2KC3A

Nmr solution structure of complete receptor binding domain of human apolipoprotein e
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein E
publication title A complete receptor binding domain of human apolipoprotein E
rcsb
source organism Homo sapiens
molecule tags Lipoprotein
total genus 58
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2008-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 2kc3A00
1BZ4A 1LS4A 1OR3A 1YA9A 1NFNA 1H7IA 1AEPA 1NFOA 3R2PA 2KC3A 1LPEA 1EA8A 1OR2A 1GS9A 1EQ1A 1B68A 1LE4A 3S84A 1LE2A
chains in the Genus database with same CATH superfamily
3U8PA 5A69A 3RVYA 1BZ4A 3EZIA 1BR2A 3KYJA 1HE1A 1LI5A 3M4CA 2QUPA 1ST6A 4NQFA 4Z9HA 4IGGA 2YRFA 2IXNA 4IWBA 1LS1A 1TKNA 2DYRC 1ZW3A 4K0DA 3F47A 4EUKB 4KI2A 3JSEO 4FWVA 4WABA 1H7IA 4CS8C 5AC4A 5JUAA 2A0UA 2V3CC 1JRAA 3SXYA 1XWJA 4GEHA 3UMHA 2BC5A 1LPEA 3VYWA 2YL7A 5E2QA 5KYUB 2YL1A 2R03A 1Q0FA 4MVOA 3HTKC 3MBGA 5FZTA 5BQHA 5DQTA 3JZ0A 2VC9A 1LI7A 1Y6DA 4LDQA 5JVEA 1EQ1A 3BRJA 3K6BA 4CBEA 2AWCA 5JRAA 1YZAA 2IXOA 3H65A 5COFA 1KU2A 2IM8A 3GM1A 1J8YF 2EIKC 2VH3A 2R7UA 5A6BD 1ZHYA 3IQCA 1D0ZA 1EKYA 3T4RA 1V55C 1VYIA 1LVKA 1TWGA 2IXMA 2KYHA 3BEHA 4EBBA 4MVMA 3FVYA 3NMKA 4JIOA 2H8AA 3C18A 3JSZA 4GQHA 5E33A 5KYXA 1QSPA 1K05A 5HV9A 3SXMA 5L0DA 5KYNA 3TJ5A 2RSEB 3QW1A 1IW7F 3K1IA 3HNJA 2YQYA 2VCCA 4G7OF 4PACA 2G3KA 2J7PD 3ASOC 1WWPA 4IAQA 4MQ9F 3RF3A 1CPQA 1Q0DA 3LJBA 4YWQA 1CGME 1AVOB 2XXAB 3POVA 2XLVA 3QMKA 4YT4A 1I4YA 3G4ZA 2NSFA 1U6HA 3JRTA 1FMWA 3ZSUA 3M4BA 1YARO 1LS4A 2HMQA 3FMSA 4RDAA 3B0VC 4C7OB 4WGZA 5KYXB 2CYDA 3GODA 4U5BE 1VLTA 2EIMC 4E0HA 3B0UX 1TQGA 1M2VA 3WODF 3ZDLA 2EIJC 2PFDA 3ATPA 4BG0A 3NYMA 1O5HA 4C3BA 1OCCC 1T6QA 2OEXA 1AEPA 2OJED 3GWLA 4EBJA 3U5SA 3AOUA 1YAUO 5COGA 1EA8A 3GM2A 2F22A 1UG7A 4O6MA 1OCRC 3NMIA 3SXZA 4CS7A 2J9BA 2AP3A 3T9OA 5L0FA 2BL2A 4MTFA 2GA0A 1C03A 3VRCA 3ZC4A 1B68A 1BDJB 1ZHXA 4QDLA 1EI7A 5CIVA 2M4EA 2YKZA 1TR2A 2B0HA 2L9JA 4I1OB 2Y3BA 3LS0A 2AVKA 4OIRF 1WATA 3FAPB 5KYWB 3N2ZB 2R05A 1M2VB 5F5FA 1FFTC 4DBQA 3U2MA 3LLKA 2A1DD 3HNLA 1RXQA 3OWTA 3LAYA 2AWYA 3RYLA 1PD1A 1FTSA 3IQ5A 4CS9A 1OKKD 4AX2A 2IXPA 3DMDA 3T6BA 4JEBA 3O39A 5B1BC 1M57C 3KMIA 1V74B 2Q9BA 3KPHA 2R25A 3RQGA 3KYIA 1TFKB 3C63A 2J9WA 3DM5A 3PMRA 5DS6A 3L8JA 3RW0A 5EGYA 2XLHA 3RH3A 3C7JA 4KNVA 4OD5A 4DRJB 1VLSA 4DRHB 2YHSA 3U3BA 2LIGA 3PCVA 3S90A 1WN0A 3ZQVA 1K40A 3AG4C 4CJGA 5L3QA 5CI9A 2UUHA 2OEVA 