2KC3A

Nmr solution structure of complete receptor binding domain of human apolipoprotein e
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
b'KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein E
publication title A complete receptor binding domain of human apolipoprotein E
rcsb
source organism Homo sapiens
molecule tags Lipoprotein
total genus 58
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2008-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 2kc3A00
3S84A 1AEPA 1LS4A 1YA9A 1B68A 1BZ4A 1GS9A 2KC3A 1NFOA 3R2PA 1H7IA 1OR2A 1OR3A 1NFNA 1LE4A 1LE2A 1LPEA 1EQ1A 1EA8A
chains in the Genus database with same CATH superfamily
1C03A 1Y4CA 5CI9A 3JRTA 3RQFA 2WVNA 1YYJA 3PMRA 3POVA 3G4ZA 4FX5A 4CS8C 4CX9A 1CPQA 1FR0A 2EINC 3IQTA 1OXBA 3L8IA 4U5EE 3CEXA 4AE4A 2CGEA 1HMDA 3DAGA 1Q0KA 1QPUA 2IXNA 3V7OA 2R7UA 1DOWA 3UMHA 5L0CA 3NYMA 1NFNA 2ETSA 3A11A 2R7VA 5B3IA 3VM6A 1OCZC 2E87A 3QW0A 3EPVA 3HLZA 4JEAA 3PHF2 2XM0A 4JTCB 2TMVP 4JJFA 4DJ9A 2R05A 1K05A 4JC7A 2BC5A 2XLVA 2YL7A 3FHDA 1LS1A 2W4BA 4LDRA 2QLAA 4EIYA 1WGWA 3VYWA 2PF4E 4YN0B 5T3TA 2JX0A 3Q6MA 5L3VA 2R03A 2HUJA 2Q7RA 3K7DA 4WJ0A 4EBJA 2J0XA 5L0JA 3EZHA 2Z15A 5L0IA 2O9XA 3GANA 4BJTA 5DS6A 2XL6A 3HNLA 1YA7O 4XQ1A 5BUOA 4CDYA 5T3WA 2J0WA 4BPMA 2OU6A 2YZSA 4C3BA 3TOLA 1QZXA 1CGNA 2XLOA 2CCYA 4Z9JA 4YT8A 4OIQF 1YZAA 1OCOC 2ZXOA 5E3CA 4AX2A 2QUPA 2LFDA 3IQCA 4AK9A 1NU9C 2XRHA 2CNWD 4JW1A 4YJWA 3K6BA 3DM9B 4O7GA 2GWWA 4O6NA 2XLDA 4K1OA 2HS5A 2IXOA 1T6QA 4XEFA 4J32B 4BJ5C 2G62A 1J8YF 2EPNA 3WG7C 2EIMC 2KNHA 3AG4C 4XPXA 3S90A 1OCRC 3C63A 3NKEA 3V5YA 4BJ1A 2P7VA 4YL1A 3AJMA 3ZIBA 3DMDA 4DXWA 1YJGA 4EWCA 2LQGA 2R7RA 4MVZA 2XS8A 4CSAA 1V55C 1Z6AA 4IAQA 1FFTC 3ZTMA 2Q9AA 1K04A 1VMAA 2R02A 2J9WA 3S9OA 5L0FA 1JRAA 4J30B 2HZ8A 1S7ZA 1QLEC 2CW0F 2Q9CA 2B0HA 4G7OF 1F1MA 3K1HA 1Q0GA 1UFBA 3LS0A 1K40A 4I1MA 5KYNA 1A7EA 1SF8A 4U9EA 1RKEB 2HMZA 4PJLA 2KJGA 1PD1A 3DD7A 3H2VA 1VYIA 3NMIA 3DE9A 1G4WR 1MNDA 1RKEA 3EQLF 2FGYA 3FOOA 2PX0A 5AC5A 3RF3A 3RW0A 3C8GB 3IQ5A 3LJBA 3R2PA 4IRUA 5B1AC 3KH2A 3W4YA 2MHRA 1WN0A 1L3PA 3C8GA 3T6JA 3GM1A 3TOMA 5DS5A 5BQHA 2H8AA 5JLIA 2IOQA 3L0IA 1XZQA 2Y3BA 3M4BA 3OWTA 5FCLA 5F5FA 1JPNA 4E0HA 3NG1A 2LCHA 4KBLA 4E7ZA 4A2NB 3SYNA 3KPHA 2H7BA 4XPYA 3ZG1A 5JP7A 4PJNA 4IAOA 3VAYA 2HMQA 2YQYA 4OD5A 1QVXA 1OW7A 3KMIA 4DVZA 3U2LA 2PX3A 4JIOA 4NC3A 4CS8A 3DWWA 3O55A 4RDAA 3DXJF 2WVQA 1QKRA 1JPJA 1VB5A 1B68A 