3A1QB 2G4SA 2DZMA 1U4AA 4IG7B 2C7NB 1NI2A 3NZUA 2HJ8A 3MJWA 1V5TA 2KC2A 2WX1A 4HPMB 4M0WB 4NAWA 3ZIMA 3KUDB 2KDIA 2KMCA 2KK8A 3QJZA 3UIOB 2KZRA 4RM9A 2K8CA 4TQ1A 3RD2A 1ZW7A 3ZUNA 5J18A 4WJOA 4NQLB 2N1VA 4F8CB 4W9GA 2WWZA 4CYEA 2JVCA 3HIZA 2N9EB 2KJRA 2CR5A 2KWVB 3L10B 2KFJA 4II2B 2KDEB 2MBHA 1S1QB 4KDLB 4W9IA 4J6IA 3U7DA 2IY0B 4DHJB 3H7SA 2K6QA 1WXAA 4TV3A 4LDTB 4ICUA 3ALBA 4FA6A 1GC6A 1VD2A 1WJ4A 3KW5B 1V2YA 3VTWA 2L7RA 3TIXA 3D32A 3L54A 4XZ4A 4A3OA 4I6PA 2C9WB 4BOSC 1UBQA 1WM3A 4WQOB 3V61A 1OEYA 2IO1B 2ZEQA 1WE7A 2RR9A 3PHWB 3ZDTA 3UIPB 4GDLB 4CHKA 1PQSA 4NNJB 1V9JA 1UBIA 2IO2B 1UGMA 2MP2A 1ISNA 2M4NA 2YLMA 4ASWC 4MGIE 4ICVA 3WAOA 3AI5A 4AJWA 2LRUA 3PGEA 1A5RA 3H6NA 2JXXA 3PHXB 1C1YB 1P1AA 2JRIB 3DCGA 2L05A 1FXTB 5AZFA 3SD5A 1RFAA 4HJKA 3VTVA 4FULA 1G6JA 4NJ6A 1Q1OA 2O6VB 4K1RB 4NJ7A 1WH3A 4X57B 3V62A 4IW0A 4K7SA 4MSMB 2MBOA 3TJPA 2JUOA 1WXMA 3BY4B 4HCPB 4M8NA 1YIWA 2FCQA 2LRWA 2C5LC 2GOWA 2KDBA 2NCNA 3W1SA 4DDGD 2JZ3B 1X1MA 4FJYA 2MX2A 2C7HA 2C60A 2KX0A 1GJZA 2MCNB 2ZNVC 2V3SA 3O65B 4TUUA 2DAFA 4ANXA 2HD5B 4WWOA 3A1QA 2ZNVB 4B9KA 1WX7A 1RRBA 3VDZA 3H7PB 3DDCB 2KTRB 2KXJA 5KHOA 2G4DB 2BYEA 2HE7A 3EC8A 4EKUA 1Z5SB 4HPLB 2LVPA 2M8SA 2KLCA 2AYOB 3Q3FA 4DHJD 2UWQA 1BT0A 4P7IA 2WX0A 4EEWA 4KSKC 4MH0E 5IA7A 4LDTD 1LM8B 3ZO5B 3QX1A 2LXAA 4GMVA 4KDIC 4XX5A 5CTRC 3WAPA 2PEAA 2Y5BB 4KZCA 2Z59B 4G3XB 3JVZX 3VUXA 2JF5A 2MRPA 2CHXA 2KJHB 4GDKB 4BKSD 2N1WA 2Z0EB 4JQWC 2KFKB 4HXDA 4TQ0A 3PV1A 3QIJA 3CMMB 3DVNU 3ZTDA 5EDSA 2FCMA 4I6LB 3ZTCA 4BOZB 4GDLA 3ECIA 5CX3A 1RLFA 3WANA 1AARA 2BKRB 1TTNA 2JT4B 3QHTA 3Q3JA 2R2QA 3H1UA 5C23A 3V6CB 2KQSA 2PPHA 3IVFA 4DHZB 4JIOU 4OVUA 2GBMA 4XC2A 1LXDA 2MW5A 3DQVA 3MTNB 1HE8A 2AWTA 1TZ1A 3A4SC 3AU5A 2O6VA 4FJZA 3QC8B 4AUQC 2PE9A 4IC7B 4MJSB 4ANUA 3EFUA 4HVBA 3HHMA 2DZIA 2KKCA 2IY1B 2D2QA 4BVUC 2JY6A 2NBUA 2ZZPB 1WR6E 4G11A 3ZLZA 1OEYJ 4IUMB 5AZHA 4MSQB 3N32A 1WXSA 2V1YA 2OJRA 3APDA 3UQBA 3DPDA 4ANVA 1UZXB 2L8JA 2LVQA 2FNJB 2AL3A 2K39A 5GMVA 2CHZA 3X23A 2XK5B 4HDQA 1SE9A 3JYUA 4WJQA 3HM6X 2L3ZA 2ZJDA 3HK0A 4G0NB 1WGRA 5D94A 2MBQA 3ZRCA 3EECA 3H7PA 2LWPA 4AP4C 2KTRA 2ZVOA 3CSFA 3GOEA 2B3AA 4GB9A 3UF8A 4NY0A 2DAJA 4EZKA 1EUVB 2KNBA 2MA9B 4GSWA 2JRHA 5BO4B 5JHAA 3VUWA 4MGKE 1F9JA 3OJ3A 2M17A 1WM2A 5HKHA 3PRZA 2BGFA 4HK2A 3ML8A 2ASQA 2JPHA 2OOBB 3B08A 1TGZB 2BYVE 1KJTA 3ML9A 3PRMB 2NPTB 3A33B 3ZNID 4CO7A 2FIFA 2ZCBA 3V6EB 4GDKA 3RZFA 4GIVA 3IHPC 1WGYA 2FIDA 2KFKA 3WAMA 5DPWA 3QAQA 2M1MA 3P2BA 2JZZA 4FJVB 3SHQA 4HLEA 4NQKE 3R3MA 2KC1A 2D07B 2MBEA 4E3CA 5FR6A 4MGZE 3ZVVA 3PSEB 4PYUA 1WY8A 1LQBA 4FBJB 3T9LA 1H4RA 4F1SA 4W9HA 2I1JA 5DPTA 3RYTA 1J0GA 3VQIA 2J0JA 2MWSB 2RGFA 3VH4B 2LUEA 3ONSA 4AJYB 1E7VA 2D3GA 2NS5A 4F7ZA 1YQBA 4W9KA 4PS3A 3L08A 2ZPYA 4K7UA 2IO0B 2Z0DB 4W9CA 4MJSA 4BFRA 2N9PC 1L2NA 2KD0A 2KMAA 4A3PA 2RSUA 4MEMA 2I1KA 3IG3A 3IBEA 4JLCA 3PS6A 2GBKA 1WGDA 4EZJA 3AXCA 3VXWA 4GN1A 5JZEB 2K8BA 4KIKB 2XK5A 3L0WB 3UGBB 3R66C 2D11A 1V86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9F A;  2EMT A;  3VHT C;  1K8R B;  2LZ6 A;  2LAS A;  2RD0 A;  3ZNG C;  4DK5 A;  1E7U A;  1WJ6 A;  2J0K A;  2KVR A;  4BBN F;  4YL8 A;  1WJN A;  3PTF C;  3UIN B;  1WYW B;  1R4M I;  4IWQ A;  4MM3 A;  2PE6 B;  2NR2 A;  4DXA B;  3RCZ A;  1E8Y A;  2FUH B;  4EOY A;  1P98 A;  3RUL A;  1EO6 A;  3L17 A;  1WGH A;  1IPG A;  1GG3 A;  4ZRJ A;  4WJN A;  2N7D A;  2PJH A;  4BKS A;  2D10 A;  4KZ0 A;  4PS7 A;  5J17 A;  3AUL A;  4AWJ A;  3K9P B;  5D2M B;  1KOT A;  5J2R A;  1SIF A;  2R2O A;  3DBS A;  5G55 A;  3WAL A;  2DYB A;  1L7Y A;  3IFW B;  2KDF B;  4I6N B;  2BWF A;  5E6O A;  3R7Q A;  3VH3 B;  2NBW B;  2EMS A;  2K1F A;  2ZPN A;  2NPT A;  2K6D B;  3DOW A;  1LFD A;  2LVO A;  4IM0 A;  2GBJ A;  3RT3 B;  4LJP B;  4AOF A;  2DX5 B;  1WX9 A;  3AU4 A;  4RMA A;  1JRU A;  1WZ3 A;  3MHS D;  3PPA A;  2MQJ A;  2DHZ A;  3T8M A;  2CU1 A;  3M63 B;  1XQQ A;  2ZVN A;  2J0M A;  2KAN A;  3OJ4 B;  4B95 A;  3DBR I;  3QQ8 B;  4ZRK A;  1EF5 A;  2DYO A;  1WFY A;  2FCN A;  3NY5 A;  1WX8 A;  4KV2 A;  1WRD B;  2MBB B;  2DYM A;  1WGG A;  2RPQ A;  2LI5 A;  3APF A;  3NZS A;  5E6P A;  4DWF A;  4W9D A;  1E8X A;  2DZK A;  2AL6 A;  3JSV B;  2A5U A;  4FHJ A;  4IWO A;  4RM8 A;  1IP9 A;  1GUA B;  4A20 A;  5AEK B;  1UH6 A;  4M8M A;  3TMP B;  4HWI B;  1GC7 A;  2FAZ A;  3R7R A;  2CKH B;  1YD8 U;  4GOC A;  2BYF A;  3LJ3 A;  5DPS A;  3QK0 A;  1I42 A;  2KTF A;  3VFK A;  3KUC B;  3OAW A;  4IM2 A;  1GNU A;  3A9K B;  1WIA A;  2LD9 A;  4G50 A;  2KQ7 A;  4ZYN A;  3PRP B;  2MLB A;  4FN2 A;  1WF9 A;  1WR1 A;  3RZW C;  3DBL I;  1VCB A;  1Z2M A;  2GBN A;  3U8Z A;  1WMH B;  2CS4 A;  