2KC3A

Nmr solution structure of complete receptor binding domain of human apolipoprotein e
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A complete receptor binding domain of human apolipoprotein E
rcsb
source organism Homo sapiens
molecule tags Lipoprotein
molecule keywords Apolipoprotein E
total genus 58
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2008-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 2kc3A00
1B68A 1H7IA 1NFNA 1OR3A 1YA9A 1GS9A 1NFOA 3S84A 1AEPA 1EQ1A 2KC3A 1LS4A 1OR2A 3R2PA 1LPEA 1LE4A 1EA8A 1LE2A 1BZ4A
chains in the Genus database with same CATH superfamily
2HV7A 3GWLA 3RKOF 4EHPA 2LP4A 4MVZA 1LI7A 1LIHA 2DYRC 2G62A 3EQLF 2DGJA 2J46A 2PP4A 3ABKC 3GEHA 4K7BA 4RDAA 2Q00A 2X0CA 3V5YA 1ZHXA 2QE9A 1NFOA 2CNWD 2YLGA 1MMAA 3LEVA 2L6HA 2Y3BA 2EIJC 4LLEA 4Z9IA 4CDVA 3PHF2 4M63A 1RJ9B 2YRFA 2HJ3A 4R32A 4AX2A 1PV3A 4HFFB 4WABA 1WN0A 1RCPA 1JPJA 2MWQA 4W8KA 3TULA 5T3TA 2GAQA 2IXMA 5COFA 2BC5A 2PX3A 1BZ4A 1CGNA 2YL1A 2C03A 3W8HA 3EGXB 3FOPA 2D4UA 5D92A 3RQGA 4YWQA 3FOOA 4Q5SF 1Z6AA 3HNJA 3RF3A 4CSAC 3W8IA 2YWAA 1T6QA 1MMGA 4I1OB 4W8PA 4MW3A 1TFKB 3QW1A 3ECSA 4O6YA 2HS5A 3KMIA 3U3BA 1SF8A 1ZU4A 1VTMP 4OIPF 2Y69C 4BJ1A 4EWCA 1IZMA 3RVZA 2XM4A 3BEHA 2A0UA 1YLMA 4Q7CA 3RVYA 3QVZA 1XZQA 2EPMX 4MQ9F 2I8BA 3RW0A 2H8AA 4BJ6C 5L0DA 4MTFA 1LE4A 2NUPB 4DJ9A 1LE2A 3CEXA 3F46A 1JPNA 3SNHA 5JUAA 4D4XA 2CW0F 2KYHA 2Y3HA 1HW2A 1TR2A 1E86A 3U3FA 2EINC 1A7VA 2FFHA 2EPLX 4XEKA 1ZYRF 4NQFA 1QLEC 1XWJA 2A69F 2W4MA 3K33A 3LS0A 1NLXA 2AWCA 4F4BA 2XSEA 2ETSA 2D5RB 3MFNA 4NTBA 4DRIB 3TJ5A 5BQIA 2R7VA 4AE4B 4JJFA 4MTOA 3B0VC 4CJOA 1C03A 1OCOC 1Y6DA 4JVSA 1R5ID 2EILC 2P6VA 4P6IC 1I4ZA 1CPRA 1M6TA 1Q0MA 2J0WA 3EFOA 1L3PA 4NTFA 4QDLA 1NBBA 4HEAJ 2P1AA 4I3MA 1Z3IX 4KNVA 2EPNA 1Q0GA 1NSGB 1ORSC 5CI8A 2Q9BA 5E2QA 4PK4A 1F1MA 1D0XA 1V74B 5KYYB 1U0BB 3LLIA 3SXKA 4H4KC 4OIQF 2PFDA 3ZWIA 5HSWA 1V4AA 2WVOA 4PFPA 3I4UA 4YN0B 2LFFA 2OEVA 2ZPAA 4JKVA 3HNKA 1E84A 1RJ9A 2Q4FA 4CS7A 4G7OF 2J9VA 3U2LA 2IXOA 5DS4A 1S05A 2J7PA 2QY9A 5L0CA 4E18A 2XS8A 1OR2A 4EKWA 1W2WA 4DRJB 3K7DA 1WOLA 4JTCB 4EIYA 2R7OA 2XLDA 1MQVA 4J32B 4BJ5A 1FMVA 1QKRA 3JRMO 2A6EF 3OWTA 3C63A 2WVQA 1RKEB 4NY3A 2LIGA 3PCVA 5E33A 4D4NA 4G7ZF 2QTVA 5AGFA 1YVIA 2JD3A 2L81A 1A0BA 3AG3C 1EKYA 4LLCA 3FXHA 4JEAA 2LSEA 4Z9JA 2CCYA 3TK0A 3WODF 1TWGA 256BA 2R03A 3AQCA 3S28A 2VB6A 4G78A 3NYJA 4PFOA 4OD5A 4NTAA 3ITFA 3L8IA 5F5HA 