1BZ4A 4E17A 1A0BA 1Z23A 3UGOA 3ITFA 1NBBA 5D91A 3QMKA 5KYUB 1M2VB 3EJNA 3FMSA 3ZQYA 2PFDA 1BR1A 2Q00A 5DQTA 5KYUA 3C8ZA 1A7VA 4Z9HA 3LS1A 5E2QA 2XXAB 4BJ6C 2R7TA 2ICWG 4GYTA 2XXAA 2F22A 4XEVA 4MVSA 3ZVRA 2RD9A 4N4WA 4KI2A 1LI7A 1TWAA 4JJGA 4XLPF 1M2OA 2ZXWC 1TWCA 2L81A 4EBBA 2VH3A 3ZQVA 2AVKA 4U5GA 1NSGB 2AWYA 3JSZA 1RXQA 3QVYA 3UGPA 1GM5A 4NCQA 2RSEB 1IZMA 3GWNA 3HNKA 1G8XA 1FAPB 4O6YA 2DYSC 2R7OA 5COMA 3VRCA 2YLIA 2X51A 4G7HF 4YT5A 1LS4A 5BQIA 2MYSA 2NPUA 2QTVA 1E83A 3L8JA 4O6MA 3W8HA 3U0CA 1NZEA 1NFOA 2GFHA 3U3BA 3N24A 1N1CA 1C17M 3ZTZA 5JS5A 2LSEA 1OR2A 2J8WA 3O6XA 4FESA 2G3VA 4J7YA 2EPOA 4R32A 4WGYA 2HSQA 2R7XA 3GORA 2NSFA 1YVIA 2YLGA 3Q6NA 4CJOA 1ZYRF 1VTMP 4DVYP 5BQGA 3DJNB 2R9RB 1E85A 2WVOA 4I3MA 3MLGA 1YZCA 3N2ZB 2R25A 4FWVA 3ECSA 4M63A 2H7VC 4W8PA 2IBFA 4JURI 2HSBA 2WL8A 3OA1A 4K7BA 4K0DA 1LKXA 2G3KA 2QE9A 1FMVA 2Y3GA 3K66A 3U8VA 4CS9A 4E7SA 2GA0A 256BA 3EHMA 3U3FA 3ABLC 1TWHA 1PV3A 2UUIA 3ABKC 4OINF 5E3AA 2OQMA 3R7CA 5HSWA 1M6TA 1ZHTA 3HNJA 2XLEA 3B9QA 5EK0A 4XEKA 2D5RB 3ZDLA 4QI2A 1HY5A 2NUPB 4ZLCA 1BR4A 2VCAA 1TQGA 2EPLX 4KNVA 2I8BA 3H2UA 2ZXRA 2LD6A 1ZVZA 3EHNA 3KKBA 4B6IA 2XS1A 3RQGA 3IHUA 4MTFA 1HW1A 4RBNA 1LE4A 4N6CA 5T1DB 1T6IA 1Z3IX 3MYIA 1T01A 2Q9BA 2WZLA 1MMNA 4LACB 1ZU4A 5L3QA 2ASRA 4PJMA 1Z5ZA 2PBEA 3PCVA 1L7CA 3S28A 3UNGC 2KSFA 2P1AA 3RYLA 5AC4A 1E86A 3TJ6A 3IPMO 2EIKC 3IQ6A 5KYYB 3G50A 1LVKA 1V74B 1TWGA 4P9FA 4JTDB 4P9TA 2R7SA 4ULVA 4LDQA 1NG1A 3KL4A 3KYJA 3F46A 3FAJA 5COFA 4EUKB 4NY3A 3M15A 1VK5A 1JR8A 3MFNA 4U5CE 1APCA 2DB4A 2NG1A 1ZW2A 4MTGA 3J06A 1D1BA 2W4MA 1U89A 3LAYA 3T6BA 5JVEA 4NTBA 1OR3A 2P0NA 1MMDA 3RKOF 4JE9A 4IGGA 3U5SA 1VLTA 1T9KA 2M64A 2W9YA 4HE8D 4YK5A 2R7QA 2YLDA 1ZHYA 1AVOB 2L7AA 3OEOA 3I4UA 3Q7LA 2EIJC 4EHPA 5A6BA 1SYQA 3ABMC 3UMKA 2XLMA 3UMIA 3TJ5A 1T6UA 2Y3HA 2YL0A 3LLIA 3CZ6A 1PD0A 2HJMA 2IXMA 1E2XA 2QY9A 3T9OA 4YL0A 4MVUA 1OKKA 3I5PA 2VCBA 2KC3A 4MNDA 5COGA 4MQ9F 1HW2A 2OOCA 5JT4A 2NUTB 2YVKA 3AGTA 5F28E 4YWQA 3SXKA 1ORYA 3JYHA 3RFYA 2NUTA 4EBKA 1SZIA 2CYDA 1CPRA 2J7PA 3EZIA 4EKWA 2XSEA 4G0HA 3EH1A 4MW8A 1T5OA 3B29A 3GWLA 2IM8A 1YAUO 2A6EF 4PFOA 3K1IC 3SXYA 2AWCA 2EILC 2YWAA 2BL2A 3JSEO 4IB4A 4QI0A 3SXZA 4AL0A 1OCCC 4DOZA 1A7DA 2A69F 3QZCA 2ZPAA 2YEVA 4GQHA 4XLNF 3ZSUA 1EA8A 1C02A 4YT2A 4F4BA 3B71A 3JYYA 5A69A 4P6IC 4JVSA 5JSLA 4L6RA 4LLCA 2EPMX 1NLXA 1TR2A 1UG7A 5A6AA 3QTHA 1GGQA 4OIPF 5JRAA 4MS2A 3RH3A 3WODF 4IWBA 1JOGA 3L1MA 