1ZKH A;  2YVC A;  4KIK A;  3ZKJ C;  1KLV A;  3B0A A;  3TL5 A;  3ZW3 A;  2FCS A;  2N9X A;  3KYC D;  1WJU A;  3JW0 X;  4WWN A;  2KWC A;  1CMX B;  2NBV B;  4NPN A;  5JH5 C;  1Q5W B;  1Y8R C;  3W1Y A;  1P0R A;  3VVW B;  3QAR A;  1I35 A;  2EKE C;  5CHW A;  1D3Z A;  3KUZ A;  1E90 A;  3HM3 A;  3RUI B;  3OLM D;  2J7Q B;  2XBB C;  2AEH A;  3BIN A;  4IWP A;  1UD7 A;  3KVF B;  4EUT A;  2G3Q B;  2IBI B;  3PVL A;  1QZE A;  1J8C A;  3U30 A;  4W9L A;  3NHE B;  1WE6 A;  5LLI A;  3QCA A;  1V5O A;  1SGH A;  3LDZ E;  2BWE S;  2KX3 A;  3VAW A;  2LGD A;  4ANW A;  3N3K B;  3PLU A;  3PZD A;  1S3S G;  2GBR A;  2M0X A;  4PS8 A;  2ZCC A;  1XD3 B;  4KVG B;  4GXB A;  5KHQ A;  3A9J B;  1E8Z A;  4JGH B;  1OTR B;  3C0R B;  4BBN C;  4DBG A;  2W9N A;  2O2V B;  3N30 A;  4GU2 A;  3S2A A;  5AZG A;  2GMI C;  4PYZ A;  1H8C A;  3ZRF A;  1EF1 A;  4GGQ A;  2DZJ A;  2IZV B;  2UYZ B;  3QA8 A;  4NAW B;  4W9J A;  5DCN A;  3M95 A;  2K25 A;  1WXV A;  3APC A;  1J19 A;  2C7M B;  3GZN I;  2L0T A;  3NOB A;  3JSV A;  2V4L A;  3TBL D;  2REX A;  1V6E A;  2KJ6 A;  4MEL A;  1C3T A;  3CST A;  4K7W A;  4ZRI A;  4MDK E;  1NBF C;  4W9E A;  2QHO A;  3L13 A;  4E71 A;  3DBH I;  3B1L X;  5CHF A;  1WI0 A;  2LGX A;  4N9F 4;  2IYD B;  3L16 A;  4EZL A;  2N7E A;  1MG8 A;  2KOX A;  4WWP A;  5DPR A;  2BPS A;  2WYQ A;  3UQA A;  3K9O B;  3ZNZ B;  3WIM A;  2MSE D;  2KN5 A;  2IO3 B;  1XT9 B;  3A9K A;  1OQY A;  3M3J A;  4LCD E;  5CHV C;  4TKN A;  2KO3 A;  4FHK A;  2DEN B;  2BKF A;  3TCA A;  3ZNH B;  1UEL A;  4BKG A;  4II3 B;  1YX6 B;  4WAA A;  1WZ0 A;  3V60 A;  4MGY E;  3VUY A;  5LXH A;  1WMH A;  1IYF A;  3DVN V;  4DDI D;  5IAA C;  3PLV A;  2KWU B;  2JWZ A;  4DHZ E;  3KYD D;  5L95 C;  1TBE A;  2WDT B;  4WJP A;  4FLH A;  2L00 B;  1T0Y A;  3I3T B;  1ZGU B;  1P3Q U;  5TR5 A;  4BKT A;  2K8H A;  1NDD A;  1YX5 B;  2MP2 B;  3EHV A;  3PRE A;  1E8W A;  2NVU I;  4LJO B;  5G2N A;  1OGW A;  2L76 A;  4URK A;  2HTH A;  2L0F A;  4FAD A;  3M62 B;  1V81 A;  3SU8 X;  4B6W A;  1E5W A;  2KHW B;  2N4F A;  5JHB A;  1YJ1 A;  2CHW A;  5E6N A;  1KM7 A;  3VTU A;  2XEW A;  2LGY A;  3CF6 E;  1P9D U;  4E74 A;  3SDL C;  5C1Z A;  3H9D A;  5D7G A;  3ZDM C;  1RAX A;  2LJ5 A;  4IM3 A;  2A4Z A;  3W1S C;  1Q0W B;  3X0W A;  4EFO A;  4KSL C;  1M94 A;  4ZDV A;  1R4N I;  4HCN B;  2VRR B;  2G45 B;  4JL9 A;  5LXI B;  1V49 A;  3PT2 B;  2O6V D;  3DVG Y;  3KH0 A;  3A4R A;  4HDO A;  4K81 A;  2BF8 B;  3DVG X;  3WA0 A;  3NS8 A;  4OVV A;  3QWZ B;  1V80 A;  3A9J A;  2LXC A;  5L83 A;  3ENE A;  2KLG A;  2O2V A;  5D6J B;  3A1Q B;  2G4S A;  2DZM A;  1U4A A;  4IG7 B;  2C7N B;  1NI2 A;  3NZU A;  2HJ8 A;  3MJW A;  1V5T A;  2KC2 A;  2WX1 A;  4HPM B;  4M0W B;  4NAW A;  3ZIM A;  3KUD B;  2KDI A;  2KMC A;  2KK8 A;  3QJZ A;  3UIO B;  2KZR A;  4RM9 A;  2K8C A;  4TQ1 A;  3RD2 A;  1ZW7 A;  3ZUN A;  5J18 A;  4WJO A;  4NQL B;  2N1V A;  4F8C B;  4W9G A;  2WWZ A;  4CYE A;  2JVC A;  3HIZ A;  2N9E B;  2KJR A;  2CR5 A;  2KWV B;  3L10 B;  2KFJ A;  4II2 B;  2KDE B;  2MBH A;  1S1Q B;  4KDL B;  4W9I A;  4J6I A;  3U7D A;  2IY0 B;  4DHJ B;  3H7S A;  2K6Q A;  1WXA A;  4TV3 A;  4LDT B;  4ICU A;  3ALB A;  4FA6 A;  1GC6 A;  1VD2 A;  1WJ4 A;  3KW5 B;  1V2Y A;  3VTW A;  2L7R A;  3TIX A;  3D32 A;  3L54 A;  4XZ4 A;  4A3O A;  4I6P A;  2C9W B;  4BOS C;  1UBQ A;  1WM3 A;  4WQO B;  3V61 A;  1OEY A;  2IO1 B;  2ZEQ A;  1WE7 A;  2RR9 A;  3PHW B;  3ZDT A;  3UIP B;  4GDL B;  4CHK A;  1PQS A;  4NNJ B;  1V9J A;  1UBI A;  2IO2 B;  1UGM A;  2MP2 A;  1ISN A;  2M4N A;  2YLM A;  4ASW C;  4MGI E;  4ICV A;  3WAO A;  3AI5 A;  4AJW A;  2LRU A;  3PGE A;  1A5R A;  3H6N A;  2JXX A;  3PHX B;  1C1Y B;  1P1A A;  2JRI B;  3DCG A;  2L05 A;  1FXT B;  5AZF A;  3SD5 A;  1RFA A;  4HJK A;  3VTV A;  4FUL A;  1G6J A;  4NJ6 A;  1Q1O A;  2O6V B;  4K1R B;  4NJ7 A;  1WH3 A;  4X57 B;  3V62 A;  4IW0 A;  4K7S A;  4MSM B;  2MBO A;  3TJP A;  2JUO A;  1WXM A;  3BY4 B;  4HCP B;  4M8N A;  1YIW A;  2FCQ A;  2LRW A;  2C5L C;  2GOW A;  2KDB A;  2NCN A;  3W1S A;  4DDG D;  2JZ3 B;  1X1M A;  4FJY A;  2MX2 A;  2C7H A;  2C60 A;  2KX0 A;  1GJZ A;  2MCN B;  2ZNV C;  2V3S A;  3O65 B;  4TUU A;  2DAF A;  4ANX A;  2HD5 B;  4WWO A;  3A1Q A;  2ZNV B;  4B9K A;  1WX7 A;  1RRB A;  3VDZ A;  3H7P B;  3DDC B;  2KTR B;  2KXJ A;  5KHO A;  2G4D B;  2BYE A;  2HE7 A;  3EC8 A;  4EKU A;  1Z5S B;  4HPL B;  2LVP A;  2M8S A;  2KLC A;  2AYO B;  3Q3F A;  4DHJ D;  2UWQ A;  1BT0 A;  4P7I A;  2WX0 A;  4EEW A;  4KSK C;  4MH0 E;  5IA7 A;  4LDT D;  1LM8 B;  3ZO5 B;  3QX1 A;  2LXA A;  4GMV A;  4KDI C;  4XX5 A;  5CTR C;  3WAP A;  2PEA A;  2Y5B B;  4KZC A;  2Z59 B;  