4EHPA 5A6BA 3NRHA 4C3EA 2R7RA 5B3IA 2EINC 1FR0A 2W4MA 1WASA 4E18A 2J9VA 3EPVA 3M15A 1HE9A 4MVZA 3RFYA 2H7VC 2CGEA 3DKAA 5JSLA 3AG3C 1JMWA 4JCZA 3NMJA 1NU7D 4U9EA 2WZFA 4XQ1A 4NY3A 4CS8A 1QZXA 3UR3C 2YLGA 1NZEA 4CDAA 5KYYA 4ANJA 3GEEA 1D1BA 4CSAA 3GEIA 1YJGA 2PX0A 5K0IA 3RKOF 2J7PA 4EIYA 3ZWIA 3C8GA 3LLIA 1HMOA 3K66A 4B6IA 1ZVZA 3N24A 1YYJA 2ZXRA 3CQZA 1J8MF 3C8ZA 1AUEA 3OEOA 1L3PA 1MMNA 2Y3DA 2BE5F 4LERA 1Z23A 1APCA 3DM9B 3JRMO 3M79A 3N0TA 4DXWA 4NTBA 3U9JA 4EWCA 3B0PA 2XM0A 3C62A 3TQOA 2YWAA 1HY5A 3EHMA 2P61A 3US6A 3DJNB 1VK5A 1GQAA 4I1MA 2NUTA 3GEHA 4XEFA 1M56C 2ZXPA 4E0IA 2ICWG 3KKBA 1CGNA 1A7DA 2CNWA 2QNLA 2PP4A 5KYYB 4LACB 3S28A 1CGOA 1YLMA 5EHHA 1D1AA 4IAOA 3EHNA 3W2VA 1U89A 4AL1A 2TMVP 3C8GB 4JEAA 5E3CA 3K33A 2LFFA 1SMYF 1KTMA 2HZ8A 3ZQYA 3U0CA 4JTCB 3HLZA 1JOGA 4CSAC 1NBBA 1S7ZA 1OR2A 3DWWA 1NU9C 4OD4A 3FOPA 4XEVA 2XSEA 2A68F 3JTLO 1UFBA 4XWJA 4DVYP 1H9GA 4YK5A 5B3SC 3MLGA 3J06A 3AJMA 2G3VA 2WZGA 3QTHA 4XTKA 2NUTB 1T6IA 3EH2A 1LE2A 5CI8A 4N6CA 3T6JA 2CW0F 1YZCA 4A2NB 2HJMA 2R7TA 3LESA 2A6HF 2W4BA 3WG7C 4KNWA 5A6JA 4XLNF 1OR3A 1TWAA 1YA9A 3AGUA 3VAYA 4BEJA 3MFNA 3UNGC 1G8XA 2Y3GA 1ZU5A 2ETSA 3QW0A 3EFOA 4XPYA 3W2WA 2YEVA 4XPWA 2ZPAA 3S29A 1HW2A 3JYYA 1HW1A 2DGJA 3UMIA 4EBKA 4JC7A 1FMVA 2NUPA 2R9RB 4KBLA 2YLIA 3DI5A 4ZLCA 3IPMO 3ZVRA 4Z9JA 2DB4A 2UUIA 1MMDA 2Y69C 3RIPA 1E85A 4PJLA 2R7OA 3L8IA 4PR9A 5HSWA 1BR4A 1DOWA 1Z3IX 2OG2A 3HJCA 3FOOA 4BJ1A 3EGDA 5D92A 1TFOB 4M63A 2Q00A 4XLPF 2L6FA 2L6HA 1Z5ZA 2B0JA 3QZCA 2EPNA 3NDBB 4PFOA 2KJGA 4LDKA 1O3UA 1Z7Qc 3K7DA 3NYLA 5E3AA 4CS9C 5A6AA 3AQCA 2NUPB 1WTYA 3B71A 3L1MA 4FAPB 2H7BA 3V5ZA 2HSQA 5DLJA 2XLOA 3S27A 1ZZPA 4Q5SF 3G4XA 4I3MA 2IBFA 1PV3A 4R32A 4H54A 3ABMC 4YL3A 5COMA 1MMAA 1GM5A 5L0JA 4BPMA 4YL0A 1MQVA 3KL4A 2QE9A 4FX5A 3NYJA 3U9MA 4YJWA 4DJ9A 2LD6A 3TOMA 3TK0A 4PJMA 1VOMA 2I15A 2LFDA 4Q7CA 3M1CB 3LEOA 4FESA 2J46A 2KW3C 3V5XA 4YT8A 3RVZA 3DAFA 4G78A 4XPXA 3EGXA 4BJ5C 2R7WA 3FDQA 4HFFB 2OOCA 1JPNA 2P7VA 1Z6AA 3SZRA 2KGOA 2XRHA 1A0BA 2A6EF 3JT1A 4E7ZA 2Q4FA 2WVQA 2HJ3A 1D0YA 2CCYA 4MVRA 1YA7O 1MMGA 3LS1A 4I44A 4O79A 4EKWA 1YVIA 5FCLA 3I4UA 4OIOF 1ZHTA 2DYSC 2FAPB 4JRZA 1H6GA 2KC3A 1SZIA 2HV6A 2XM4A 4JCHA 4CIPA 2YLDA 5TJ5E 1SYQA 1RKEA 1N1CA 1WOLA 2J0WA 1ZHWA 2CDQA 2W9YA 3EGXB 1SF8A 4JTAB 4X0RA 2HKVA 2J8WA 1ZHZA 2ZD9A 3F46A 3S84A 2P6VA 3JCUQ 3DJUB 4HEAJ 4N4WA 4ULWA 1K04A 2OKUA 4LLEA 1OW8A 4JTDB 1HMDA 3U8VA 2L81A 3EJNA 