5HV9A 3TK0A 4DRIB 3JTLO 2J9BA 4U5HA 3EFOB 3SP1A 3E9VA 2YHSA 3SNHA 1M2VA 2DI3A 1FTSA 2QNLA 1XZPA 3C8GD 1CGOA 4PK4A 2J9VA 1HMOA 1SR2A 5DS4A 1O5HA 2PNOA 4CSAC 1RMVA 4LERA 5D92A 1XWJA 1RCPA 1KU2A 1MNEA 2DGJA 2A0BA 2OCCC 4O79A 3S27A 1Q0FA 2CDQA 5F5HA 2KK1A 4U5BE 1Z7Qc 3MX3A 4DRJB 4YT4A 3HNIA 3CSKA 1EQ1A 3ASOC 4KC9A 4MVMA 3K33A 3C7JA 1PCXA 1MMGA 2Y69C 3C18A 4UDVA 1ZHZA 2IXPA 3AQBA 3GEEA 5DLJA 3S84A 1YA9A 1O87A 3FXHA 4BEJA 4IARA 1KNYA 1OQCA 1GS9A 3GEHA 1S05A 1H9GA 3CAXA 1NU7D 4Q7CA 1D0XA 2FAPB 1WATA 1Y6DA 4N06A 4PJJA 5B1BC 4HEAJ 4DBQA 4N6HA 4D4XA 1H7IA 3DAFA 3NRHA 1Q0DA 2JPUA 4BG0A 3MBGA 2A6HF 5A6KA 2W45A 4MVRA 3GM2A 4D4NA 2A0UA 2HV7A 2XLHA 3PDMP 4CBEA 4BJ5A 5L0HA 1RJ9B 1JAFA 4JZAA 4FAPB 1MQVA 3S29A 4OIOF 5K0IA 3SEOA 1RJ9A 2OG2A 3O39A 3TQOA 4GEHA 3TULA 2KYHA 2UUHA 3SZRA 3BRJA 3JCUQ 3U8PA 3ZC4A 1QSPA 2YKZA 4AE4B 5EGYA 4CDVA 2IYLD 2LP4A 3WAQA 2XM4A 4MTOA 2V26A 3NMKA 3NKDA 1EI7A 2NUPA 2LFFA 1W2WA 2CNWA 1BR2A 1TFKB 1ZZPA 3DKAA 4HFFB 3HTKC 3W8IA 4OD4A 2VC9A 1JMWA 2L6FA 5CIVA 1I4ZA 1VLSA 3TD7A 4J7TA 4QDLA 1EKYA 2MWQA 2KQ9A 1H9TA 1A41A 1ORJA 2Y3DA 3EG9B 4CS7A 4NTFA 3RQEA 3SXMA 2VCCA 3VF0A 3EG9A 2YL1A 3UR3C 3U9JA 4Q5SF 5DVWA 3EH2A 1YDIA 2R7WA 4NTAA 2A68F 1BBHA 5KYWB 3LESA 5KYXB 3RVYA 2XL4A 5KYYA 3BEHA 2OEVA 3DM5A 2WB7A 4JEBA 5KYXA 5KYWA 4I44A 2HJ3A 5B3SC 2FFHA 1ZU5A 2Y39A 2DYRC 3ATPA 3G4XA 3W2VA 4ZLDA 2HV6A 3GM3A 4E0IA 3K1IA 2PP4A 2BE5F 3O10A 2HKVA 1YARO 1WWPA 2YL3A 3U2MA 5DQZA 5FZTA 3M79A 4XTKA 2L9JA 2XL8A 5A6JA 3DJUB 1LE2A 3EGDB 5JUAA 1YLMA 3C62A 4JRZA 1GQAA 4JKVA 4JTAB 3EGDA 1VOMA 3L34A 3T6GB 3T4RA 3US6A 2H7OA 4LLEA 2V3CC 3NMJA 1G5ZA 4MW3A 4ANJA 2GDCA 4PACA 3N0TA 3QW1A 4A4AA 3KYIA 1ZW3A 1AEPA 4OIRF 3ZWIA 2Q4FA 2J9UA 1ST6A 2YRFA 4CS9C 1DOVA 1YYXA 5EHHA 3Q7GA 1H6GA 1IW7F 3HJCA 3LEOA 2AP3A 3GEIA 1FFHA 3X1OA 4PR9A 4W8KA 1LI5A 2OEXA 4BJ6A 2C04A 2P6VA 3NYLA 1HE9A 4C3EA 5GPGB 2GAQA 4CDAA 2LIGA 4ULWA 2JD3A 1QQ3A 1VYKA 4CIHA 4DBRA 2X0CA 3S0XA 1CGME 2OKUA 3WHNA 2WZGA 2KW3C 4RD9A 4WGZA 1LPEA 1TKNA 3LLKA 1D0ZA 4YL3A 3CQZA 1O3UA 4PFPA 1FNTc 2P61A 2XLWA 5AGFA 4U5FE 1RKCA 5TJ5E 5A6BD 4MVQA 4X0RA 1OXKA 2LK4A 2J45A 4ER9A 4E18A 3M1CB 3B0VC 3B0UX 3DI5A 3FDQA 1D1CA 3HKKA 4CJGA 4Q4ZF 3JZ0A 1D0YA 3GODA 3ASNC 3DE8A 3V5XA 3JT1A 3U9MA 1R5ID 5IY5C 1FMWA 1OKKD 1OW8A 3F47A 1LM3B 3AG2C 4KNWA 4WABA 1WTYA 3JRMO 5E33A 4H54A 1M56C 1BDJB 4JCZA 1Z63A 1HE1A 1MMAA 3FAPB 1I5NA 2B0JA 3AGUA 3QVZA 3EFOA 3RVZA 3I5QA 1J8MF 2J7PD 