4G3X B;  3JVZ X;  3VUX A;  2JF5 A;  2MRP A;  2CHX A;  2KJH B;  4GDK B;  4BKS D;  2N1W A;  2Z0E B;  4JQW C;  2KFK B;  4HXD A;  4TQ0 A;  3PV1 A;  3QIJ A;  3CMM B;  3DVN U;  3ZTD A;  5EDS A;  2FCM A;  4I6L B;  3ZTC A;  4BOZ B;  4GDL A;  3ECI A;  5CX3 A;  1RLF A;  3WAN A;  1AAR A;  2BKR B;  1TTN A;  2JT4 B;  3QHT A;  3Q3J A;  2R2Q A;  3H1U A;  5C23 A;  3V6C B;  2KQS A;  2PPH A;  3IVF A;  4DHZ B;  4JIO U;  4OVU A;  2GBM A;  4XC2 A;  1LXD A;  2MW5 A;  3DQV A;  3MTN B;  1HE8 A;  2AWT A;  1TZ1 A;  3A4S C;  3AU5 A;  2O6V A;  4FJZ A;  3QC8 B;  4AUQ C;  2PE9 A;  4IC7 B;  4MJS B;  4ANU A;  3EFU A;  4HVB A;  3HHM A;  2DZI A;  2KKC A;  2IY1 B;  2D2Q A;  4BVU C;  2JY6 A;  2NBU A;  2ZZP B;  1WR6 E;  4G11 A;  3ZLZ A;  1OEY J;  4IUM B;  5AZH A;  4MSQ B;  3N32 A;  1WXS A;  2V1Y A;  2OJR A;  3APD A;  3UQB A;  3DPD A;  4ANV A;  1UZX B;  2L8J A;  2LVQ A;  2FNJ B;  2AL3 A;  2K39 A;  5GMV A;  2CHZ A;  3X23 A;  2XK5 B;  4HDQ A;  1SE9 A;  3JYU A;  4WJQ A;  3HM6 X;  2L3Z A;  2ZJD A;  3HK0 A;  4G0N B;  1WGR A;  5D94 A;  2MBQ A;  3ZRC A;  3EEC A;  3H7P A;  2LWP A;  4AP4 C;  2KTR A;  2ZVO A;  3CSF A;  3GOE A;  2B3A A;  4GB9 A;  3UF8 A;  4NY0 A;  2DAJ A;  4EZK A;  1EUV B;  2KNB A;  2MA9 B;  4GSW A;  2JRH A;  5BO4 B;  5JHA A;  3VUW A;  4MGK E;  1F9J A;  3OJ3 A;  2M17 A;  1WM2 A;  5HKH A;  3PRZ A;  2BGF A;  4HK2 A;  3ML8 A;  2ASQ A;  2JPH A;  2OOB B;  3B08 A;  1TGZ B;  2BYV E;  1KJT A;  3ML9 A;  3PRM B;  2NPT B;  3A33 B;  3ZNI D;  4CO7 A;  2FIF A;  2ZCB A;  3V6E B;  4GDK A;  3RZF A;  4GIV A;  3IHP C;  1WGY A;  2FID A;  2KFK A;  3WAM A;  5DPW A;  3QAQ A;  2M1M A;  3P2B A;  2JZZ A;  4FJV B;  3SHQ A;  4HLE A;  4NQK E;  3R3M A;  2KC1 A;  2D07 B;  2MBE A;  4E3C A;  5FR6 A;  4MGZ E;  3ZVV A;  3PSE B;  4PYU A;  1WY8 A;  1LQB A;  4FBJ B;  3T9L A;  1H4R A;  4F1S A;  4W9H A;  2I1J A;  5DPT A;  3RYT A;  1J0G A;  3VQI A;  2J0J A;  2MWS B;  2RGF A;  3VH4 B;  2LUE A;  3ONS A;  4AJY B;  1E7V A;  2D3G A;  2NS5 A;  4F7Z A;  1YQB A;  4W9K A;  4PS3 A;  3L08 A;  2ZPY A;  4K7U A;  2IO0 B;  2Z0D B;  4W9C A;  4MJS A;  4BFR A;  2N9P C;  1L2N A;  2KD0 A;  2KMA A;  4A3P A;  2RSU A;  4MEM A;  2I1K A;  3IG3 A;  3IBE A;  4JLC A;  3PS6 A;  2GBK A;  1WGD A;  4EZJ A;  3AXC A;  3VXW A;  4GN1 A;  5JZE B;  2K8B A;  4KIK B;  2XK5 A;  3L0W B;  3UGB B;  3R66 C;  2D11 A;  1V86 A; 
#chains in the Genus database with same CATH topology
 2EMT A;  3VHT C;  2LAS A;  1WJN A;  2NR2 A;  2ON8 A;  2D5G A;  2FUH B;  4LNN A;  1K53 A;  2GI9 A;  3MHZ A;  2N7D A;  4PS7 A;  4AWJ A;  3K9P B;  1KOT A;  1SIF A;  5G55 A;  3WAL A;  1E9M A;  3HVZ A;  2LHE A;  3V3X A;  2KDF B;  1GPX A;  2NBW B;  2K1F A;  2ZPN A;  2Z8L A;  1C4A A;  1LFD A;  3Q2A C;  3RT3 B;  2DX5 B;  1WX9 A;  3MHS D;  3PPA A;  3RNB C;  2IGG A;  3T8M A;  3M63 B;  2ZVN A;  1JAL A;  2J0M A;  2WXR A;  1XO3 A;  4B95 A;  1ZPS A;  4K3B A;  1EF5 A;  4ZRK A;  1QOF A;  2DYM A;  3APF A;  3HVD A;  1MJD A;  3JSV B;  1IP9 A;  4A20 A;  4IDI A;  1T0R C;  2KDM A;  1UH6 A;  2LFI A;  2QEJ C;  4M8M A;  1SIJ A;  4L2Y A;  1UUP A;  1KLU D;  3LJ3 A;  5DPS A;  4CQN A;  1I42 A;  3R2I A;  2RDH A;  3OAW A;  2QC8 A;  2MLB A;  2RMM A;  1YN5 A;  2YVC A;  1E0Z A;  2MH7 A;  1QIL A;  4RNA A;  3ZW3 A;  3KYC D;  2KWC A;  2SEB D;  2FUG 1;  3W1Y A;  3U52 E;  4YTM B;  5CHW A;  2NMQ A;  1PYW D;  3OLM D;  3BIN A;  4IWP A;  2AEH A;  1FFU A;  3W2D A;  1UD7 A;  3KVF B;  2G3Q B;  2IBI B;  5JXV A;  1J8C A;  3U30 A;  3AN1 A;  4HRS A;  2BS4 B;  1SGH A;  2KX3 A;  1YN3 A;  1XLO A;  3I57 A;  2D3C A;  1S3S G;  2LUM A;  2M0X A;  2ZCC A;  4KVG B;  2FE8 A;  1YN4 A;  4DBG A;  3C0R B;  2W9N A;  3S2A A;  4GU2 A;  1SE2 A;  1H8C A;  3ZRF A;  4GGQ A;  1Q10 A;  2UYZ B;  3QA8 A;  1PUT A;  3JSV A;  1QT9 A;  4M02 A;  4L1B A;  3TBL D;  1C3T A;  4K7W A;  4MDK E;  1J7A A;  3BVM A;  5CHF A;  2IYD B;  3L16 A;  2N7E A;  4NAM A;  1MG8 A;  1ET9 A;  1F2R I;  4WWP A;  5DPR A;  2BPS A;  2JSV X;  3U7Z A;  1XT9 B;  2VH1 A;  2KO3 A;  4FHK A;  2DEN B;  2BKF A;  4ARC A;  4II3 B;  1TS2 A;  1TY2 A;  1GAQ B;  3B2F A;  1IYF A;  4DDI D;  3PLV A;  2KWU B;  4DHZ E;  4FLH A;  2MP2 B;  1YX5 B;  3PRE A;  1E8W A;  2NVU I;  4P6V F;  1OGW A;  2L0F A;  2KHW B;  2N4F A;  2BS2 B;  1KM7 A;  4JWS C;  4E74 A;  5D7G A;  3ZDM C;  2LJ5 A;  3W1S C;  2KQ4 X;  4EFO A;  4ZDV A;  1R4N I;  2QDF A;  2JX5 A;  3PZ8 A;  5LXI B;  1V49 A;  3PT2 B;  2O6V D;  3DVG Y;  3KH0 A;  4OVV A;  1NEN B;  3QWZ B;  2GRI A;  3C8Y A;  3I5J C;  2DWQ A;  1PGB A;  2DZM A;  2C7N B;  1N6Z A;  2HJ8 A;  3AEA B;  3ZIM A;  1JQ4 A;  3GB1 A;  2KDI A;  3I63 C;  3UIO B;  2KZR A;  5J18 