2NSGA 4YL1A 4U5CE 5T3WA 1SYQA 4WGYA 2LK4A 1SR2A 3C8ZA 4L6RA 2OKUA 1YA7O 1OCZC 1DOVA 4U5FE 3K1HA 1K40A 5B1BC 2MHRA 2IBFA 2IXPA 3ATPA 4ONSA 2ZXRA 4BJTA 1K04A 3V7OA 5B3SC 5FCLA 1LS1A 3LLKA 1PD1A 1CGOA 3ABLC 4YK5A 3CQZA 3SYNA 4DBRA 2W9YA 4BG0A 2Q7RA 2AU5A 3HKKA 3S9OA 3ZTZA 5JVEA 3C18A 1YYXA 2L9JA 1FFTC 5AC4A 3ZG1A 2J9UA 4PR9A 5B1AC 1YA9A 3DKAA 4CS9A 1LKXA 3B0PA 3N24A 4MTGA 3M4BA 3AGTA 4PJLA 3ZC4A 1OW7A 3T9OA 2DYSC 5CIVA 5KYWB 1U89A 1VB5A 1EQ1A 2YL3A 3KPHA 2YLIA 3KYJA 4A2NB 4E0IA 1Z63A 3ZSUA 2H7VC 3GM1A 4K1OA 3GEIA 4CS8C 4BJ5C 3LAYA 2WVNA 2R9RB 2QNLA 1LM3B 1XZPA 3FDQA 5L3VA 2AVKA 4KNWA 4CJGA 2R05A 3HJCA 2Z15A 5JP7A 1WWPA 5BQGA 1CPQA 3M15A 1OXBA 3G4XA 4E0HA 4YT8A 2C04A 5KYXA 1MMNA 2IYLD 2J7PD 2UUIA 4U5EE 4DOZA 3C8GA 4J7TA 4DXWA 3IPMO 3Q7LA 2HUJA 3Q6MA 4XTKA 3DXJF 5COMA 4E7SA 4RBNA 1HMOA 3MYIA 4JRZA 4ZLDA 4ANJA 3SXYA 3EGDB 1TWAA 4OD4A 1HY5A 1H9TA 2HSBA 2J9BA 3C7JA 4OIRF 4GEHA 3TQOA 2OQMA 4A4AA 2R7SA 3K1IC 1QVXA 3DM5A 1PCXA 4IARA 5KYYA 4C3BA 4JW1A 2PX0A 3JCUQ 4EBJA 3JSZA 1ZHYA 2OCCC 3R2PA 4HFKB 4JEBA 1BR4A 3JZ0A 2QUPA 1QQ3A 2ZXWC 2EPKX 3EFOB 3NMKA 3T6GB 2GFHA 4ULVA 4E17A 1S7ZA 2A1DD 2LCHA 4IB4A 4O79A 2VC9A 5IY5C 4JIOA 3NMJA 4XPYA 3TOLA 1E85A 2Q9CA 4BEMJ 2GDCA 1FNTc 1T01A 4MVRA 4IGGA 3X2QC 2XS1A 1OW6A 1WGWA 2P61A 3NG1A 1SZIA 5A6JA 3I5QA 4DBQA 1AEPA 2KGOA 4LDRA 2YKZA 5KYUA 4CX9A 1ORJA 3TJ6A 1ZU5A 2EIMC 3UGOA 1NU7D 1T6IA 1Q0DA 1SMYF 3EG9A 3NMIA 4JZAA 4B6IA 1O87A 2GA0A 3TOMA 1GGQA 1G4US 1HW1A 3G4ZA 3A11A 1YJGA 3ZTMA 3US6A 4N6CA 2KC3A 2YLDA 3ABMC 3NYMA 2XXAB 4JJGA 4JCHA 5T1DB 2CNWA 1JAFA 4IAQA 3IQTA 3V5ZA 2HV6A 1ZVZA 2L7AA 4U9EA 4XPWA 1M2VB 4XEVA 4BEJA 2A0BA 1FR0A 1A7DA 4IWBA 2WL8A 3FAPB 4H54A 1OQCA 3GORA 2Y3GA 1QSPA 2VASA 5JS5A 3T6BA 1TQGA 3L8JA 3QW0A 4XWJA 4FAPB 2OG2A 4NCQA 3QMKA 2R7UA 1QPUA 3E9VA 1JOGA 3DI5A 2J9WA 2X51A 3H2UA 3JSEO 2DB4A 1WASA 3LNMB 4AL1A 4CS8A 2RD9A 3EZIA 2HMQA 2XLVA 3IEEA 2ZD9A 3S27A 1GQAA 3DE8A 3L34A 4IAOA 1MNDA 4MVMA 4AK9A 4CBEA 4CIPA 2HSQA 3MYFA 1TFOB 1Q0KA 3KH2A 1Z5ZA 1J8MF 3AG1C 3VF0A 1YZAA 2A68F 2G3KA 5JLIA 2Y3DA 4HE8D 3AG2C 5BUOA 2IM8A 4YT5A 4MVOA 4DRHB 3O39A 4P9FA 1D0YA 1EA8A 2FGYA 2KSFA 2IXNA 3L1MA 2NUTA 4JTAB 4N6HA 4MVQA 3W2WA 3UGPA 2TMVP 4N06A 2Q3TA 3IQ5A 3RH3A 2HZ8A 5JT4A 4DVZA 3GM3A 4FWVA 3O55A 3B29A 3FVYA 2JPUA 2I15A 3V5XA 5A6BA 2J8WA 3LUTB 3J06A 2VCBA 5TJ5E 2H7OA 1K05A 2EIKC 1CGME 1VOMA 3N2ZB 1TWCA 2FAPB 1B68A 4YJWA 3POVA 5JSLA 2CGEA 1ZZPA 4K0DA 