2DI3A 4L6RA 3SYNA 3V7OA 2WVNA 2XL4A 3H2UA 3AG1C 1D1CA 1E2XA 3X1OA 4HFKB 1Q0KA 1LKXA 1L7CA 1R4TA 1ZW2A 1RKEB 2W45A 2P1AA 2Y3HA 4G0HA 4MVUA 4N6HA 3SP1A 4U5CE 2KK1A 1Y4CA 4YT5A 3TULA 3NG1A 1C17M 2MWQA 3DD7A 3LEVA 4MTOA 4UDVA 3CZ6A 4CDYA 5A6KA 2I8BA 2VB6A 3O10A 2FGYA 2XS1A 4P9TA 4P6IC 4O6YA 4BEMJ 2FFHA 4E17A 5L0HA 1GS9A 2Z15A 4WJ0A 4JZAA 5L0GA 3ASNC 4JURI 1DOVA 2OCCC 3T6GB 2XL6A 3W8HA 5BQIA 2YL3A 1QVXA 2XLEA 1U0BB 3CEXA 1G4US 3FXHA 2KNHA 4PJNA 1W2WA 3B9QA 4QI0A 2XL8A 3S0XA 4G7ZF 3UGPA 1G4WR 4NTFA 4U5HA 3R7CA 4U5GA 2PF4E 4WGYA 4OIPF 1VMAA 1I4ZA 4P9FA 3ZTZA 3PHF2 2NPUA 1QKRA 4MW3A 3L0IA 3VM6A 4AE4A 3ZIBA 2X0CA 1G5ZA 1OW6A 2WZLA 1NLXA 1OQCA 3GWNA 1PD0A 3Q7LA 3H2VA 4MTGA 4U5EE 4U5FE 3LNMB 3I5QA 4O6NA 2IYLD 3HNKA 2L7AA 3DXJF 4G7HF 1LE4A 2YL0A 3VF0A 1ORYA 3IHUA 4IB4A 3K1HA 5D91A 1NG1A 5DQZA 4U9DA 4ZLDA 1M2OA 1LIHA 2XS8A 5F28E 1F1MA 1SR2A 5T3WA 4MNDA 4OINF 3TD7A 3EG9A 4BJ6C 3UGOA 3LUTB 5AGFA 1VTMP 2MHRA 3GANA 1OKKA 4AE4B 2EPMX 5JLIA 1FNTc 4Q4ZF 5BQGA 1BR1A 5DS5A 2A69F 3QVYA 1T5OA 2HFIA 1A41A 3KH2A 2GFHA 4ER9A 1E84A 1OCZC 3DE9A 1CPRA 1Q0MA 3EZHA 4Z9IA 3LNRA 1WGWA 1OCOC 3ZG1A 3U3FA 2OJQA 5DS4A 1QPUA 2PNOA 4LDRA 4A4AA 2JPUA 2EPLX 3OA1A 4MS2A 2J9UA 1TWHA 2X51A 4RBNA 3NKEA 3G50A 3EG9B 2PX3A 1YDIA 1YYXA 2LP4A 2LSEA 3A9CA 5EK0A 5IY5C 4BJ5A 2LQGA 2XXAA 2QLAA 1Z63A 2R7XA 2A0BA 3DZAA 3ZTMA 3SEOA 3EFOB 1PCXA 4E7SA 3IEEA 4JE9A 5F5HA 2C03A 2JD3A 4IRUA 2IOQA 4YN0B 1QLEC 4DOZA 4YT2A 4CX9A 4C7OA 1C02A 1OXKA 1JR8A 4HE8D 5T3TA 2GDCA 1T01A 5B1AC 4JW1A 3O55A 1JPJA 2ASRA 2Q3TA 3SXKA 1MNEA 3FAJA 1VB5A 3L34A 3EQLF 1BBHA 2OU6A 2OQMA 3ITFA 3DAGA 3NKDA 1Q0GA 3R2PA 4U5DE 2GWWA 5GPGB 4QI2A 2H7OA 2RD9A 4N06A 3EGDB 3C8GD 3TJ6A 2VCBA 3Q6NA 4MVSA 1JAFA 256BA 2LK4A 2MYSA 5JP7A 2WB7A 1GGQA 2Q9CA 3X2QC 2LCHA 1RCPA 1D0XA 2YZSA 1TWCA 1E86A 1LM3B 1ORSC 3MX3A 1ZYRF 4BJTA 4DVZA 4F4BA 5KYWA 1ORJA 2QY9A 4OIQF 4AL0A 2GAQA 5DVWA 3MYFA 2Q9AA 4O7GA 3TOLA 1IZMA 3JYHA 4JKVA 1MNDA 2CNWD 2ZXWC 2R7VA 1M6TA 4J7YA 5L3VA 2QTVA 4IJJA 3HKKA 4MW8A 3FHDA 2XLWA 4ULVA 1ZU4A 2L6GA 3K1IC 1QQ3A 4PJJA 5L0CA 5AC5A 2E87A 4PFPA 4GYTA 3AQBA 2HMZA 1I5NA 2R7SA 4NC3A 2R7QA 5L0IA 4ONSA 4NTAA 2M64A 3U2LA 4H4KC 4J30B 2Q7RA 4CDVA 4DBRA 4JJFA 3V5YA 2WL8A 2HS5A 2KQ9A 2NSGA 1A7EA 1V4AA 3PDMP 3IQ6A 3HNIA 3Q6MA 3I5PA 4JVSA 2D4UA 3GM3A 4XEKA 1E83A 1O87A 3AG2C 1XZQA 4K1OA 1R5ID 2J45A 2AU5A 2XLDA 2D5RB 2HUJA 1NFNA 2XLMA 1T9KA 2VASA 3B29A 1OXBA 2NG1A 1H9TA 