A;  1ZW7 A;  2AQ2 B;  1ENF A;  2GB1 A;  2JVC A;  2ZW0 A;  1FRD A;  2KFJ A;  2KDE B;  4J6I A;  4YT0 B;  2WXF A;  1TKG A;  2KAC A;  4JE3 B;  4WQO B;  3AED B;  2XN9 C;  2KWD A;  4XE0 A;  3AMZ A;  2RR9 A;  3PHW B;  3UIP B;  1KLG D;  2MP2 A;  1ISN A;  2M4N A;  1SSN A;  3WAO A;  3N20 C;  2JXX A;  3BZD B;  2WDV B;  3DCG A;  1FXT B;  4N58 A;  2K9X A;  3KWL A;  1WH3 A;  3AEB B;  4X57 B;  4K7S A;  2MBO A;  3FKY A;  4P1C C;  2JUO A;  2WU2 B;  2INC C;  2LRW A;  3W1S A;  1XLP A;  2QMT A;  2MX2 A;  2Y5P A;  2KX0 A;  2IDY A;  4DQO C;  2K22 A;  3RPF C;  4ANX A;  4WWO A;  2G4D B;  2EKI A;  1C79 A;  4YWG G;  4AQ7 A;  2UWQ A;  4KSK C;  3FC4 A;  1XCQ L;  5BMH A;  1GB1 A;  2K3U A;  3GE8 C;  2W82 A;  2WNM A;  2Y5B B;  2JZP A;  4QAY A;  3JVZ X;  4GDK B;  4BKS D;  4TQ0 A;  4HXD A;  4KKI A;  3ZTD A;  2FCM A;  2XNA C;  2ICI A;  3NG0 A;  3ECI A;  5CX3 A;  3WAN A;  1V97 A;  3IXS A;  1QQR A;  2R2Q A;  2PPH A;  4ZRQ A;  4ACF A;  4LNF A;  3BII D;  2W55 A;  1NVI D;  4YSZ B;  4IC7 B;  1PGA A;  2WGS A;  1QF6 A;  4G11 A;  4IUM B;  1WXS A;  3APD A;  2AX5 A;  2CHZ A;  1BML C;  2XK5 B;  3ZXV A;  1PDX A;  2PW9 A;  2WXJ A;  3AEC B;  2INP E;  2MA9 B;  4GSW A;  2CJN A;  3OJ3 A;  1JRP A;  5HKH A;  2JPH A;  3A33 B;  2FIF A;  2HDE A;  4RGT A;  4GDK A;  2N0S B;  3RZF A;  2NTT A;  2M1M A;  5BMI A;  2JZZ A;  4FJV B;  5H92 C;  4OHJ A;  4FBJ B;  1LQB A;  2PVG C;  3IT6 B;  4F1S A;  3RYT A;  3VQI A;  2J0J A;  4ZHP A;  2RGF A;  1VZ7 A;  3ONS A;  1E7V A;  3L08 A;  4K7U A;  2Z0D B;  4BFR A;  2N9P C;  1TT5 B;  1P7F A;  2GBK A;  1V1O A;  4EZJ A;  4ITK A;  2LJI A;  4YTN B;  1CK1 A;  2XK5 A;  4KKJ A;  2D11 A;  4W9F A;  1F0Z A;  1E7U A;  2J0K A;  2KVR A;  3EGR A;  1HXY D;  3RUL A;  1EO6 A;  1HZ5 A;  4ZRJ A;  2BVC A;  1AW7 A;  1TKY A;  2PJH A;  1FXA A;  3DBS A;  5E6O A;  3R7Q A;  3P4R B;  4WUR A;  2K6D B;  2LVO A;  3SEB A;  2BBC A;  4HKZ E;  2GBJ A;  4M00 A;  4AOF A;  5GXG B;  2MQJ A;  3GE3 C;  1XQQ A;  1L6U A;  1L5P A;  1T0S C;  2FCN A;  3NY5 A;  1WRD B;  3KWV A;  5E6P A;  2RPQ A;  3RN9 C;  4W9D A;  1QKZ A;  1E8X A;  2AL6 A;  4IWO A;  2V0G A;  4LNI A;  4HWI B;  1GC7 A;  1YD8 U;  4GOC A;  2RPV A;  1IGD A;  3VFK A;  4IM2 A;  3PO0 A;  2LD9 A;  2OED A;  4WQM A;  2D3A A;  1TIF A;  2BTE A;  2KT7 A;  1WF9 A;  3DBL I;  1VCB A;  5IO9 A;  3U8Z A;  1WSP A;  2WQY B;  1KLV A;  3ZKJ C;  4RGM A;  3TL5 A;  2N9X A;  1WJU A;  1HA5 A;  4WWN A;  2IGH A;  3AEG B;  4C7Y A;  4NPN A;  1Q5W B;  1Y8R C;  1P0R A;  3VVW B;  3QAR A;  1I35 A;  2EKE C;  1D3Z A;  3KUZ A;  1RM6 C;  2WXQ A;  3MC0 B;  3PVL A;  4W9L A;  1VZ8 A;  5LLI A;  3QCA A;  1FXI A;  3RMK C;  2LGD A;  3SR6 A;  3N3K B;  3PLU A;  3PZD A;  2GBR A;  1QOA A;  1F52 A;  3Q6B A;  3KQ4 A;  3A9J B;  1E8Z A;  3ZJU A;  5E6J A;  2O2V B;  1FM0 D;  5AZG A;  1EF1 A;  1JML A;  2IZV B;  4NAW B;  1HTO A;  2VZK B;  5DCN A;  3M95 A;  3APC A;  2C7M B;  3GZN I;  2L0T A;  3NOB A;  4W9E A;  3L13 A;  4RFB A;  3B1L X;  5IOI A;  2PLP A;  3UQA A;  3K9O B;  4J3O D;  2IO3 B;  1AWD A;  4IOI E;  4C4V B;  4BKG A;  4WAA A;  3V60 A;  4MGY E;  3VUY A;  3DVN V;  3KYD D;  2WDT B;  4WJP A;  3EFC A;  4C7Z A;  1PGX A;  4RCO A;  4LJO B;  2J42 A;  3W5V B;  3M62 B;  1JRO A;  1V81 A;  4HRO A;  3URY A;  5JHB A;  1YJ1 A;  1CQV A;  3AE4 B;  1P9D U;  1V8C A;  3SDL C;  5C1Z A;  1RAX A;  2JYT A;  4IM3 A;  2A4Z A;  3X0W A;  4KSL C;  1SJH D;  1QLB B;  1YQ4 B;  1TJE A;  1NYR A;  4K81 A;  3WA0 A;  3DVG X;  3NS8 A;  3Q8E A;  1V80 A;  2VZK D;  2H89 B;  3A9J A;  2K0P A;  3DWG C;  5L83 A;  3BYT B;  3ENE A;  2O2V A;  2G4S A;  4IG7 B;  2RDB C;  4NAW A;  1B1Z A;  1V5T A;  2KC2 A;  2WX1 A;  5AUI A;  3AEE B;  2KMC A;  2JXT A;  2KK8 A;  3EA6 A;  4TQ1 A;  3ZUN A;  3IT4 B;  4HJG E;  1HZ6 A;  3E56 A;  4W9G A;  2N9E B;  2KWV B;  2MBH A;  1MHH E;  1S1Q B;  2MEK A;  3ZGZ A;  3U7D A;  4TV3 A;  1VD2 A;  2RDG A;  1V2Y A;  4C4V A;  1SBB B;  3VTW A;  3L54 A;  4I6P A;  3V61 A;  2W3S A;  2IO1 B;  2ZEQ A;  1WE7 A;  1VLB A;  1K51 A;  3RNG C;  2TSS A;  4TMA B;  3H8H A;  1UBI A;  4ASW C;  1BUI C;  3PGE A;  3PHX B;  1GOZ A;  2L05 A;  5AZF A;  1RFA A;  1G6J A;  4LTU A;  2O6V B;  5HG2 A;  1ZDV A;  2LMC A;  4MSM B;  3Q3N C;  1E7P B;  3BY4 B;  3MFG A;  4M8N A;  2WU5 B;  3MC9 A;  5TSS A;  4DDG D;  1X1M A;  4D2K A;  4FJY A;  2C7H A;  3TSS A;  2MCN B;  2PKO A;  2V3S A;  1F77 A;  1RYJ A;  4XGA B;  1RRB A;  1WRI A;  3VDZ A;  3H7P B;  5C2T B;  2KTR B;  5KHO A;  2HE7 A;  2BYE A;  1Z5S B;  3Q8B A;  1TS3 A;  2KLC A;  4HPP A;  3Q3F A;  3QX1 A;  2LXA A;  4GMV A;  3LB8 C;  1WGK A;  2PEA A;  4G3X B;  1HTQ A;  3AB5 A;  2KJH B;  4GLS C;  