3Q7GA 1M2VA 2KK1A 2XLHA 2MYSA 1YARO 2ZXPA 3H65A 3S0XA 4UDVA 3TD7A 3PDMP 4G0HA 3JT1A 2CYDA 2HKVA 1H7IA 2J45A 2KNHA 1D0ZA 1APCA 1LVKA 1V54C 3GM2A 3SP1A 4U5GA 1OCRC 3LEOA 3G50A 3W4YA 1E83A 2XL8A 3B9QA 1A41A 2NPUA 4LDKA 4G7HF 2CDQA 4KC9A 3X1OA 4PJJA 1YZCA 2YZSA 4EUKB 5DS5A 3IQCA 1RKEA 1HMDA 1HE9A 2WB7A 2IOQA 3LESA 5AC5A 2OJED 3T4RA 4C3DA 1YYJA 4XLPF 4CDYA 4X0RA 1Z23A 3NKDA 4QI2A 1G4WR 3JYHA 2OJQA 3DD7A 5A6BD 5JRAA 3VAYA 5F5FA 1AUEA 4MVSA 3UMHA 3ZQVA 2JX0A 2R7RA 1D1BA 1ST6A 2LQGA 1VMAA 1VYIA 3E70C 1RKCA 3JRTA 4YL0A 4J30B 4XLNF 3OA1A 1ZW3A 3S84A 2R7TA 1KNYA 3RQEA 3DZAA 3U9MA 1OW8A 2KJGA 3U5SA 1E2XA 1ZW2A 2G3VA 2R25A 1OCCC 3HNLA 3CSKA 3ZQYA 3GANA 2HFIA 2XM0A 3O6XA 1OXKA 2LFDA 2XLEA 4U5DE 5EGYA 4JC7A 3NYLA 2YEVA 1FTSA 1D1CA 4U5HA 4FESA 5K0IA 3UMKA 2GWWA 2YHSA 4JE9A 5L0HA 2B0JA 1NZEA 3AG4C 3DAFA 3ZDLA 3T6JA 2UUHA 4C7OA 3DM9B 3QTHA 4O7GA 3GEEA 4AE4A 1BR1A 1D1AA 3VRCA 1MNEA 4I44A 1HE1A 1FFHA 1YDIA 4WJ0A 1G5ZA 3S29A 1MMDA 2A6HF 2YQYA 3ASOC 1FMWA 2R7WA 3LNRA 4YL3A 1Y4CA 4CS9C 2R02A 3MX3A 1I4YA 3OEOA 2F22A 3L0IA 4RD9A 3DMDA 5KYXB 3S90A 1UFBA 3IQ6A 4IRUA 4LDQA 4MNDA 4P9TA 5E3AA 4BJ6A 1QZXA 2R7QA 4FX5A 4J7YA 4XPXA 1L7CA 3AQBA 1DOWA 3H2VA 1T6UA 2M4EA 3SEOA 4C7OB 5GPGB 4OIOF 3LS1A 1VK5A 3MBGA 2RSEB 3WAQA 3RQFA 2O9XA 4ER9A 2XLMA 3A9CA 2V26A 3FAJA 4MS2A 3W2VA 1H6GA 5KYUB 1O3UA 3WG7C 3K6BA 2EPOA 3I5PA 1NG1A 2AP3A 1R4TA 2YVKA 3EGXA 3M79A 3WHNA 5A6KA 2XL6A 3EGDA 2J0XA 2Q9AA 3QVYA 3B71A 5DQZA 1NFNA 2ICWG 3LJBA 4E7ZA 1Z7Qc 2E87A 3GODA 3PMRA 1T9KA 5L3QA 1PD0A 2PBEA 2NSFA 2NG1A 2YL7A 3DJUB 1ZHWA 3FMSA 3KYIA 4U9DA 2XRHA 3B0UX 3AJMA 4NC3A 3SXMA 5HV9A 5L0IA 3Q6NA 3R7CA 1LS4A 3U2MA 3UMIA 2XLOA 3EH2A 4JURI 3ZVRA 4KI2A 3AOUA 2YL0A 4U5BE 1TWHA 4LACB 1JMWA 4QI0A 5B3IA 5FZTA 4O6NA 1M2OA 2BE5F 5COGA 3F47A 1TKNA 4GYTA 5A69A 1LPEA 2M64A 4CDAA 4N4WA 1JR8A 1OKKA 1N1CA 1BBHA 3KL4A 2B0HA 2V3CC 2HJMA 3EH1A 3HLZA 4MW8A 5F28E 2P0NA 5L0GA 4JCZA 1ZHTA 3EZHA 2R7XA 1OR3A 3SXZA 2QLAA 3DWWA 2PNOA 4YT2A 1I5NA 3M4CA 2ZXOA 1A7EA 1RXQA 3SZRA 2OU6A 3NKEA 4Z9HA 3VYWA 3DE9A 5BQHA 3EPVA 4IJJA 3U8VA 3UR3C 3NDBB 1BR2A 2L6GA 3ZIBA 4XQ1A 3U9JA 3EHMA 1M57C 3K66A 1C17M 1ORYA 1KU2A 2PF4E 2VCAA 5E3CA 5EK0A 2BL2A 1KTMA 1FAPB 1GS9A 5EHHA 1UG7A 3FHDA 3HTKC 3JTLO 1J8YF 2L6FA 4AL0A 5DS6A 3C8GD 3M1CB 1O5HA 5L0JA 3DAGA 2WZGA 1Q0FA 1V55C 4CIHA 3GWNA 2LD6A 3DJNB 4PJMA 2AWYA 4EBKA 2WZFA 1WTYA 5DLJA 1T5OA 4I1MA 1AVOB 3JYYA 2KW3C 4DVYP 1EI7A 4Q4ZF 