3DE8A 2JX0A 1S05A 3Q7GA 2HSBA 3S9OA 2EPKX 2O9XA 5BUOA 4C3DA 4CIHA 3ABLC 2V26A 4J32B 4J7TA 4YL1A 2EPOA 1A7VA 1T6UA 2EILC 3RQEA 3CSKA 2HV7A 2YVKA 3UMKA 2Y39A 3AGTA 1RJ9A 3ECSA 3EH1A 4D4XA 3E70C 2P0NA 4BJ6A 2G62A 4CJOA 2PBEA 1RMVA 3W4YA 3CAXA 4KC9A 4W8KA 4K7BA 3IQTA 4AK9A 2J0XA 4LLCA 3WAQA 2VCAA 1OW7A 1VYKA 2WVOA 3RQFA 4DRIB 1NSGB 4JJGA 3GORA 3MYIA 1RKCA 3WHNA 1KNYA 1NFOA 4D4NA 4PK4A 4NCQA 4W8PA 3A11A 5JT4A 1XZPA 5T1DB 3SNHA 1FAPB 2R02A 2ZXOA 3ABKC 2KSFA 4RD9A 5JS5A 3O6XA 1RJ9B 3E9VA 3W8IA 4MVQA 4IARA 1FFHA 5KYUA 1V54C 2C04A 3QVZA
chains in the Genus database with same CATH topology
1BZ4A 1LS4A 1OR3A 1YA9A 1NFNA 1H7IA 1AEPA 1NFOA 3R2PA 2KC3A 1LPEA 1EA8A 1OR2A 1GS9A 1EQ1A 1B68A 1LE4A 3S84A 1LE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BZ4 A;  1LS4 A;  1OR3 A;  1YA9 A;  1NFN A;  1H7I A;  1AEP A;  1NFO A;  3R2P A;  2KC3 A;  1LPE A;  1EA8 A;  1OR2 A;  1GS9 A;  1EQ1 A;  1B68 A;  1LE4 A;  3S84 A;  1LE2 A; 
#chains in the Genus database with same CATH topology
 3U8P A;  5A69 A;  3RVY A;  1BZ4 A;  3EZI A;  1BR2 A;  3KYJ A;  1HE1 A;  1LI5 A;  3M4C A;  2QUP A;  1ST6 A;  4NQF A;  4Z9H A;  4IGG A;  2YRF A;  2IXN A;  4IWB A;  1LS1 A;  1TKN A;  2DYR C;  1ZW3 A;  4K0D A;  3F47 A;  4EUK B;  4KI2 A;  3JSE O;  4FWV A;  4WAB A;  1H7I A;  4CS8 C;  5AC4 A;  5JUA A;  2A0U A;  2V3C C;  1JRA A;  3SXY A;  1XWJ A;  4GEH A;  3UMH A;  2BC5 A;  1LPE A;  3VYW A;  2YL7 A;  5E2Q A;  5KYU B;  2YL1 A;  2R03 A;  1Q0F A;  4MVO A;  3HTK C;  3MBG A;  5FZT A;  5BQH A;  5DQT A;  3JZ0 A;  2VC9 A;  1LI7 A;  1Y6D A;  4LDQ A;  5JVE A;  1EQ1 A;  3BRJ A;  3K6B A;  4CBE A;  2AWC A;  5JRA A;  1YZA A;  2IXO A;  3H65 A;  5COF A;  1KU2 A;  2IM8 A;  3GM1 A;  1J8Y F;  2EIK C;  2VH3 A;  2R7U A;  5A6B D;  1ZHY A;  3IQC A;  1D0Z A;  1EKY A;  3T4R A;  1V55 C;  1VYI A;  1LVK A;  1TWG A;  2IXM A;  2KYH A;  3BEH A;  4EBB A;  4MVM A;  3FVY A;  3NMK A;  4JIO A;  2H8A A;  3C18 A;  3JSZ A;  4GQH A;  5E33 A;  5KYX A;  1QSP A;  1K05 A;  5HV9 A;  3SXM A;  5L0D A;  5KYN A;  3TJ5 A;  2RSE B;  3QW1 A;  1IW7 F;  3K1I A;  3HNJ A;  2YQY A;  2VCC A;  4G7O F;  4PAC A;  2G3K A;  2J7P D;  3ASO C;  1WWP A;  4IAQ A;  4MQ9 F;  3RF3 A;  1CPQ A;  1Q0D A;  3LJB A;  4YWQ A;  1CGM E;  1AVO B;  2XXA B;  3POV A;  2XLV A;  3QMK A;  4YT4 A;  1I4Y A;  3G4Z A;  2NSF A;  1U6H A;  3JRT A;  1FMW A;  3ZSU A;  3M4B A;  1YAR O;  1LS4 A;  2HMQ A;  3FMS A;  4RDA