4N59 A;  2Z0E B;  1FMA D;  3PV1 A;  3CMM B;  4JPS A;  2L32 A;  1ZUD 2;  3ZTC A;  3BVG A;  2BKR B;  3QHT A;  1JWA D;  3N1X C;  3N1Y C;  3MJ5 A;  4Q2J A;  4DHZ B;  2GBM A;  2HTM E;  4LNO A;  1TZ1 A;  3NVY A;  2O6V A;  4AUQ C;  2B76 B;  4MJS B;  3GZN B;  4YXD B;  2QCZ A;  2IY1 B;  2NBU A;  1WR6 E;  3B9J A;  4ZOH C;  3P63 A;  2K39 A;  4S0R A;  5IP4 D;  2LEK A;  1AYF A;  1VJK A;  4AS1 A;  4TSS A;  4WAF A;  3JYU A;  4NJC A;  3HK0 A;  4G0N B;  2L1A A;  3EEC A;  1ZXI A;  3H7P A;  2LWP A;  3Q8C A;  2Y3A A;  2KTR A;  2ZVO A;  4GB9 A;  2DAJ A;  2BT6 A;  4A55 A;  2JRH A;  2I38 A;  3VUW A;  2QIL A;  4OVZ A;  4MGK E;  1IUE A;  4WWM A;  3PRZ A;  2BGF A;  3ML8 A;  2ASQ A;  1DOI A;  1KJT A;  3ZNI D;  2ZCB A;  2OHF A;  3KLS X;  1WGY A;  1D6E C;  1T3Q A;  1ZDX A;  1HEZ E;  2VH2 A;  5FR6 A;  4MGZ E;  2G1E A;  1YOV B;  4PYU A;  3T3O A;  1ZXH A;  3T9L A;  3NVV A;  2I1J A;  5AUK A;  3AE5 B;  1LO5 D;  2H88 B;  2LUE A;  4LK0 M;  1YQB A;  4C80 A;  4W9K A;  4F7Z A;  3TEW A;  2ZPY A;  4MJS A;  1AN8 A;  4OZB A;  3V05 A;  1L2N A;  2KD0 A;  4LLG M;  2KMA A;  4A3P A;  2RSU A;  4MEM A;  3IBE A;  3DHH C;  1L0Y B;  1WGD A;  3AXC A;  3VXW A;  1UNS A;  5JZE B;  2K8B A;  4KIK B;  3UGB B;  1V86 A;  4DK5 A;  1PFD A;  1WJ6 A;  4BBN F;  3CIR B;  1NYQ A;  3PTF C;  1C4C A;  4IWQ A;  1VDV A;  1MG4 A;  1WGH A;  2EEL A;  1GG3 A;  2WDQ B;  1JWM D;  1MVK A;  4WJN A;  4BKS A;  2D10 A;  5D2M B;  1KH0 A;  2IGD A;  2R2O A;  2DYB A;  3IFW B;  3VR9 B;  4I6N B;  4A8X C;  2BWF A;  3VH3 B;  4IM0 A;  4KGS A;  4C56 C;  2CU1 A;  3OJ4 B;  3QQ8 B;  2DYO A;  1WFY A;  3NZS A;  4DWF A;  1WGG A;  2N9K A;  5BYR A;  4RM8 A;  2A5U A;  4FHJ A;  1F2R C;  2W3R A;  2D3B A;  1C78 A;  3TMP B;  2FAZ A;  3R7R A;  2CKH B;  2WP9 B;  1N60 A;  1J7C A;  3O13 A;  3RNE C;  2KTF A;  2BQQ A;  2DNF A;  1GNU A;  3FIL B;  2KQ7 A;  1HQR D;  4FN2 A;  1T6B X;  1Z2M A;  2GBN A;  4KIK A;  1RWS A;  3P4P B;  1TS5 A;  1KFY B;  2NBV B;  1B9R A;  3U4E G;  1P7E A;  3ZQ4 A;  3HM3 A;  2J7Q B;  1MFW A;  1QZE A;  2E6X A;  4XWT A;  3NZ3 A;  1R4N B;  1WE6 A;  1V5O A;  2BB6 A;  4ZHO A;  4WIP A;  3P42 A;  1XD3 B;  4GXB A;  5KHQ A;  4BBN C;  1OTR B;  1JWU D;  3B2G A;  2GMI C;  2DZJ A;  2N9L A;  4W9J A;  2K25 A;  1J19 A;  2REX A;  2KJ6 A;  2V3P A;  4ZRI A;  2QHO A;  3E9S A;  3DBH I;  2LGX A;  3AE9 B;  4EZL A;  2I2Y A;  1XF5 L;  2PIA A;  3RNF C;  3FIL A;  4LCD E;  1V1P B;  3TCA A;  3ZNH B;  2R61 A;  4PT5 A;  1WZ0 A;  3NJT A;  5LXH A;  1FNV A;  1DOY A;  1JCK B;  3BYY B;  2JWZ A;  1MPE A;  5L95 C;  1T0Y A;  1P3Q U;  5TR5 A;  2K8H A;  1NDD A;  3EHV A;  3GP7 A;  2L76 A;  2WHI A;  2HTH A;  2JWU A;  1JWS D;  1Y56 A;  3SU8 X;  1E5W A;  2CHW A;  1YJI A;  5E6N A;  2XEW A;  2LGY A;  2GLS A;  3HUI A;  3H9D A;  1TZO A;  1FIQ A;  1M94 A;  1SEB D;  2G45 B;  4HEA 1;  1I4R A;  2BF8 B;  1FCL A;  2NTS A;  4ARI A;  2LXC A;  2KLG A;  2V4I B;  4YSY B;  5D6J B;  3A1Q B;  1D5Z C;  3ETR A;  3NZU A;  4M0W B;  4HPM B;  3BWU D;  3KUD B;  3DHG C;  2IJ0 A;  3BVZ A;  3QJZ A;  3RD2 A;  3RI7 C;  4JX1 C;  4F8C B;  1VZ6 A;  2CR5 A;  4KDL B;  3L10 B;  4DHJ B;  5D3I B;  2K6Q A;  4ICU A;  3ALB A;  3Q8A A;  1GC6 A;  2AQ1 B;  3KW5 B;  1K50 A;  3DWM A;  3TIX A;  3I9V 1;  1V1P A;  3SFE B;  3Q3O C;  2SAK A;  3RNC C;  2BYT A;  4BOS C;  2WXK A;  1WM3 A;  4YTP B;  3ZDT A;  4GDL B;  4CHK A;  1PQS A;  1V9J A;  1UGM A;  1C77 A;  1STE A;  5FR3 A;  5BYQ A;  3AI5 A;  4A6Q A;  2LRU A;  4AJW A;  1A5R A;  1SE4 A;  1P1A A;  4US8 A;  2WXI A;  4YSX B;  2DLB A;  3VTV A;  4FUL A;  4OZA A;  4K1R B;  1WXM A;  4HCP B;  2LHD A;  4KGT A;  2GOW A;  2KDB A;  1ZE3 D;  1XEE A;  1L4D B;  4RH6 A;  1TS4 A;  1EWY C;  3ZJT A;  2X8X X;  2OJW A;  3W5U B;  4TUU A;  2DAF A;  1DGJ A;  2HD5 B;  2QSD A;  3A1Q A;  1I7H A;  1FNU A;  2J4X A;  2WS3 B;  2KXJ A;  3LYY A;  4FXC A;  2LVP A;  3MC8 A;  1L4Z B;  4REZ A;  4DHJ D;  2LGS A;  4RF0 A;  4P7I A;  1OFF A;  4MH0 E;  5IA7 A;  2LGI A;  3ZO5 B;  4XX5 A;  3WAP A;  3N1Z C;  4M01 A;  3WCQ A;  2Z59 B;  1E10 A;  2PMV A;  2CHX A;  2N1W A;  1ACC A;  4LNK A;  3T3N A;  5LNK 1;  4B0E A;  1T0Q C;  1EM7 A;  4BOZ B;  3AH7 A;  4GDL A;  2E3T A;  2QJL A;  1FCC C;  1OQR A;  3Q3J A;  5FK9 C;  1N5X A;  3IVF A;  4DXG A;  4JIO U;  3NVZ A;  2KYW A;  2MW5 A;  3DQV A;  1HE8 A;  3VRA B;  2WXH A;  1RFK A;  4OW0 A;  1N63 A;  1SB3 C;  3BK2 A;  3QC8 B;  2PE9 A;  4ANU A;  3TEZ A;  2D2Q A;  1GB4 A;  1OEY J;  5IKC M;  3N32 A;  3DBH B;  3UQB A;  3DPD A;  4ANV A;  1UZX B;  2L8J A;  2LVQ A;  2MJD A;  2AL3 A;  2L52 A;  2J53 A;  1FD6 A;  5D94 A;  2JQR B;  4MM3 B;  1LGR A;  2WXN A;  3GOE A;  2B3A