4ULWA 3CAXA 1IW7F 3AGUA 4LERA 2HMZA 2KQ9A 5A6AA 2H7BA 3RIPA 3RYLA 3UNGC 1G8XA 2VH3A 1JRAA 3C8GB 3N0TA 3U0CA 2OEXA 1WATA 3EJNA 4O6MA 2W4BA 5DVWA 4ZLCA 2XLWA 1VLSA 1BDJB 4PJNA 1H9GA 5CI9A 4C3EA 3KKBA 3VM6A 4KBLA 4YT4A 3IHUA 3EHNA 2DI3A 5KYNA 3K1IA 2VCCA 1C02A 3QZCA 4CSAA 3NRHA 1ZHZA 3MLGA 5D91A 1NU9C 3O10A 1RMVA 5KYWA 2OOCA 2WZLA 2Y39A 2NUTB 4XEFA 4OINF 2XL4A 4JTDB 4PACA 3RFYA 2P7VA 4MVUA 1M56C 3BRJA 3U8PA 4EBBA 2XXAA 4WGZA 1LI5A 2W45A 1U6HA 3ASNC 2NUPA 5DQTA 1YAUO 1VLTA 2ASRA 4GQHA 4BPMA 1VYKA 3EG9B 3HNIA 1OKKD 1GM5A 5L0FA 3CZ6A 3C62A
chains in the Genus database with same CATH topology
1B68A 1H7IA 1NFNA 1OR3A 1YA9A 1GS9A 1NFOA 3S84A 1AEPA 1EQ1A 2KC3A 1LS4A 1OR2A 3R2PA 1LPEA 1LE4A 1EA8A 1LE2A 1BZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B68 A;  1H7I A;  1NFN A;  1OR3 A;  1YA9 A;  1GS9 A;  1NFO A;  3S84 A;  1AEP A;  1EQ1 A;  2KC3 A;  1LS4 A;  1OR2 A;  3R2P A;  1LPE A;  1LE4 A;  1EA8 A;  1LE2 A;  1BZ4 A; 
#chains in the Genus database with same CATH topology
 2HV7 A;  3GWL A;  3RKO F;  4EHP A;  2LP4 A;  4MVZ A;  1LI7 A;  1LIH A;  2DYR C;  2G62 A;  3EQL F;  2DGJ A;  2J46 A;  2PP4 A;  3ABK C;  3GEH A;  4K7B A;  4RDA A;  2Q00 A;  2X0C A;  3V5Y A;  1ZHX A;  2QE9 A;  1NFO A;  2CNW D;  2YLG A;  1MMA A;  3LEV A;  2L6H A;  2Y3B A;  2EIJ C;  4LLE A;  4Z9I A;  4CDV A;  3PHF 2;  4M63 A;  1RJ9 B;  2YRF A;  2HJ3 A;  4R32 A;  4AX2 A;  1PV3 A;  4HFF B;  4WAB A;  1WN0 A;  1RCP A;  1JPJ A;  2MWQ A;  4W8K A;  3TUL A;  5T3T A;  2GAQ A;  2IXM A;  5COF A;  2BC5 A;  2PX3 A;  1BZ4 A;  1CGN A;  2YL1 A;  2C03 A;  3W8H A;  3EGX B;  3FOP A;  2D4U A;  5D92 A;  3RQG A;  4YWQ A;  3FOO A;  4Q5S F;  1Z6A A;  3HNJ A;  3RF3 A;  4CSA C;  3W8I A;  2YWA A;  1T6Q A;  1MMG A;  4I1O B;  4W8P A;  4MW3 A;  1TFK B;  3QW1 A;  3ECS A;  4O6Y A;  2HS5 A;  3KMI A;  3U3B A;  1SF8 A;  1ZU4 A;  1VTM P;  4OIP F;  2Y69 C;  4BJ1 A;  4EWC A;  1IZM A;  3RVZ A;  2XM4 A;  3BEH A;  2A0U A;  1YLM A;  4Q7C A;  3RVY A;  3QVZ A;  1XZQ A;  2EPM X;  4MQ9 F;  2I8B A;  3RW0 A;  2H8A A;  4BJ6 C;  5L0D A;  4MTF A;  1LE4 A;  2NUP B;  4DJ9 A;  1LE2 A;  3CEX A;  3F46 A;  1JPN A;  3SNH A;  5JUA A;  4D4X A;  2CW0 F;  2KYH A;  2Y3H A;  1HW2 A;  1TR2 A;  1E86 A;  3U3F A;  2EIN C;  1A7V A;  2FFH A;  2EPL X;  4XEK A;  1ZYR F;  4NQF A;  1QLE C;  1XWJ A;  2A69 F;  2W4M A;  3K33 A;  3LS0 A;  1NLX A;  2AWC A;  4F4B A;  2XSE A;  2ETS A;  2D5R