A;  3B0V C;  4C7O B;  4WGZ A;  5KYX B;  2CYD A;  3GOD A;  4U5B E;  1VLT A;  2EIM C;  4E0H A;  3B0U X;  1TQG A;  1M2V A;  3WOD F;  3ZDL A;  2EIJ C;  2PFD A;  3ATP A;  4BG0 A;  3NYM A;  1O5H A;  4C3B A;  1OCC C;  1T6Q A;  2OEX A;  1AEP A;  2OJE D;  3GWL A;  4EBJ A;  3U5S A;  3AOU A;  1YAU O;  5COG A;  1EA8 A;  3GM2 A;  2F22 A;  1UG7 A;  4O6M A;  1OCR C;  3NMI A;  3SXZ A;  4CS7 A;  2J9B A;  2AP3 A;  3T9O A;  5L0F A;  2BL2 A;  4MTF A;  2GA0 A;  1C03 A;  3VRC A;  3ZC4 A;  1B68 A;  1BDJ B;  1ZHX A;  4QDL A;  1EI7 A;  5CIV A;  2M4E A;  2YKZ A;  1TR2 A;  2B0H A;  2L9J A;  4I1O B;  2Y3B A;  3LS0 A;  2AVK A;  4OIR F;  1WAT A;  3FAP B;  5KYW B;  3N2Z B;  2R05 A;  1M2V B;  5F5F A;  1FFT C;  4DBQ A;  3U2M A;  3LLK A;  2A1D D;  3HNL A;  1RXQ A;  3OWT A;  3LAY A;  2AWY A;  3RYL A;  1PD1 A;  1FTS A;  3IQ5 A;  4CS9 A;  1OKK D;  4AX2 A;  2IXP A;  3DMD A;  3T6B A;  4JEB A;  3O39 A;  5B1B C;  1M57 C;  3KMI A;  1V74 B;  2Q9B A;  3KPH A;  2R25 A;  3RQG A;  3KYI A;  1TFK B;  3C63 A;  2J9W A;  3DM5 A;  3PMR A;  5DS6 A;  3L8J A;  3RW0 A;  5EGY A;  2XLH A;  3RH3 A;  3C7J A;  4KNV A;  4OD5 A;  4DRJ B;  1VLS A;  4DRH B;  2YHS A;  3U3B A;  2LIG A;  3PCV A;  3S90 A;  1WN0 A;  3ZQV A;  1K40 A;  3AG4 C;  4CJG A;  5L3Q A;  5CI9 A;  2UUH A;  2OEV A;  4EHP A;  5A6B A;  3NRH A;  4C3E A;  2R7R A;  5B3I A;  2EIN C;  1FR0 A;  2W4M A;  1WAS A;  4E18 A;  2J9V A;  3EPV A;  3M15 A;  1HE9 A;  4MVZ A;  3RFY A;  2H7V C;  2CGE A;  3DKA A;  5JSL A;  3AG3 C;  1JMW A;  4JCZ A;  3NMJ A;  1NU7 D;  4U9E A;  2WZF A;  4XQ1 A;  4NY3 A;  4CS8 A;  1QZX A;  3UR3 C;  2YLG A;  1NZE A;  4CDA A;  5KYY A;  4ANJ A;  3GEE A;  1D1B A;  4CSA A;  3GEI A;  1YJG A;  2PX0 A;  5K0I A;  3RKO F;  2J7P A;  4EIY A;  3ZWI A;  3C8G A;  3LLI A;  1HMO A;  3K66 A;  4B6I A;  1ZVZ A;  3N24 A;  1YYJ A;  2ZXR A;  3CQZ A;  1J8M F;  3C8Z A;  1AUE A;  3OEO A;  1L3P A;  1MMN A;  2Y3D A;  2BE5 F;  4LER A;  1Z23 A;  1APC A;  3DM9 B;  3JRM O;  3M79 A;  3N0T A;  4DXW A;  4NTB A;  3U9J A;  4EWC A;  3B0P A;  2XM0 A;  3C62 A;  3TQO A;  2YWA A;  1HY5 A;  3EHM A;  2P61 A;  3US6 A;  3DJN B;  1VK5 A;  1GQA A;  4I1M A;  2NUT A;  3GEH A;  4XEF A;  1M56 C;  2ZXP A;  4E0I A;  2ICW G;  3KKB A;  1CGN A;  1A7D A;  2CNW A;  2QNL A;  2PP4 A;  5KYY B;  4LAC B;  3S28 A;  1CGO A;  1YLM A;  5EHH A;  1D1A A;  4IAO A;  3EHN A;  3W2V A;  1U89 A;  4AL1 A;  2TMV P;  3C8G B;  4JEA A;  