3AQCA 3H65A 4MVOA 2EPKX 2A1DD 3E70C 4U9DA 4LDKA 2NSGA 2WZFA 3LNMB 4NQFA 4XPWA 1WASA 3AG3C 5L0DA 2VB6A 2OJED 3A9CA 3EGXB 1U0BB 2KGOA 2HFIA 1LIHA 4C7OB 3EGXA 1G4US 2AU5A 2M4EA 4G7ZF 2Q3TA 4C7OA 1M57C 4U5DE 3X2QC 1OW6A 1E84A 4BEMJ 1ZHXA 3NYJA 4H4KC 4ONSA 4XWJA 3IEEA 1AUEA 1D1AA 3LNRA 4JCHA 2D4UA 4AL1A 3DZAA 4DRHB 5L0GA 3RIPA 2ZXPA 2I15A 3LEVA 4G78A 4Z9IA 3W2WA 4CIPA 5CI8A 1TFOB 1I4YA 4C3DA 1SMYF 2L6GA 4IJJA 1ORSC 2OJQA 1WOLA 3LUTB 3MYFA 3M4CA 4HFKB 1V54C 3AG1C 2C03A 1U6HA 2J46A 2L6HA 2VASA 1V4AA 3FVYA 3V5ZA 1KTMA 3FOPA 1Q0MA 3AOUA 3NDBB 4I1OB 1R4TA 3B0PA 2ZD9A 1ZHWA
chains in the Genus database with same CATH topology
3S84A 1AEPA 1LS4A 1YA9A 1B68A 1BZ4A 1GS9A 2KC3A 1NFOA 3R2PA 1H7IA 1OR2A 1OR3A 1NFNA 1LE4A 1LE2A 1LPEA 1EQ1A 1EA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S84 A;  1AEP A;  1LS4 A;  1YA9 A;  1B68 A;  1BZ4 A;  1GS9 A;  2KC3 A;  1NFO A;  3R2P A;  1H7I A;  1OR2 A;  1OR3 A;  1NFN A;  1LE4 A;  1LE2 A;  1LPE A;  1EQ1 A;  1EA8 A; 
#chains in the Genus database with same CATH topology
 1C03 A;  1Y4C A;  5CI9 A;  3JRT A;  3RQF A;  2WVN A;  1YYJ A;  3PMR A;  3POV A;  3G4Z A;  4FX5 A;  4CS8 C;  4CX9 A;  1CPQ A;  1FR0 A;  2EIN C;  3IQT A;  1OXB A;  3L8I A;  4U5E E;  3CEX A;  4AE4 A;  2CGE A;  1HMD A;  3DAG A;  1Q0K A;  1QPU A;  2IXN A;  3V7O A;  2R7U A;  1DOW A;  3UMH A;  5L0C A;  3NYM A;  1NFN A;  2ETS A;  3A11 A;  2R7V A;  5B3I A;  3VM6 A;  1OCZ C;  2E87 A;  3QW0 A;  3EPV A;  3HLZ A;  4JEA A;  3PHF 2;  2XM0 A;  4JTC B;  2TMV P;  4JJF A;  4DJ9 A;  2R05 A;  1K05 A;  4JC7 A;  2BC5 A;  2XLV A;  2YL7 A;  3FHD A;  1LS1 A;  2W4B A;  4LDR A;  2QLA A;  4EIY A;  1WGW A;  3VYW A;  2PF4 E;  4YN0 B;  5T3T A;  2JX0 A;  3Q6M A;  5L3V A;  2R03 A;  2HUJ A;  2Q7R A;  3K7D A;  4WJ0 A;  4EBJ A;  2J0X A;  5L0J A;  3EZH A;  2Z15 A;  5L0I A;  2O9X A;  3GAN A;  4BJT A;  5DS6 A;  2XL6 A;  3HNL A;  1YA7 O;  4XQ1 A;  5BUO A;  4CDY A;  5T3W A;  2J0W A;  4BPM A;  2OU6 A;  2YZS A;  4C3B A;  3TOL A;  1QZX A;  1CGN A;  2XLO A;  2CCY A;  4Z9J A;  4YT8 A;  4OIQ F;  1YZA A;  1OCO C;  2ZXO A;  5E3C A;  4AX2 A;  2QUP A;  2LFD A;  3IQC A;  4AK9 A;  1NU9 C;  2XRH A;  2CNW D;  4JW1 A;  4YJW A;  3K6B A;  3DM9 B;  4O7G A;  2GWW A;  4O6N A;  2XLD A;  4K1O A;  2HS5 A;  2IXO A;  1T6Q A;  4XEF A;  4J32 B;  4BJ5 C;  2G62 A;  1J8Y F;  2EPN A;  3WG7 C;  2EIM C;  2KNH A;  3AG4 C;  4XPX A;  3S90 A;  1OCR C;  3C63 A;  