B;  3MFN A;  4NTB A;  4DRI B;  3TJ5 A;  5BQI A;  2R7V A;  4AE4 B;  4JJF A;  4MTO A;  3B0V C;  4CJO A;  1C03 A;  1OCO C;  1Y6D A;  4JVS A;  1R5I D;  2EIL C;  2P6V A;  4P6I C;  1I4Z A;  1CPR A;  1M6T A;  1Q0M A;  2J0W A;  3EFO A;  1L3P A;  4NTF A;  4QDL A;  1NBB A;  4HEA J;  2P1A A;  4I3M A;  1Z3I X;  4KNV A;  2EPN A;  1Q0G A;  1NSG B;  1ORS C;  5CI8 A;  2Q9B A;  5E2Q A;  4PK4 A;  1F1M A;  1D0X A;  1V74 B;  5KYY B;  1U0B B;  3LLI A;  3SXK A;  4H4K C;  4OIQ F;  2PFD A;  3ZWI A;  5HSW A;  1V4A A;  2WVO A;  4PFP A;  3I4U A;  4YN0 B;  2LFF A;  2OEV A;  2ZPA A;  4JKV A;  3HNK A;  1E84 A;  1RJ9 A;  2Q4F A;  4CS7 A;  4G7O F;  2J9V A;  3U2L A;  2IXO A;  5DS4 A;  1S05 A;  2J7P A;  2QY9 A;  5L0C A;  4E18 A;  2XS8 A;  1OR2 A;  4EKW A;  1W2W A;  4DRJ B;  3K7D A;  1WOL A;  4JTC B;  4EIY A;  2R7O A;  2XLD A;  1MQV A;  4J32 B;  4BJ5 A;  1FMV A;  1QKR A;  3JRM O;  2A6E F;  3OWT A;  3C63 A;  2WVQ A;  1RKE B;  4NY3 A;  2LIG A;  3PCV A;  5E33 A;  4D4N A;  4G7Z F;  2QTV A;  5AGF A;  1YVI A;  2JD3 A;  2L81 A;  1A0B A;  3AG3 C;  1EKY A;  4LLC A;  3FXH A;  4JEA A;  2LSE A;  4Z9J A;  2CCY A;  3TK0 A;  3WOD F;  1TWG A;  256B A;  2R03 A;  3AQC A;  3S28 A;  2VB6 A;  4G78 A;  3NYJ A;  4PFO A;  4OD5 A;  4NTA A;  3ITF A;  3L8I A;  5F5H A;  2NSG A;  4YL1 A;  4U5C E;  5T3W A;  1SYQ A;  4WGY A;  2LK4 A;  1SR2 A;  3C8Z A;  4L6R A;  2OKU A;  1YA7 O;  1OCZ C;  1DOV A;  4U5F E;  3K1H A;  1K40 A;  5B1B C;  2MHR A;  2IBF A;  2IXP A;  3ATP A;  4ONS A;  2ZXR A;  4BJT A;  1K04 A;  3V7O A;  5B3S C;  5FCL A;  1LS1 A;  3LLK A;  1PD1 A;  1CGO A;  3ABL C;  4YK5 A;  3CQZ A;  3SYN A;  4DBR A;  2W9Y A;  4BG0 A;  2Q7R A;  2AU5 A;  3HKK A;  3S9O A;  3ZTZ A;  5JVE A;  3C18 A;  1YYX A;  2L9J A;  1FFT C;  5AC4 A;  3ZG1 A;  2J9U A;  4PR9 A;  5B1A C;  1YA9 A;  3DKA A;  4CS9 A;  1LKX A;  3B0P A;  3N24 A;  4MTG A;  3M4B A;  3AGT A;  4PJL A;  3ZC4 A;  1OW7 A;  3T9O A;  2DYS C;  5CIV A;  5KYW B;  1U89 A;  1VB5 A;  1EQ1 A;  2YL3 A;  3KPH A;  2YLI A;  3KYJ A;  4A2N B;  4E0I A;  1Z63 A;  3ZSU A;  2H7V C;  3GM1 A;  4K1O A;  3GEI A;  4CS8 C;  4BJ5 C;  3LAY A;  2WVN A;  2R9R B;  2QNL A;  1LM3 B;  1XZP A;  3FDQ A;  5L3V A;  2AVK A;  4KNW A;  4CJG A;  2R05 A;  3HJC A;  2Z15 A;  5JP7 A;  1WWP A;  5BQG A;  1CPQ A;  3M15 A;  1OXB A;  3G4X A;  4E0H A;  4YT8 A;  2C04 A;  5KYX A;  1MMN A;  2IYL D;  2J7P D;  2UUI A;  4U5E E;  4DOZ A;  3C8G A;  4J7T