5E3C A;  3K33 A;  2LFF A;  1SMY F;  1KTM A;  2HZ8 A;  3ZQY A;  3U0C A;  4JTC B;  3HLZ A;  1JOG A;  4CSA C;  1NBB A;  1S7Z A;  1OR2 A;  3DWW A;  1NU9 C;  4OD4 A;  3FOP A;  4XEV A;  2XSE A;  2A68 F;  3JTL O;  1UFB A;  4XWJ A;  4DVY P;  1H9G A;  4YK5 A;  5B3S C;  3MLG A;  3J06 A;  3AJM A;  2G3V A;  2WZG A;  3QTH A;  4XTK A;  2NUT B;  1T6I A;  3EH2 A;  1LE2 A;  5CI8 A;  4N6C A;  3T6J A;  2CW0 F;  1YZC A;  4A2N B;  2HJM A;  2R7T A;  3LES A;  2A6H F;  2W4B A;  3WG7 C;  4KNW A;  5A6J A;  4XLN F;  1OR3 A;  1TWA A;  1YA9 A;  3AGU A;  3VAY A;  4BEJ A;  3MFN A;  3UNG C;  1G8X A;  2Y3G A;  1ZU5 A;  2ETS A;  3QW0 A;  3EFO A;  4XPY A;  3W2W A;  2YEV A;  4XPW A;  2ZPA A;  3S29 A;  1HW2 A;  3JYY A;  1HW1 A;  2DGJ A;  3UMI A;  4EBK A;  4JC7 A;  1FMV A;  2NUP A;  2R9R B;  4KBL A;  2YLI A;  3DI5 A;  4ZLC A;  3IPM O;  3ZVR A;  4Z9J A;  2DB4 A;  2UUI A;  1MMD A;  2Y69 C;  3RIP A;  1E85 A;  4PJL A;  2R7O A;  3L8I A;  4PR9 A;  5HSW A;  1BR4 A;  1DOW A;  1Z3I X;  2OG2 A;  3HJC A;  3FOO A;  4BJ1 A;  3EGD A;  5D92 A;  1TFO B;  4M63 A;  2Q00 A;  4XLP F;  2L6F A;  2L6H A;  1Z5Z A;  2B0J A;  3QZC A;  2EPN A;  3NDB B;  4PFO A;  2KJG A;  4LDK A;  1O3U A;  1Z7Q c;  3K7D A;  3NYL A;  5E3A A;  4CS9 C;  5A6A A;  3AQC A;  2NUP B;  1WTY A;  3B71 A;  3L1M A;  4FAP B;  2H7B A;  3V5Z A;  2HSQ A;  5DLJ A;  2XLO A;  3S27 A;  1ZZP A;  4Q5S F;  3G4X A;  4I3M A;  2IBF A;  1PV3 A;  4R32 A;  4H54 A;  3ABM C;  4YL3 A;  5COM A;  1MMA A;  1GM5 A;  5L0J A;  4BPM A;  4YL0 A;  1MQV A;  3KL4 A;  2QE9 A;  4FX5 A;  3NYJ A;  3U9M A;  4YJW A;  4DJ9 A;  2LD6 A;  3TOM A;  3TK0 A;  4PJM A;  1VOM A;  2I15 A;  2LFD A;  4Q7C A;  3M1C B;  3LEO A;  4FES A;  2J46 A;  2KW3 C;  3V5X A;  4YT8 A;  3RVZ A;  3DAF A;  4G78 A;  4XPX A;  3EGX A;  4BJ5 C;  2R7W A;  3FDQ A;  4HFF B;  2OOC A;  1JPN A;  2P7V A;  1Z6A A;  3SZR A;  2KGO A;  2XRH A;  1A0B A;  2A6E F;  3JT1 A;  4E7Z A;  2Q4F A;  2WVQ A;  2HJ3 A;  1D0Y A;  2CCY A;  4MVR A;  1YA7 O;  1MMG A;  3LS1 A;  4I44 A;  4O79 A;  4EKW A;  1YVI A;  5FCL A;  3I4U A;  4OIO F;  1ZHT A;  2DYS C;  2FAP B;  4JRZ A;  1H6G A;  2KC3 A;  1SZI A;  2HV6 A;  2XM4 A;  4JCH A;  4CIP A;  2YLD A;  5TJ5 E;  1SYQ A;  1RKE A;  1N1C A;  1WOL A;  2J0W A;  1ZHW A;  2CDQ A;  2W9Y A;  3EGX B;  1SF8 A;  4JTA B;  4X0R A;  2HKV A;  2J8W A;  1ZHZ A;  2ZD9 A;  3F46 A;  3S84 A;  2P6V A;  3JCU Q;  3DJU B;  4HEA J;  4N4W A;  4ULW