3NKE A;  3V5Y A;  4BJ1 A;  2P7V A;  4YL1 A;  3AJM A;  3ZIB A;  3DMD A;  4DXW A;  1YJG A;  4EWC A;  2LQG A;  2R7R A;  4MVZ A;  2XS8 A;  4CSA A;  1V55 C;  1Z6A A;  4IAQ A;  1FFT C;  3ZTM A;  2Q9A A;  1K04 A;  1VMA A;  2R02 A;  2J9W A;  3S9O A;  5L0F A;  1JRA A;  4J30 B;  2HZ8 A;  1S7Z A;  1QLE C;  2CW0 F;  2Q9C A;  2B0H A;  4G7O F;  1F1M A;  3K1H A;  1Q0G A;  1UFB A;  3LS0 A;  1K40 A;  4I1M A;  5KYN A;  1A7E A;  1SF8 A;  4U9E A;  1RKE B;  2HMZ A;  4PJL A;  2KJG A;  1PD1 A;  3DD7 A;  3H2V A;  1VYI A;  3NMI A;  3DE9 A;  1G4W R;  1MND A;  1RKE A;  3EQL F;  2FGY A;  3FOO A;  2PX0 A;  5AC5 A;  3RF3 A;  3RW0 A;  3C8G B;  3IQ5 A;  3LJB A;  3R2P A;  4IRU A;  5B1A C;  3KH2 A;  3W4Y A;  2MHR A;  1WN0 A;  1L3P A;  3C8G A;  3T6J A;  3GM1 A;  3TOM A;  5DS5 A;  5BQH A;  2H8A A;  5JLI A;  2IOQ A;  3L0I A;  1XZQ A;  2Y3B A;  3M4B A;  3OWT A;  5FCL A;  5F5F A;  1JPN A;  4E0H A;  3NG1 A;  2LCH A;  4KBL A;  4E7Z A;  4A2N B;  3SYN A;  3KPH A;  2H7B A;  4XPY A;  3ZG1 A;  5JP7 A;  4PJN A;  4IAO A;  3VAY A;  2HMQ A;  2YQY A;  4OD5 A;  1QVX A;  1OW7 A;  3KMI A;  4DVZ A;  3U2L A;  2PX3 A;  4JIO A;  4NC3 A;  4CS8 A;  3DWW A;  3O55 A;  4RDA A;  3DXJ F;  2WVQ A;  1QKR A;  1JPJ A;  1VB5 A;  1B68 A;  1BZ4 A;  4E17 A;  1A0B A;  1Z23 A;  3UGO A;  3ITF A;  1NBB A;  5D91 A;  3QMK A;  5KYU B;  1M2V B;  3EJN A;  3FMS A;  3ZQY A;  2PFD A;  1BR1 A;  2Q00 A;  5DQT A;  5KYU A;  3C8Z A;  1A7V A;  4Z9H A;  3LS1 A;  5E2Q A;  2XXA B;  4BJ6 C;  2R7T A;  2ICW G;  4GYT A;  2XXA A;  2F22 A;  4XEV A;  4MVS A;  3ZVR A;  2RD9 A;  4N4W A;  4KI2 A;  1LI7 A;  1TWA A;  4JJG A;  4XLP F;  1M2O A;  2ZXW C;  1TWC A;  2L81 A;  4EBB A;  2VH3 A;  3ZQV A;  2AVK A;  4U5G A;  1NSG B;  2AWY A;  3JSZ A;  1RXQ A;  3QVY A;  3UGP A;  1GM5 A;  4NCQ A;  2RSE B;  1IZM A;  3GWN A;  3HNK A;  1G8X A;  1FAP B;  4O6Y A;  2DYS C;  2R7O A;  5COM A;  3VRC A;  2YLI A;  2X51 A;  4G7H F;  4YT5 A;  1LS4 A;  5BQI A;  2MYS A;  2NPU A;  2QTV A;  1E83 A;  3L8J A;  4O6M A;  3W8H A;  3U0C A;  1NZE A;  1NFO A;  2GFH A;  3U3B A;  3N24 A;  1N1C A;  1C17 M;  3ZTZ A;  5JS5 A;  2LSE A;  1OR2 A;  2J8W A;  3O6X A;  4FES A;  2G3V A;  4J7Y A;  2EPO A;  4R32 A;  4WGY A;  2HSQ A;  2R7X A;  3GOR A;  2NSF A;  1YVI A;  2YLG A;  3Q6N A;  4CJO A;  1ZYR F;  1VTM P;  4DVY P;  5BQG A;  3DJN B;  2R9R B;  1E85 A;  2WVO A;  4I3M A;  3MLG A;  1YZC A;  3N2Z B;  2R25 A;  4FWV A;  3ECS A;  4M63 