A;  4DXW A;  3IPM O;  3Q7L A;  2HUJ A;  3Q6M A;  4XTK A;  3DXJ F;  5COM A;  4E7S A;  4RBN A;  1HMO A;  3MYI A;  4JRZ A;  4ZLD A;  4ANJ A;  3SXY A;  3EGD B;  1TWA A;  4OD4 A;  1HY5 A;  1H9T A;  2HSB A;  2J9B A;  3C7J A;  4OIR F;  4GEH A;  3TQO A;  2OQM A;  4A4A A;  2R7S A;  3K1I C;  1QVX A;  3DM5 A;  1PCX A;  4IAR A;  5KYY A;  4C3B A;  4JW1 A;  2PX0 A;  3JCU Q;  4EBJ A;  3JSZ A;  1ZHY A;  2OCC C;  3R2P A;  4HFK B;  4JEB A;  1BR4 A;  3JZ0 A;  2QUP A;  1QQ3 A;  2ZXW C;  2EPK X;  3EFO B;  3NMK A;  3T6G B;  2GFH A;  4ULV A;  4E17 A;  1S7Z A;  2A1D D;  2LCH A;  4IB4 A;  4O79 A;  2VC9 A;  5IY5 C;  4JIO A;  3NMJ A;  4XPY A;  3TOL A;  1E85 A;  2Q9C A;  4BEM J;  2GDC A;  1FNT c;  1T01 A;  4MVR A;  4IGG A;  3X2Q C;  2XS1 A;  1OW6 A;  1WGW A;  2P61 A;  3NG1 A;  1SZI A;  5A6J A;  3I5Q A;  4DBQ A;  1AEP A;  2KGO A;  4LDR A;  2YKZ A;  5KYU A;  4CX9 A;  1ORJ A;  3TJ6 A;  1ZU5 A;  2EIM C;  3UGO A;  1NU7 D;  1T6I A;  1Q0D A;  1SMY F;  3EG9 A;  3NMI A;  4JZA A;  4B6I A;  1O87 A;  2GA0 A;  3TOM A;  1GGQ A;  1G4U S;  1HW1 A;  3G4Z A;  3A11 A;  1YJG A;  3ZTM A;  3US6 A;  4N6C A;  2KC3 A;  2YLD A;  3ABM C;  3NYM A;  2XXA B;  4JJG A;  4JCH A;  5T1D B;  2CNW A;  1JAF A;  4IAQ A;  3IQT A;  3V5Z A;  2HV6 A;  1ZVZ A;  2L7A A;  4U9E A;  4XPW A;  1M2V B;  4XEV A;  4BEJ A;  2A0B A;  1FR0 A;  1A7D A;  4IWB A;  2WL8 A;  3FAP B;  4H54 A;  1OQC A;  3GOR A;  2Y3G A;  1QSP A;  2VAS A;  5JS5 A;  3T6B A;  1TQG A;  3L8J A;  3QW0 A;  4XWJ A;  4FAP B;  2OG2 A;  4NCQ A;  3QMK A;  2R7U A;  1QPU A;  3E9V A;  1JOG A;  3DI5 A;  2J9W A;  2X51 A;  3H2U A;  3JSE O;  2DB4 A;  1WAS A;  3LNM B;  4AL1 A;  4CS8 A;  2RD9 A;  3EZI A;  2HMQ A;  2XLV A;  3IEE A;  2ZD9 A;  3S27 A;  1GQA A;  3DE8 A;  3L34 A;  4IAO A;  1MND A;  4MVM A;  4AK9 A;  4CBE A;  4CIP A;  2HSQ A;  3MYF A;  1TFO B;  1Q0K A;  3KH2 A;  1Z5Z A;  1J8M F;  3AG1 C;  3VF0 A;  1YZA A;  2A68 F;  2G3K A;  5JLI A;  2Y3D A;  4HE8 D;  3AG2 C;  5BUO A;  2IM8 A;  4YT5 A;  4MVO A;  4DRH B;  3O39 A;  4P9F A;  1D0Y A;  1EA8 A;  2FGY A;  2KSF A;  2IXN A;  3L1M A;  2NUT A;  4JTA B;  4N6H A;  4MVQ A;  3W2W A;  3UGP A;  2TMV P;  4N06 A;  2Q3T A;  3IQ5 A;  3RH3 A;  2HZ8 A;  5JT4 A;  4DVZ A;  3GM3 A;  4FWV A;  3O55 A;  3B29 A;  3FVY A;  2JPU A;  2I15 A;  3V5X A;  5A6B A;  2J8W A;  3LUT B;  3J06 A;  2VCB A;  5TJ5 E;  2H7O A;  1K05 A;  2EIK C;  1CGM E;  1VOM A;  3N2Z B;  1TWC A;  