A;  1K04 A;  2OKU A;  4LLE A;  1OW8 A;  4JTD B;  1HMD A;  3U8V A;  2L81 A;  3EJN A;  2DI3 A;  4L6R A;  3SYN A;  3V7O A;  2WVN A;  2XL4 A;  3H2U A;  3AG1 C;  1D1C A;  1E2X A;  3X1O A;  4HFK B;  1Q0K A;  1LKX A;  1L7C A;  1R4T A;  1ZW2 A;  1RKE B;  2W45 A;  2P1A A;  2Y3H A;  4G0H A;  4MVU A;  4N6H A;  3SP1 A;  4U5C E;  2KK1 A;  1Y4C A;  4YT5 A;  3TUL A;  3NG1 A;  1C17 M;  2MWQ A;  3DD7 A;  3LEV A;  4MTO A;  4UDV A;  3CZ6 A;  4CDY A;  5A6K A;  2I8B A;  2VB6 A;  3O10 A;  2FGY A;  2XS1 A;  4P9T A;  4P6I C;  4O6Y A;  4BEM J;  2FFH A;  4E17 A;  5L0H A;  1GS9 A;  2Z15 A;  4WJ0 A;  4JZA A;  5L0G A;  3ASN C;  4JUR I;  1DOV A;  2OCC C;  3T6G B;  2XL6 A;  3W8H A;  5BQI A;  2YL3 A;  1QVX A;  2XLE A;  1U0B B;  3CEX A;  1G4U S;  3FXH A;  2KNH A;  4PJN A;  1W2W A;  3B9Q A;  4QI0 A;  2XL8 A;  3S0X A;  4G7Z F;  3UGP A;  1G4W R;  4NTF A;  4U5H A;  3R7C A;  4U5G A;  2PF4 E;  4WGY A;  4OIP F;  1VMA A;  1I4Z A;  4P9F A;  3ZTZ A;  3PHF 2;  2NPU A;  1QKR A;  4MW3 A;  3L0I A;  3VM6 A;  4AE4 A;  3ZIB A;  2X0C A;  1G5Z A;  1OW6 A;  2WZL A;  1NLX A;  1OQC A;  3GWN A;  1PD0 A;  3Q7L A;  3H2V A;  4MTG A;  4U5E E;  4U5F E;  3LNM B;  3I5Q A;  4O6N A;  2IYL D;  3HNK A;  2L7A A;  3DXJ F;  4G7H F;  1LE4 A;  2YL0 A;  3VF0 A;  1ORY A;  3IHU A;  4IB4 A;  3K1H A;  5D91 A;  1NG1 A;  5DQZ A;  4U9D A;  4ZLD A;  1M2O A;  1LIH A;  2XS8 A;  5F28 E;  1F1M A;  1SR2 A;  5T3W A;  4MND A;  4OIN F;  3TD7 A;  3EG9 A;  4BJ6 C;  3UGO A;  3LUT B;  5AGF A;  1VTM P;  2MHR A;  3GAN A;  1OKK A;  4AE4 B;  2EPM X;  5JLI A;  1FNT c;  4Q4Z F;  5BQG A;  1BR1 A;  5DS5 A;  2A69 F;  3QVY A;  1T5O A;  2HFI A;  1A41 A;  3KH2 A;  2GFH A;  4ER9 A;  1E84 A;  1OCZ C;  3DE9 A;  1CPR A;  1Q0M A;  3EZH A;  4Z9I A;  3LNR A;  1WGW A;  1OCO C;  3ZG1 A;  3U3F A;  2OJQ A;  5DS4 A;  1QPU A;  2PNO A;  4LDR A;  4A4A A;  2JPU A;  2EPL X;  3OA1 A;  4MS2 A;  2J9U A;  1TWH A;  2X51 A;  4RBN A;  3NKE A;  3G50 A;  3EG9 B;  2PX3 A;  1YDI A;  1YYX A;  2LP4 A;  2LSE A;  3A9C A;  5EK0 A;  5IY5 C;  4BJ5 A;  2LQG A;  2XXA A;  2QLA A;  1Z63 A;  2R7X A;  2A0B A;  3DZA A;  3ZTM A;  3SEO A;  3EFO B;  1PCX A;  4E7S A;  3IEE A;  4JE9 A;  5F5H A;  2C03 A;  2JD3 A;  4IRU A;  2IOQ A;  4YN0 B;  1QLE C;  4DOZ A;  4YT2 A;  4CX9 A;  4C7O A;  1C02 A;  1OXK A;  1JR8 A;  4HE8 D;  5T3T A;  2GDC A;  1T01 A;  5B1A C;  4JW1 A;  3O55 A;  1JPJ A;  2ASR A;  2Q3T A;  3SXK A;  1MNE A;  