A;  2H7V C;  4W8P A;  2IBF A;  4JUR I;  2HSB A;  2WL8 A;  3OA1 A;  4K7B A;  4K0D A;  1LKX A;  2G3K A;  2QE9 A;  1FMV A;  2Y3G A;  3K66 A;  3U8V A;  4CS9 A;  4E7S A;  2GA0 A;  256B A;  3EHM A;  3U3F A;  3ABL C;  1TWH A;  1PV3 A;  2UUI A;  3ABK C;  4OIN F;  5E3A A;  2OQM A;  3R7C A;  5HSW A;  1M6T A;  1ZHT A;  3HNJ A;  2XLE A;  3B9Q A;  5EK0 A;  4XEK A;  2D5R B;  3ZDL A;  4QI2 A;  1HY5 A;  2NUP B;  4ZLC A;  1BR4 A;  2VCA A;  1TQG A;  2EPL X;  4KNV A;  2I8B A;  3H2U A;  2ZXR A;  2LD6 A;  1ZVZ A;  3EHN A;  3KKB A;  4B6I A;  2XS1 A;  3RQG A;  3IHU A;  4MTF A;  1HW1 A;  4RBN A;  1LE4 A;  4N6C A;  5T1D B;  1T6I A;  1Z3I X;  3MYI A;  1T01 A;  2Q9B A;  2WZL A;  1MMN A;  4LAC B;  1ZU4 A;  5L3Q A;  2ASR A;  4PJM A;  1Z5Z A;  2PBE A;  3PCV A;  1L7C A;  3S28 A;  3UNG C;  2KSF A;  2P1A A;  3RYL A;  5AC4 A;  1E86 A;  3TJ6 A;  3IPM O;  2EIK C;  3IQ6 A;  5KYY B;  3G50 A;  1LVK A;  1V74 B;  1TWG A;  4P9F A;  4JTD B;  4P9T A;  2R7S A;  4ULV A;  4LDQ A;  1NG1 A;  3KL4 A;  3KYJ A;  3F46 A;  3FAJ A;  5COF A;  4EUK B;  4NY3 A;  3M15 A;  1VK5 A;  1JR8 A;  3MFN A;  4U5C E;  1APC A;  2DB4 A;  2NG1 A;  1ZW2 A;  4MTG A;  3J06 A;  1D1B A;  2W4M A;  1U89 A;  3LAY A;  3T6B A;  5JVE A;  4NTB A;  1OR3 A;  2P0N A;  1MMD A;  3RKO F;  4JE9 A;  4IGG A;  3U5S A;  1VLT A;  1T9K A;  2M64 A;  2W9Y A;  4HE8 D;  4YK5 A;  2R7Q A;  2YLD A;  1ZHY A;  1AVO B;  2L7A A;  3OEO A;  3I4U A;  3Q7L A;  2EIJ C;  4EHP A;  5A6B A;  1SYQ A;  3ABM C;  3UMK A;  2XLM A;  3UMI A;  3TJ5 A;  1T6U A;  2Y3H A;  2YL0 A;  3LLI A;  3CZ6 A;  1PD0 A;  2HJM A;  2IXM A;  1E2X A;  2QY9 A;  3T9O A;  4YL0 A;  4MVU A;  1OKK A;  3I5P A;  2VCB A;  2KC3 A;  4MND A;  5COG A;  4MQ9 F;  1HW2 A;  2OOC A;  5JT4 A;  2NUT B;  2YVK A;  3AGT A;  5F28 E;  4YWQ A;  3SXK A;  1ORY A;  3JYH A;  3RFY A;  2NUT A;  4EBK A;  1SZI A;  2CYD A;  1CPR A;  2J7P A;  3EZI A;  4EKW A;  2XSE A;  4G0H A;  3EH1 A;  4MW8 A;  1T5O A;  3B29 A;  3GWL A;  2IM8 A;  1YAU O;  2A6E F;  4PFO A;  3K1I C;  3SXY A;  2AWC A;  2EIL C;  2YWA A;  2BL2 A;  3JSE O;  4IB4 A;  4QI0 A;  3SXZ A;  4AL0 A;  1OCC C;  4DOZ A;  1A7D A;  2A69 F;  3QZC A;  2ZPA A;  2YEV A;  4GQH A;  4XLN F;  3ZSU A;  1EA8 A;  1C02 A;  4YT2 A;  4F4B A;  3B71 A;  3JYY A;  5A69 A;  4P6I C;  4JVS A;  5JSL A;  4L6R A;  4LLC A;  2EPM X;  1NLX A;  1TR2 A;  1UG7 A;  5A6A A;  3QTH A;  1GGQ A;  4OIP F;  5JRA A;  4MS2 A;  3RH3 A;  3WOD F;  