2FAP B;  1B68 A;  4YJW A;  3POV A;  5JSL A;  2CGE A;  1ZZP A;  4K0D A;  3Q7G A;  1M2V A;  2KK1 A;  2XLH A;  2MYS A;  1YAR O;  2ZXP A;  3H65 A;  3S0X A;  4UDV A;  3TD7 A;  3PDM P;  4G0H A;  3JT1 A;  2CYD A;  2HKV A;  1H7I A;  2J45 A;  2KNH A;  1D0Z A;  1APC A;  1LVK A;  1V54 C;  3GM2 A;  3SP1 A;  4U5G A;  1OCR C;  3LEO A;  3G50 A;  3W4Y A;  1E83 A;  2XL8 A;  3B9Q A;  1A41 A;  2NPU A;  4LDK A;  4G7H F;  2CDQ A;  4KC9 A;  3X1O A;  4PJJ A;  1YZC A;  2YZS A;  4EUK B;  5DS5 A;  3IQC A;  1RKE A;  1HMD A;  1HE9 A;  2WB7 A;  2IOQ A;  3LES A;  5AC5 A;  2OJE D;  3T4R A;  4C3D A;  1YYJ A;  4XLP F;  4CDY A;  4X0R A;  1Z23 A;  3NKD A;  4QI2 A;  1G4W R;  3JYH A;  2OJQ A;  3DD7 A;  5A6B D;  5JRA A;  3VAY A;  5F5F A;  1AUE A;  4MVS A;  3UMH A;  3ZQV A;  2JX0 A;  2R7R A;  1D1B A;  1ST6 A;  2LQG A;  1VMA A;  1VYI A;  3E70 C;  1RKC A;  3JRT A;  4YL0 A;  4J30 B;  4XLN F;  3OA1 A;  1ZW3 A;  3S84 A;  2R7T A;  1KNY A;  3RQE A;  3DZA A;  3U9M A;  1OW8 A;  2KJG A;  3U5S A;  1E2X A;  1ZW2 A;  2G3V A;  2R25 A;  1OCC C;  3HNL A;  3CSK A;  3ZQY A;  3GAN A;  2HFI A;  2XM0 A;  3O6X A;  1OXK A;  2LFD A;  2XLE A;  4U5D E;  5EGY A;  4JC7 A;  3NYL A;  2YEV A;  1FTS A;  1D1C A;  4U5H A;  4FES A;  5K0I A;  3UMK A;  2GWW A;  2YHS A;  4JE9 A;  5L0H A;  2B0J A;  1NZE A;  3AG4 C;  3DAF A;  3ZDL A;  3T6J A;  2UUH A;  4C7O A;  3DM9 B;  3QTH A;  4O7G A;  3GEE A;  4AE4 A;  1BR1 A;  1D1A A;  3VRC A;  1MNE A;  4I44 A;  1HE1 A;  1FFH A;  1YDI A;  4WJ0 A;  1G5Z A;  3S29 A;  1MMD A;  2A6H F;  2YQY A;  3ASO C;  1FMW A;  2R7W A;  3LNR A;  4YL3 A;  1Y4C A;  4CS9 C;  2R02 A;  3MX3 A;  1I4Y A;  3OEO A;  2F22 A;  3L0I A;  4RD9 A;  3DMD A;  5KYX B;  3S90 A;  1UFB A;  3IQ6 A;  4IRU A;  4LDQ A;  4MND A;  4P9T A;  5E3A A;  4BJ6 A;  1QZX A;  2R7Q A;  4FX5 A;  4J7Y A;  4XPX A;  1L7C A;  3AQB A;  1DOW A;  3H2V A;  1T6U A;  2M4E A;  3SEO A;  4C7O B;  5GPG B;  4OIO F;  3LS1 A;  1VK5 A;  3MBG A;  2RSE B;  3WAQ A;  3RQF A;  2O9X A;  4ER9 A;  2XLM A;  3A9C A;  2V26 A;  3FAJ A;  4MS2 A;  3W2V A;  1H6G A;  5KYU B;  1O3U A;  3WG7 C;  3K6B A;  2EPO A;  3I5P A;  1NG1 A;  2AP3 A;  1R4T A;  2YVK A;  3EGX A;  3M79 A;  3WHN A;  5A6K A;  2XL6 A;  3EGD A;  2J0X A;  2Q9A A;  3QVY A;  3B71 A;  5DQZ A;  1NFN A;  2ICW G;  3LJB A;  4E7Z A;  1Z7Q c;  2E87 A;  3GOD A;  3PMR A;  1T9K A;  5L3Q A;  1PD0 A;  2PBE A;  2NSF A;  2NG1 A;  2YL7 A;  3DJU B;  1ZHW A;  