A;  5BO4 B;  5JHA A;  4US9 A;  1KF6 B;  1F9J A;  2YEP B;  4MAC A;  4MT5 A;  2CJO A;  1WM2 A;  3Q14 C;  4HK2 A;  2BB5 A;  2OOB B;  3B08 A;  2BYV E;  1IGC A;  3ML9 A;  2NPT B;  4CO7 A;  4PK1 A;  3V6E B;  3DHI C;  1N5W A;  3QAQ A;  3P2B A;  3GS2 A;  1L0V B;  4C00 A;  2ZW1 A;  3R3M A;  4NQK E;  2KC1 A;  3U2S C;  2D07 B;  2MBE A;  1ZOY B;  1H4R A;  4W9H A;  4XDD A;  1J0G A;  3UI3 A;  2MWS B;  1I4G A;  2INN E;  2CU3 A;  1XXG A;  4AJY B;  2NS5 A;  1FFV A;  1WYG A;  4H2A A;  3IG3 A;  5HFY A;  4JLC A;  3DBL B;  4UDU C;  2BS3 B;  3MP9 A;  2WXG A;  2WXL A;  4GN1 A;  2KN4 A;  1EU4 A;  3L0W B;  3SFD B;  3TEY A;  1K8R B;  2LZ6 A;  2RD0 A;  3ZNG C;  4YL8 A;  1N62 A;  3UIN B;  3R8B A;  1WYW B;  3C19 A;  1R4M I;  4MM3 A;  2PE6 B;  4DXA B;  1D5X C;  1E8Y A;  3RCZ A;  4EOY A;  1P98 A;  2IPK D;  1SF0 A;  3L17 A;  3TUO A;  1IPG A;  4KZ0 A;  5J17 A;  3AUL A;  5J2R A;  4BAX A;  1I4P A;  1L7Y A;  3EUB 2;  1F1H A;  1C76 A;  2EMS A;  4KX6 B;  2NPT A;  3NS1 A;  3DOW A;  4XWW A;  1ESF A;  2IND C;  4LJP B;  3AU4 A;  4P1B C;  4RMA A;  1JRU A;  4B0M A;  1WZ3 A;  1ZP0 B;  2DHZ A;  2WLB A;  1D5M C;  1UF0 A;  2KAN A;  3DBR I;  2Q5W D;  4KV2 A;  1WX8 A;  4ZRP A;  2MBB B;  2LI5 A;  1I4X A;  2KAJ A;  2L83 A;  5I4D A;  1VRA B;  2DZK A;  2WXM A;  3IAM 1;  1GUA B;  2FBW B;  3LXF A;  4USA A;  5AEK B;  2W54 A;  1IBX B;  2PVO D;  5H8Y E;  2BYF A;  2KMM A;  3OWE B;  3QK0 A;  5IN7 A;  4L23 A;  3KUC B;  4S17 A;  3A9K B;  1WIA A;  4G50 A;  3TEX A;  4ZYN A;  3PRP B;  1WR1 A;  3RZW C;  1WMH B;  2CS4 A;  1ZKH A;  3VR8 B;  1FNW A;  3B0A A;  2FCS A;  3Q8F A;  3JW0 X;  1CMX B;  5JH5 C;  1UWX A;  4MH8 A;  4N6E B;  1CZP A;  1E90 A;  3FAH A;  3RUI B;  2XBB C;  3PZ7 A;  3L4P A;  4EUT A;  3NHE B;  3IAS 1;  1L0X B;  3LDZ E;  2BWE S;  4XDC A;  5HHD G;  3VAW A;  4ANW A;  2QIE B;  4PS8 A;  3W9C B;  3AE1 B;  4JGH B;  1QOG A;  3N30 A;  2ACZ B;  1FRR A;  5EE0 A;  4PYZ A;  2MHJ A;  1WXV A;  2KVZ A;  4JWU C;  2PTL A;  2V4L A;  1V6E A;  4MEL A;  3CST A;  1NBF C;  4E71 A;  2DBY A;  1IBX A;  1SXT A;  1WI0 A;  1J7B A;  4N9F 4;  1TKE A;  2KOX A;  2WYQ A;  3ZNZ B;  3WIM A;  4R3D A;  2MSE D;  2KN5 A;  3A9K A;  1OQY A;  2G9H D;  3M3J A;  5CHV C;  4TKN A;  4RGN A;  4IKG A;  1UEL A;  1CJE A;  1YX6 B;  1WMH A;  3AE8 B;  5IAA C;  1TBE A;  1NEK B;  2L00 B;  3I3T B;  1ZGU B;  5D3D A;  1DOX A;  4BKT A;  1R7S A;  5G5H A;  1M4V A;  2N7J A;  5G2N A;  4URK A;  4A9A A;  2BW2 A;  4FAD A;  3P1M A;  4B6W A;  3ZXR A;  3VTU A;  3CF6 E;  1N61 A;  3ZYY X;  2JU6 X;  5EE1 A;  5EE9 A;  4NZL B;  1DYQ A;  1Q0W B;  4RGO S;  4HCN B;  2VRR B;  4JL9 A;  2M56 B;  3A4R A;  4HDO A;  3BK1 A;  3AEF B;  3N9Y C;  1K52 A;  1U4A A;  1A70 A;  1NI2 A;  3MJW A;  2ONQ A;  4RM9 A;  2K8C A;  4WJO A;  4NQL B;  2N1V A;  3NVW A;  4O1N A;  2WWZ A;  4CYE A;  2WXP A;  3HIZ A;  2KJR A;  4II2 B;  4W9I A;  1R4M B;  2IY0 B;  3H7S A;  4ZYS A;  1WXA A;  4LDT B;  4FA6 A;  1WJ4 A;  4DXF A;  1VR9 A;  2L7R A;  2UU7 A;  3D32 A;  4XZ4 A;  4A3O A;  2C9W B;  1UBQ A;  4EE2 A;  1OEY A;  2MJ3 A;  3AV8 A;  4NNJ B;  2IO2 B;  2YLM A;  3AE2 B;  1ET6 A;  4WH4 A;  4MGI E;  4ICV A;  3H6N A;  2WDR B;  1D4B A;  1C1Y B;  2JRI B;  1XLN A;  3SD5 A;  2JYE A;  3RFZ B;  3DBR B;  4HJK A;  4NJ6 A;  1Q1O A;  1XLQ A;  4HKQ A;  4NJ7 A;  3V62 A;  4IW0 A;  2X38 A;  3TJP A;  1C4P A;  1YIW A;  1WXQ A;  1YMH E;  2FCQ A;  2C5L C;  1MI0 A;  2NCN A;  2J52 A;  2JZ3 B;  3ABV B;  2C60 A;  3OG5 A;  1GJZ A;  2ZNV C;  3O65 B;  2ZNV B;  1YNT E;  1QOB A;  4P16 A;  4B9K A;  3NRZ A;  1WX7 A;  3DDC B;  1UGJ A;  3EC8 A;  4EKU A;  2V9H A;  4HPL B;  3VRB B;  2HJ1 A;  3CWI A;  2M8S A;  5G5G A;  2AYO B;  1BT0 A;  2WX0 A;  4EEW A;  4LDT D;  1LM8 B;  2M0A A;  4KDI C;  5CTR C;  4KZC A;  4RF1 A;  5HI1 A;  3VUX A;  2JF5 A;  2MRP A;  4JQW C;  2KFK B;  3R2T A;  3AE7 B;  3QIJ A;  1FEH A;  3DVN U;  1BXT A;  5EDS A;  4I6L B;  1WWT A;  1RLF A;  1AAR A;  1JWB D;  1TTN A;  2JT4 B;  5FKA C;  3H1U A;  5C23 A;  3V6C B;  2KQS A;  3AE6 B;  1TY0 A;  4K3C A;  1FO4 A;  1SJE D;  4OVU A;  4XC2 A;  5BYS A;  1LXD A;  3MTN B;  2AWT A;  3A4S C;  3AU5 A;  4BZA A;  4FJZ A;  4A90 A;  3Q69 A;  3EFU A;  4HVB A;  5BMG A;  3HHM A;  2DZI A;  1NI3 A;  2KKC A;  4BVU C;  2JY6 A;  2ZZP B;  1EWC A;  3ZLZ A;  5AZH A;  4MSQ B;  2V1Y A;  2OJR A;  2FNJ B;  5GMV A;  3X23 A;  1T5X D;  4HDQ A;  1SE9 A;  5MPO A;  4WJQ A;  3HM6 X;  2L3Z A;  2ZJD A;  1WGR A;  2MBQ A;  4XYC A;  3ZRC A;  1FPY A;  1OQQ A;  3AE3 B;  1EU3 A;  3NUH B;  2WXO A;  4AP4 C;  2AQ3 B;  3CSF A;  3UF8 A;  5C3J B;  4EZK A;  4NY0 A;  1EUV B;  1I4H A;  2KNB A;  2M19 A;  3Q3M C;  2M17 A;  4KGR A;  2MJE A;  3AM9 A;  1TGZ B;  3PRM B;  4GIV A;  3IHP C;  2FID A;  2KFK A;  3WAM A;  5DPW A;  3SHQ A;  4HLE A;  2YEP F;  3P4S B;  1TYG B;  5T8I A;  4E3C A;  3ZVV A;  1KRH A;  3PSE B;  1WY8 A;  3RNA C;  1E6E B;  5DPT A;  3J9C A;  3VH4 B;  2K5P A;  5EE3 A;  1L6V A;  2D3G A;  2Y5C A;  3ZJV A;  1JW9 D;  4PS3 A;  1C9F A;  4W9C A;  2IO0 B;  4M0W A;  4OZC A;  1KTK A;  1MHX A;  3P4Q B;  2I1K A;  1ROE A;  2V3N A;  3PS6 A;  1XCT L;  3HRD D;  1YJJ A;  1I4Q A;  1YQ3 B;  1UWM A;  1SE3 A;  3R66 C; 