4IWB A;  1JOG A;  3L1M A;  5HV9 A;  3TK0 A;  4DRI B;  3JTL O;  2J9B A;  4U5H A;  3EFO B;  3SP1 A;  3E9V A;  2YHS A;  3SNH A;  1M2V A;  2DI3 A;  1FTS A;  2QNL A;  1XZP A;  3C8G D;  1CGO A;  4PK4 A;  2J9V A;  1HMO A;  1SR2 A;  5DS4 A;  1O5H A;  2PNO A;  4CSA C;  1RMV A;  4LER A;  5D92 A;  1XWJ A;  1RCP A;  1KU2 A;  1MNE A;  2DGJ A;  2A0B A;  2OCC C;  4O79 A;  3S27 A;  1Q0F A;  2CDQ A;  5F5H A;  2KK1 A;  4U5B E;  1Z7Q c;  3MX3 A;  4DRJ B;  4YT4 A;  3HNI A;  3CSK A;  1EQ1 A;  3ASO C;  4KC9 A;  4MVM A;  3K33 A;  3C7J A;  1PCX A;  1MMG A;  2Y69 C;  3C18 A;  4UDV A;  1ZHZ A;  2IXP A;  3AQB A;  3GEE A;  5DLJ A;  3S84 A;  1YA9 A;  1O87 A;  3FXH A;  4BEJ A;  4IAR A;  1KNY A;  1OQC A;  1GS9 A;  3GEH A;  1S05 A;  1H9G A;  3CAX A;  1NU7 D;  4Q7C A;  1D0X A;  2FAP B;  1WAT A;  1Y6D A;  4N06 A;  4PJJ A;  5B1B C;  4HEA J;  4DBQ A;  4N6H A;  4D4X A;  1H7I A;  3DAF A;  3NRH A;  1Q0D A;  2JPU A;  4BG0 A;  3MBG A;  2A6H F;  5A6K A;  2W45 A;  4MVR A;  3GM2 A;  4D4N A;  2A0U A;  2HV7 A;  2XLH A;  3PDM P;  4CBE A;  4BJ5 A;  5L0H A;  1RJ9 B;  1JAF A;  4JZA A;  4FAP B;  1MQV A;  3S29 A;  4OIO F;  5K0I A;  3SEO A;  1RJ9 A;  2OG2 A;  3O39 A;  3TQO A;  4GEH A;  3TUL A;  2KYH A;  2UUH A;  3SZR A;  3BRJ A;  3JCU Q;  3U8P A;  3ZC4 A;  1QSP A;  2YKZ A;  4AE4 B;  5EGY A;  4CDV A;  2IYL D;  2LP4 A;  3WAQ A;  2XM4 A;  4MTO A;  2V26 A;  3NMK A;  3NKD A;  1EI7 A;  2NUP A;  2LFF A;  1W2W A;  2CNW A;  1BR2 A;  1TFK B;  1ZZP A;  3DKA A;  4HFF B;  3HTK C;  3W8I A;  4OD4 A;  2VC9 A;  1JMW A;  2L6F A;  5CIV A;  1I4Z A;  1VLS A;  3TD7 A;  4J7T A;  4QDL A;  1EKY A;  2MWQ A;  2KQ9 A;  1H9T A;  1A41 A;  1ORJ A;  2Y3D A;  3EG9 B;  4CS7 A;  4NTF A;  3RQE A;  3SXM A;  2VCC A;  3VF0 A;  3EG9 A;  2YL1 A;  3UR3 C;  3U9J A;  4Q5S F;  5DVW A;  3EH2 A;  1YDI A;  2R7W A;  4NTA A;  2A68 F;  1BBH A;  5KYW B;  3LES A;  5KYX B;  3RVY A;  2XL4 A;  5KYY A;  3BEH A;  2OEV A;  3DM5 A;  2WB7 A;  4JEB A;  5KYX A;  5KYW A;  4I44 A;  2HJ3 A;  5B3S C;  2FFH A;  1ZU5 A;  2Y39 A;  2DYR C;  3ATP A;  3G4X A;  3W2V A;  4ZLD A;  2HV6 A;  3GM3 A;  4E0I A;  3K1I A;  2PP4 A;  2BE5 F;  3O10 A;  2HKV A;  1YAR O;  1WWP A;  2YL3 A;  3U2M A;  5DQZ A;  5FZT A;  3M79 A;  4XTK A;  2L9J A;  2XL8 A;  5A6J A;  3DJU B;  1LE2 A;  3EGD B;  5JUA A;  1YLM A;  3C62 A;  4JRZ A;  1GQA A;  4JKV A;  4JTA B;  3EGD A;  1VOM A;  3L34 A;  3T6G B;  3T4R A;  3US6 A;  2H7O A;  4LLE