3FMS A;  3KYI A;  4U9D A;  2XRH A;  3B0U X;  3AJM A;  4NC3 A;  3SXM A;  5HV9 A;  5L0I A;  3Q6N A;  3R7C A;  1LS4 A;  3U2M A;  3UMI A;  2XLO A;  3EH2 A;  4JUR I;  3ZVR A;  4KI2 A;  3AOU A;  2YL0 A;  4U5B E;  1TWH A;  4LAC B;  1JMW A;  4QI0 A;  5B3I A;  5FZT A;  4O6N A;  1M2O A;  2BE5 F;  5COG A;  3F47 A;  1TKN A;  4GYT A;  5A69 A;  1LPE A;  2M64 A;  4CDA A;  4N4W A;  1JR8 A;  1OKK A;  1N1C A;  1BBH A;  3KL4 A;  2B0H A;  2V3C C;  2HJM A;  3EH1 A;  3HLZ A;  4MW8 A;  5F28 E;  2P0N A;  5L0G A;  4JCZ A;  1ZHT A;  3EZH A;  2R7X A;  1OR3 A;  3SXZ A;  2QLA A;  3DWW A;  2PNO A;  4YT2 A;  1I5N A;  3M4C A;  2ZXO A;  1A7E A;  1RXQ A;  3SZR A;  2OU6 A;  3NKE A;  4Z9H A;  3VYW A;  3DE9 A;  5BQH A;  3EPV A;  4IJJ A;  3U8V A;  3UR3 C;  3NDB B;  1BR2 A;  2L6G A;  3ZIB A;  4XQ1 A;  3U9J A;  3EHM A;  1M57 C;  3K66 A;  1C17 M;  1ORY A;  1KU2 A;  2PF4 E;  2VCA A;  5E3C A;  5EK0 A;  2BL2 A;  1KTM A;  1FAP B;  1GS9 A;  5EHH A;  1UG7 A;  3FHD A;  3HTK C;  3JTL O;  1J8Y F;  2L6F A;  4AL0 A;  5DS6 A;  3C8G D;  3M1C B;  1O5H A;  5L0J A;  3DAG A;  2WZG A;  1Q0F A;  1V55 C;  4CIH A;  3GWN A;  2LD6 A;  3DJN B;  4PJM A;  2AWY A;  4EBK A;  2WZF A;  1WTY A;  5DLJ A;  1T5O A;  4I1M A;  1AVO B;  3JYY A;  2KW3 C;  4DVY P;  1EI7 A;  4Q4Z F;  4ULW A;  3CAX A;  1IW7 F;  3AGU A;  4LER A;  2HMZ A;  2KQ9 A;  5A6A A;  2H7B A;  3RIP A;  3RYL A;  3UNG C;  1G8X A;  2VH3 A;  1JRA A;  3C8G B;  3N0T A;  3U0C A;  2OEX A;  1WAT A;  3EJN A;  4O6M A;  2W4B A;  5DVW A;  4ZLC A;  2XLW A;  1VLS A;  1BDJ B;  4PJN A;  1H9G A;  5CI9 A;  4C3E A;  3KKB A;  3VM6 A;  4KBL A;  4YT4 A;  3IHU A;  3EHN A;  2DI3 A;  5KYN A;  3K1I A;  2VCC A;  1C02 A;  3QZC A;  4CSA A;  3NRH A;  1ZHZ A;  3MLG A;  5D91 A;  1NU9 C;  3O10 A;  1RMV A;  5KYW A;  2OOC A;  2WZL A;  2Y39 A;  2NUT B;  4XEF A;  4OIN F;  2XL4 A;  4JTD B;  4PAC A;  3RFY A;  2P7V A;  4MVU A;  1M56 C;  3BRJ A;  3U8P A;  4EBB A;  2XXA A;  4WGZ A;  1LI5 A;  2W45 A;  1U6H A;  3ASN C;  2NUP A;  5DQT A;  1YAU O;  1VLT A;  2ASR A;  4GQH A;  4BPM A;  1VYK A;  3EG9 B;  3HNI A;  1OKK D;  1GM5 A;  5L0F A;  3CZ6 A;  3C62 A; 
#chains in the Genus database with same CATH homology
 1B68 A;  1H7I A;  1NFN A;  1OR3 A;  1YA9 A;  1GS9 A;  1NFO A;  3S84 A;  1AEP A;  1EQ1 A;  2KC3 A;  1LS4 A;  1OR2 A;  3R2P A;  1LPE A;  1LE4 A;  1EA8 A;  1LE2 A;  1BZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...