#chains in the Genus database with same CATH homology
 4W9F A;  2EMT A;  3VHT C;  1K8R B;  2LZ6 A;  2LAS A;  2RD0 A;  3ZNG C;  4DK5 A;  1E7U A;  1WJ6 A;  2J0K A;  2KVR A;  4BBN F;  4YL8 A;  1WJN A;  3PTF C;  3UIN B;  1WYW B;  1R4M I;  4IWQ A;  4MM3 A;  2PE6 B;  2NR2 A;  4DXA B;  3RCZ A;  1E8Y A;  2FUH B;  4EOY A;  1P98 A;  3RUL A;  1EO6 A;  3L17 A;  1WGH A;  1IPG A;  1GG3 A;  4ZRJ A;  4WJN A;  2N7D A;  2PJH A;  4BKS A;  2D10 A;  4KZ0 A;  4PS7 A;  5J17 A;  3AUL A;  4AWJ A;  3K9P B;  5D2M B;  1KOT A;  5J2R A;  1SIF A;  2R2O A;  3DBS A;  5G55 A;  3WAL A;  2DYB A;  1L7Y A;  3IFW B;  2KDF B;  4I6N B;  2BWF A;  5E6O A;  3R7Q A;  3VH3 B;  2NBW B;  2EMS A;  2K1F A;  2ZPN A;  2NPT A;  2K6D B;  3DOW A;  1LFD A;  2LVO A;  4IM0 A;  2GBJ A;  3RT3 B;  4LJP B;  4AOF A;  2DX5 B;  1WX9 A;  3AU4 A;  4RMA A;  1JRU A;  1WZ3 A;  3MHS D;  3PPA A;  2MQJ A;  2DHZ A;  3T8M A;  2CU1 A;  3M63 B;  1XQQ A;  2ZVN A;  2J0M A;  2KAN A;  3OJ4 B;  4B95 A;  3DBR I;  3QQ8 B;  4ZRK A;  1EF5 A;  2DYO A;  1WFY A;  2FCN A;  3NY5 A;  1WX8 A;  4KV2 A;  1WRD B;  2MBB B;  2DYM A;  1WGG A;  2RPQ A;  2LI5 A;  3APF A;  3NZS A;  5E6P A;  4DWF A;  4W9D A;  1E8X A;  2DZK A;  2AL6 A;  3JSV B;  2A5U A;  4FHJ A;  4IWO A;  4RM8 A;  1IP9 A;  1GUA B;  4A20 A;  5AEK B;  1UH6 A;  4M8M A;  3TMP B;  4HWI B;  1GC7 A;  2FAZ A;  3R7R A;  2CKH B;  1YD8 U;  4GOC A;  2BYF A;  3LJ3 A;  5DPS A;  3QK0 A;  1I42 A;  2KTF A;  3VFK A;  3KUC B;  3OAW A;  4IM2 A;  1GNU A;  3A9K B;  1WIA A;  2LD9 A;  4G50 A;  2KQ7 A;  4ZYN A;  3PRP B;  2MLB A;  4FN2 A;  1WF9 A;  1WR1 A;  3RZW C;  3DBL I;  1VCB A;  1Z2M A;  2GBN A;  3U8Z A;  1WMH B;  2CS4 A;  1ZKH A;  2YVC A;  4KIK A;  3ZKJ C;  1KLV A;  3B0A A;  3TL5 A;  3ZW3 A;  2FCS A;  2N9X A;  3KYC D;  1WJU A;  3JW0 X;  4WWN A;  2KWC A;  1CMX B;  2NBV B;  4NPN A;  5JH5 C;  1Q5W B;  1Y8R C;  3W1Y A;  1P0R A;  3VVW B;  3QAR A;  1I35 A;  2EKE C;  5CHW A;  1D3Z A;  3KUZ A;  1E90 A;  3HM3 A;  3RUI B;  3OLM D;  2J7Q B;  2XBB C;  2AEH A;  3BIN A;  4IWP A;  1UD7 A;  3KVF B;  4EUT A;  2G3Q B;  2IBI B;  3PVL A;  1QZE A;  1J8C A;  3U30 A;  4W9L A;  3NHE B;  1WE6 A;  5LLI A;  3QCA A;  1V5O A;  1SGH A;  3LDZ E;  2BWE S;  2KX3 A;  3VAW A;  2LGD A;  4ANW A;  3N3K B;  3PLU A;  3PZD A;  1S3S G;  2GBR A;  2M0X A;  4PS8 A;  2ZCC A;  1XD3 B;  4KVG B;  4GXB A;  5KHQ A;  3A9J B;  1E8Z A;  4JGH B;  1OTR B;  3C0R B;  4BBN C;  4DBG A;  2W9N A;  2O2V B;  3N30 A;  4GU2 A;  3S2A A;  5AZG A;  2GMI C;  4PYZ A;  1H8C A;  3ZRF A;  1EF1 A;  4GGQ A;  2DZJ A;  2IZV B;  2UYZ B;  3QA8 A;  4NAW B;  4W9J A;  5DCN A;  3M95 A;  2K25 A;  1WXV A;  3APC A;  1J19 A;  2C7M B;  3GZN I;  2L0T A;  3NOB A;  3JSV A;  2V4L A;  3TBL D;  2REX A;  1V6E A;  2KJ6 A;  4MEL A;  1C3T A;  3CST A;  4K7W A;  4ZRI A;  4MDK E;  1NBF C;  4W9E A;  2QHO A;  3L13 A;  4E71 A;  3DBH I;  3B1L X;  5CHF A;  1WI0 A;  2LGX A;  4N9F 4;  2IYD B;  3L16 A;  4EZL A;  2N7E A;  1MG8 A;  2KOX A;  4WWP A;  5DPR A;  2BPS A;  2WYQ A;  3UQA A;  3K9O B;  3ZNZ B;  3WIM A;  2MSE D;  2KN5 A;  2IO3 B;  1XT9 B;  3A9K A;  1OQY A;  3M3J A;  4LCD E;  5CHV C;  4TKN A;  2KO3 A;  4FHK A;  2DEN B;  2BKF A;  3TCA A;  3ZNH B;  1UEL A;  4BKG A;  4II3 B;  1YX6 B;  4WAA A;  1WZ0 A;  3V60 A;  4MGY E;  3VUY A;  5LXH A;  1WMH A;  1IYF A;  3DVN V;  4DDI D;  5IAA C;  3PLV A;  2KWU B;  2JWZ A;  4DHZ E;  3KYD D;  5L95 C;  1TBE A;  2WDT B;  4WJP A;  4FLH A;  2L00 B;  1T0Y A;  3I3T B;  1ZGU B;  1P3Q U;  5TR5 A;  4BKT A;  2K8H A;  1NDD A;  1YX5 B;  2MP2 B;  3EHV A;  3PRE A;  1E8W A;  2NVU I;  4LJO B;  5G2N A;  1OGW A;  2L76 A;  4URK A;  2HTH A;  2L0F A;  4FAD A;  3M62 B;  1V81 A;  3SU8 X;  4B6W A;  1E5W A;  2KHW B;  2N4F A;  5JHB A;  1YJ1 A;  2CHW A;  5E6N A;  1KM7 A;  3VTU A;  2XEW A;  2LGY A;  3CF6 E;  1P9D U;  4E74 A;  3SDL C;  5C1Z A;  3H9D A;  5D7G A;  3ZDM C;  1RAX A;  2LJ5 A;  4IM3 A;  2A4Z A;  3W1S C;  1Q0W B;  3X0W A;  4EFO A;  4KSL C;  1M94 A;  4ZDV A;  1R4N I;  4HCN B;  2VRR B;  2G45 B;  4JL9 A;  5LXI B;  1V49 A;  3PT2 B;  2O6V D;  3DVG Y;  3KH0 A;  3A4R A;  4HDO A;  