3FAJ A;  1VB5 A;  3L34 A;  3EQL F;  1BBH A;  2OU6 A;  2OQM A;  3ITF A;  3DAG A;  3NKD A;  1Q0G A;  3R2P A;  4U5D E;  2GWW A;  5GPG B;  4QI2 A;  2H7O A;  2RD9 A;  4N06 A;  3EGD B;  3C8G D;  3TJ6 A;  2VCB A;  3Q6N A;  4MVS A;  1JAF A;  256B A;  2LK4 A;  2MYS A;  5JP7 A;  2WB7 A;  1GGQ A;  2Q9C A;  3X2Q C;  2LCH A;  1RCP A;  1D0X A;  2YZS A;  1TWC A;  1E86 A;  1LM3 B;  1ORS C;  3MX3 A;  1ZYR F;  4BJT A;  4DVZ A;  4F4B A;  5KYW A;  1ORJ A;  2QY9 A;  4OIQ F;  4AL0 A;  2GAQ A;  5DVW A;  3MYF A;  2Q9A A;  4O7G A;  3TOL A;  1IZM A;  3JYH A;  4JKV A;  1MND A;  2CNW D;  2ZXW C;  2R7V A;  1M6T A;  4J7Y A;  5L3V A;  2QTV A;  4IJJ A;  3HKK A;  4MW8 A;  3FHD A;  2XLW A;  4ULV A;  1ZU4 A;  2L6G A;  3K1I C;  1QQ3 A;  4PJJ A;  5L0C A;  5AC5 A;  2E87 A;  4PFP A;  4GYT A;  3AQB A;  2HMZ A;  1I5N A;  2R7S A;  4NC3 A;  2R7Q A;  5L0I A;  4ONS A;  4NTA A;  2M64 A;  3U2L A;  4H4K C;  4J30 B;  2Q7R A;  4CDV A;  4DBR A;  4JJF A;  3V5Y A;  2WL8 A;  2HS5 A;  2KQ9 A;  2NSG A;  1A7E A;  1V4A A;  3PDM P;  3IQ6 A;  3HNI A;  3Q6M A;  3I5P A;  4JVS A;  2D4U A;  3GM3 A;  4XEK A;  1E83 A;  1O87 A;  3AG2 C;  1XZQ A;  4K1O A;  1R5I D;  2J45 A;  2AU5 A;  2XLD A;  2D5R B;  2HUJ A;  1NFN A;  2XLM A;  1T9K A;  2VAS A;  3B29 A;  1OXB A;  2NG1 A;  1H9T A;  3DE8 A;  2JX0 A;  1S05 A;  3Q7G A;  2HSB A;  3S9O A;  2EPK X;  2O9X A;  5BUO A;  4C3D A;  4CIH A;  3ABL C;  2V26 A;  4J32 B;  4J7T A;  4YL1 A;  2EPO A;  1A7V A;  1T6U A;  2EIL C;  3RQE A;  3CSK A;  2HV7 A;  2YVK A;  3UMK A;  2Y39 A;  3AGT A;  1RJ9 A;  3ECS A;  3EH1 A;  4D4X A;  3E70 C;  2P0N A;  4BJ6 A;  2G62 A;  4CJO A;  2PBE A;  1RMV A;  3W4Y A;  3CAX A;  4KC9 A;  4W8K A;  4K7B A;  3IQT A;  4AK9 A;  2J0X A;  4LLC A;  3WAQ A;  2VCA A;  1OW7 A;  1VYK A;  2WVO A;  3RQF A;  4DRI B;  1NSG B;  4JJG A;  3GOR A;  3MYI A;  1RKC A;  3WHN A;  1KNY A;  1NFO A;  4D4N A;  4PK4 A;  4NCQ A;  4W8P A;  3A11 A;  5JT4 A;  1XZP A;  5T1D B;  3SNH A;  1FAP B;  2R02 A;  2ZXO A;  3ABK C;  2KSF A;  4RD9 A;  5JS5 A;  3O6X A;  1RJ9 B;  3E9V A;  3W8I A;  4MVQ A;  4IAR A;  1FFH A;  5KYU A;  1V54 C;  2C04 A;  3QVZ A; 
#chains in the Genus database with same CATH homology
 1BZ4 A;  1LS4 A;  1OR3 A;  1YA9 A;  1NFN A;  1H7I A;  1AEP A;  1NFO A;  3R2P A;  2KC3 A;  1LPE A;  1EA8 A;  1OR2 A;  1GS9 A;  1EQ1 A;  1B68 A;  1LE4 A;  3S84 A;  1LE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...