2KC6A

Nmr solution structure of the pheromone en-1 of euplotes nobilii at -1.5 c
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
NPEDWFTPDTCAYGDSNTAWTTCTTPGQTCYTCCSSCFDVVGEQACQMSAQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mating pheromone En-1
publication title Molecular cold-adaptation: Comparative analysis of two homologous families of psychrophilic and mesophilic signal proteins of the protozoan ciliate, Euplotes.
pubmed doi rcsb
molecule tags Signaling protein
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2008-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.40 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 2kc6A01
2NSWA 2NSVA 2JMSA 2KC6A 2KK2A
chains in the Genus database with same CATH superfamily
2NSWA 2ERLA 1DDEA 4E2KA 3B39A 2B39A 4EE1A 3CU7A 4EDKA 4EDGA 1EQNA 2NSVA 1DD9A 2LMKA 4EDVA 2KC6A 2AU3A 2KK2A 1ERCA 4EDRA 3KXRA 2JMSA 3KLSA 4EDTA
chains in the Genus database with same CATH topology
2NSWA 2ERLA 1DDEA 4E2KA 3B39A 2B39A 4EE1A 3CU7A 4EDKA 4EDGA 1EQNA 2NSVA 1DD9A 2LMKA 4EDVA 2KC6A 2AU3A 2KK2A 1ERCA 4EDRA 3KXRA 2JMSA 3KLSA 4EDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSW A;  2NSV A;  2JMS A;  2KC6 A;  2KK2 A; 
#chains in the Genus database with same CATH topology
 2NSW A;  2ERL A;  1DDE A;  4E2K A;  3B39 A;  2B39 A;  4EE1 A;  3CU7 A;  4EDK A;  4EDG A;  1EQN A;  2NSV A;  1DD9 A;  2LMK A;  4EDV A;  2KC6 A;  2AU3 A;  2KK2 A;  1ERC A;  4EDR A;  3KXR A;  2JMS A;  3KLS A;  4EDT A; 
#chains in the Genus database with same CATH homology
 2NSW A;  2ERL A;  1DDE A;  4E2K A;  3B39 A;  2B39 A;  4EE1 A;  3CU7 A;  4EDK A;  4EDG A;  1EQN A;  2NSV A;  1DD9 A;  2LMK A;  4EDV A;  2KC6 A;  2AU3 A;  2KK2 A;  1ERC A;  4EDR A;  3KXR A;  2JMS A;  3KLS A;  4EDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...