A;  2V3C C;  3NMJ A;  1G5Z A;  4MW3 A;  4ANJ A;  2GDC A;  4PAC A;  3N0T A;  3QW1 A;  4A4A A;  3KYI A;  1ZW3 A;  1AEP A;  4OIR F;  3ZWI A;  2Q4F A;  2J9U A;  1ST6 A;  2YRF A;  4CS9 C;  1DOV A;  1YYX A;  5EHH A;  3Q7G A;  1H6G A;  1IW7 F;  3HJC A;  3LEO A;  2AP3 A;  3GEI A;  1FFH A;  3X1O A;  4PR9 A;  4W8K A;  1LI5 A;  2OEX A;  4BJ6 A;  2C04 A;  2P6V A;  3NYL A;  1HE9 A;  4C3E A;  5GPG B;  2GAQ A;  4CDA A;  2LIG A;  4ULW A;  2JD3 A;  1QQ3 A;  1VYK A;  4CIH A;  4DBR A;  2X0C A;  3S0X A;  1CGM E;  2OKU A;  3WHN A;  2WZG A;  2KW3 C;  4RD9 A;  4WGZ A;  1LPE A;  1TKN A;  3LLK A;  1D0Z A;  4YL3 A;  3CQZ A;  1O3U A;  4PFP A;  1FNT c;  2P61 A;  2XLW A;  5AGF A;  4U5F E;  1RKC A;  5TJ5 E;  5A6B D;  4MVQ A;  4X0R A;  1OXK A;  2LK4 A;  2J45 A;  4ER9 A;  4E18 A;  3M1C B;  3B0V C;  3B0U X;  3DI5 A;  3FDQ A;  1D1C A;  3HKK A;  4CJG A;  4Q4Z F;  3JZ0 A;  1D0Y A;  3GOD A;  3ASN C;  3DE8 A;  3V5X A;  3JT1 A;  3U9M A;  1R5I D;  5IY5 C;  1FMW A;  1OKK D;  1OW8 A;  3F47 A;  1LM3 B;  3AG2 C;  4KNW A;  4WAB A;  1WTY A;  3JRM O;  5E33 A;  4H54 A;  1M56 C;  1BDJ B;  4JCZ A;  1Z63 A;  1HE1 A;  1MMA A;  3FAP B;  1I5N A;  2B0J A;  3AGU A;  3QVZ A;  3EFO A;  3RVZ A;  3I5Q A;  1J8M F;  2J7P D;  3AQC A;  3H65 A;  4MVO A;  2EPK X;  2A1D D;  3E70 C;  4U9D A;  4LDK A;  2NSG A;  2WZF A;  3LNM B;  4NQF A;  4XPW A;  1WAS A;  3AG3 C;  5L0D A;  2VB6 A;  2OJE D;  3A9C A;  3EGX B;  1U0B B;  2KGO A;  2HFI A;  1LIH A;  4C7O B;  3EGX A;  1G4U S;  2AU5 A;  2M4E A;  4G7Z F;  2Q3T A;  4C7O A;  1M57 C;  4U5D E;  3X2Q C;  1OW6 A;  1E84 A;  4BEM J;  1ZHX A;  3NYJ A;  4H4K C;  4ONS A;  4XWJ A;  3IEE A;  1AUE A;  1D1A A;  3LNR A;  4JCH A;  2D4U A;  4AL1 A;  3DZA A;  4DRH B;  5L0G A;  3RIP A;  2ZXP A;  2I15 A;  3LEV A;  4G78 A;  4Z9I A;  3W2W A;  4CIP A;  5CI8 A;  1TFO B;  1I4Y A;  4C3D A;  1SMY F;  2L6G A;  4IJJ A;  1ORS C;  2OJQ A;  1WOL A;  3LUT B;  3MYF A;  3M4C A;  4HFK B;  1V54 C;  3AG1 C;  2C03 A;  1U6H A;  2J46 A;  2L6H A;  2VAS A;  1V4A A;  3FVY A;  3V5Z A;  1KTM A;  3FOP A;  1Q0M A;  3AOU A;  3NDB B;  4I1O B;  1R4T A;  3B0P A;  2ZD9 A;  1ZHW A; 
#chains in the Genus database with same CATH homology
 3S84 A;  1AEP A;  1LS4 A;  1YA9 A;  1B68 A;  1BZ4 A;  1GS9 A;  2KC3 A;  1NFO A;  3R2P A;  1H7I A;  1OR2 A;  1OR3 A;  1NFN A;  1LE4 A;  1LE2 A;  1LPE A;  1EQ1 A;  1EA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...