4K81 A;  2BF8 B;  3DVG X;  3WA0 A;  3NS8 A;  4OVV A;  3QWZ B;  1V80 A;  3A9J A;  2LXC A;  5L83 A;  3ENE A;  2KLG A;  2O2V A;  5D6J B;  3A1Q B;  2G4S A;  2DZM A;  1U4A A;  4IG7 B;  2C7N B;  1NI2 A;  3NZU A;  2HJ8 A;  3MJW A;  1V5T A;  2KC2 A;  2WX1 A;  4HPM B;  4M0W B;  4NAW A;  3ZIM A;  3KUD B;  2KDI A;  2KMC A;  2KK8 A;  3QJZ A;  3UIO B;  2KZR A;  4RM9 A;  2K8C A;  4TQ1 A;  3RD2 A;  1ZW7 A;  3ZUN A;  5J18 A;  4WJO A;  4NQL B;  2N1V A;  4F8C B;  4W9G A;  2WWZ A;  4CYE A;  2JVC A;  3HIZ A;  2N9E B;  2KJR A;  2CR5 A;  2KWV B;  3L10 B;  2KFJ A;  4II2 B;  2KDE B;  2MBH A;  1S1Q B;  4KDL B;  4W9I A;  4J6I A;  3U7D A;  2IY0 B;  4DHJ B;  3H7S A;  2K6Q A;  1WXA A;  4TV3 A;  4LDT B;  4ICU A;  3ALB A;  4FA6 A;  1GC6 A;  1VD2 A;  1WJ4 A;  3KW5 B;  1V2Y A;  3VTW A;  2L7R A;  3TIX A;  3D32 A;  3L54 A;  4XZ4 A;  4A3O A;  4I6P A;  2C9W B;  4BOS C;  1UBQ A;  1WM3 A;  4WQO B;  3V61 A;  1OEY A;  2IO1 B;  2ZEQ A;  1WE7 A;  2RR9 A;  3PHW B;  3ZDT A;  3UIP B;  4GDL B;  4CHK A;  1PQS A;  4NNJ B;  1V9J A;  1UBI A;  2IO2 B;  1UGM A;  2MP2 A;  1ISN A;  2M4N A;  2YLM A;  4ASW C;  4MGI E;  4ICV A;  3WAO A;  3AI5 A;  4AJW A;  2LRU A;  3PGE A;  1A5R A;  3H6N A;  2JXX A;  3PHX B;  1C1Y B;  1P1A A;  2JRI B;  3DCG A;  2L05 A;  1FXT B;  5AZF A;  3SD5 A;  1RFA A;  4HJK A;  3VTV A;  4FUL A;  1G6J A;  4NJ6 A;  1Q1O A;  2O6V B;  4K1R B;  4NJ7 A;  1WH3 A;  4X57 B;  3V62 A;  4IW0 A;  4K7S A;  4MSM B;  2MBO A;  3TJP A;  2JUO A;  1WXM A;  3BY4 B;  4HCP B;  4M8N A;  1YIW A;  2FCQ A;  2LRW A;  2C5L C;  2GOW A;  2KDB A;  2NCN A;  3W1S A;  4DDG D;  2JZ3 B;  1X1M A;  4FJY A;  2MX2 A;  2C7H A;  2C60 A;  2KX0 A;  1GJZ A;  2MCN B;  2ZNV C;  2V3S A;  3O65 B;  4TUU A;  2DAF A;  4ANX A;  2HD5 B;  4WWO A;  3A1Q A;  2ZNV B;  4B9K A;  1WX7 A;  1RRB A;  3VDZ A;  3H7P B;  3DDC B;  2KTR B;  2KXJ A;  5KHO A;  2G4D B;  2BYE A;  2HE7 A;  3EC8 A;  4EKU A;  1Z5S B;  4HPL B;  2LVP A;  2M8S A;  2KLC A;  2AYO B;  3Q3F A;  4DHJ D;  2UWQ A;  1BT0 A;  4P7I A;  2WX0 A;  4EEW A;  4KSK C;  4MH0 E;  5IA7 A;  4LDT D;  1LM8 B;  3ZO5 B;  3QX1 A;  2LXA A;  4GMV A;  4KDI C;  4XX5 A;  5CTR C;  3WAP A;  2PEA A;  2Y5B B;  4KZC A;  2Z59 B;  4G3X B;  3JVZ X;  3VUX A;  2JF5 A;  2MRP A;  2CHX A;  2KJH B;  4GDK B;  4BKS D;  2N1W A;  2Z0E B;  4JQW C;  2KFK B;  4HXD A;  4TQ0 A;  3PV1 A;  3QIJ A;  3CMM B;  3DVN U;  3ZTD A;  5EDS A;  2FCM A;  4I6L B;  3ZTC A;  4BOZ B;  4GDL A;  3ECI A;  5CX3 A;  1RLF A;  3WAN A;  1AAR A;  2BKR B;  1TTN A;  2JT4 B;  3QHT A;  3Q3J A;  2R2Q A;  3H1U A;  5C23 A;  3V6C B;  2KQS A;  2PPH A;  3IVF A;  4DHZ B;  4JIO U;  4OVU A;  2GBM A;  4XC2 A;  1LXD A;  2MW5 A;  3DQV A;  3MTN B;  1HE8 A;  2AWT A;  1TZ1 A;  3A4S C;  3AU5 A;  2O6V A;  4FJZ A;  3QC8 B;  4AUQ C;  2PE9 A;  4IC7 B;  4MJS B;  4ANU A;  3EFU A;  4HVB A;  3HHM A;  2DZI A;  2KKC A;  2IY1 B;  2D2Q A;  4BVU C;  2JY6 A;  2NBU A;  2ZZP B;  1WR6 E;  4G11 A;  3ZLZ A;  1OEY J;  4IUM B;  5AZH A;  4MSQ B;  3N32 A;  1WXS A;  2V1Y A;  2OJR A;  3APD A;  3UQB A;  3DPD A;  4ANV A;  1UZX B;  2L8J A;  2LVQ A;  2FNJ B;  2AL3 A;  2K39 A;  5GMV A;  2CHZ A;  3X23 A;  2XK5 B;  4HDQ A;  1SE9 A;  3JYU A;  4WJQ A;  3HM6 X;  2L3Z A;  2ZJD A;  3HK0 A;  4G0N B;  1WGR A;  5D94 A;  2MBQ A;  3ZRC A;  3EEC A;  3H7P A;  2LWP A;  4AP4 C;  2KTR A;  2ZVO A;  3CSF A;  3GOE A;  2B3A A;  4GB9 A;  3UF8 A;  4NY0 A;  2DAJ A;  4EZK A;  1EUV B;  2KNB A;  2MA9 B;  4GSW A;  2JRH A;  5BO4 B;  5JHA A;  3VUW A;  4MGK E;  1F9J A;  3OJ3 A;  2M17 A;  1WM2 A;  5HKH A;  3PRZ A;  2BGF A;  4HK2 A;  3ML8 A;  2ASQ A;  2JPH A;  2OOB B;  3B08 A;  1TGZ B;  2BYV E;  1KJT A;  3ML9 A;  3PRM B;  2NPT B;  3A33 B;  3ZNI D;  4CO7 A;  2FIF A;  2ZCB A;  3V6E B;  4GDK A;  3RZF A;  4GIV A;  3IHP C;  1WGY A;  2FID A;  2KFK A;  3WAM A;  5DPW A;  3QAQ A;  2M1M A;  3P2B A;  2JZZ A;  4FJV B;  3SHQ A;  4HLE A;  4NQK E;  3R3M A;  2KC1 A;  2D07 B;  2MBE A;  4E3C A;  5FR6 A;  4MGZ E;  3ZVV A;  3PSE B;  4PYU A;  1WY8 A;  1LQB A;  4FBJ B;  3T9L A;  1H4R A;  4F1S A;  4W9H A;  2I1J A;  5DPT A;  3RYT A;  1J0G A;  3VQI A;  2J0J A;  2MWS B;  2RGF A;  3VH4 B;  2LUE A;  3ONS A;  4AJY B;  1E7V A;  2D3G A;  2NS5 A;  4F7Z A;  1YQB A;  4W9K A;  4PS3 A;  3L08 A;  2ZPY A;  4K7U A;  2IO0 B;  2Z0D B;  4W9C A;  4MJS A;  4BFR A;  2N9P C;  1L2N A;  2KD0 A;  2KMA A;  4A3P A;  2RSU A;  4MEM A;  2I1K A;  3IG3 A;  3IBE A;  4JLC A;  3PS6 A;  2GBK A;  1WGD A;  4EZJ A;  3AXC A;  3VXW A;  4GN1 A;  5JZE B;  2K8B A;  4KIK B;  2XK5 A;  3L0W B;  3UGB B;  3R66 C;  2D11 A;  1V86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...