2KCAA

Gp16
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
109
structure length
109
Chain Sequence
MYEEFRDVITFQSYVEQSNGEGGKTYKWVDEFTAAAHVQPISQEEYYKAQQLQTPIGYNIYTPYDDRIDKKMRVIYRGKIVTFIGDPVDLSGLQEITRIKGKEDGAYVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of bacteriophage SPP1 head-to-tail connection reveals mechanism for viral DNA gating.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
molecule keywords Bacteriophage SPP1 complete nucleotide sequence
total genus 14
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05521 Phage_H_T_join Phage head-tail joining protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.270 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2kcaA00
2KZ4A 2KCAA
chains in the Genus database with same CATH superfamily
2BD7A 4A1XA 1CBWB 1UVSH 1GJCB 4AFQA 1OWHA 4BAOB 4NFEA 3TGIE 2BXTH 2VGCC 3RMLH 1QJ6B 1GDQA 1Z6EA 4CRGA 1NPMA 3RM0H 1KYNA 1QBNA 2THFB 5F8ZA 4DG4A 1GBAA 3MMGA 2AYWA 1IQMA 3LKWA 1AB9B 2XWAA 1SQAA 1LKAA 2PGBB 4WH8A 1GJ9B 1O3CA 2GCHF 2W3IA 1DWEH 3S7HB 1OS8A 1TGBA 1UTKA 3LU9B 3V0XA 3A84A 2ZGCA 1D4PB 1C1UH 2OC8A 1XMNB 5GPIB 1BIOA 2UUJB 1ETTH 1FZZA 1Y3XA 4YOJA 1P05A 1O3PB 1AY6H 1T8LA 3NPSA 1Z8IB 5DKMA 1KTTB 1HAVB 2FMJA 2ZEBA 3GY3A 1UMAH 1AHTH 1O2RA 4AFZA 3LONA 5EXNA 3MOCA 4IN1A 1O30A 2VWLA 4WH6A 3ZIAD 3SW2B 3A80A 3MU5A 5FPSA 1DLKB 2VIQA 2Y5FA 3QGNB 2VU8E 4ZKRU 2HALA 3RLYH 1CHOF 2WYGA 1QQ4A 2BDAA 1C5LH 3KQEA 1TX8A 2SFAA 3GCTF 2BM2A 2HVXA 2A2XH 1AZ8A 1XUJA 1BMNH 3BSQA 2TGAA 3E90B 1COWD 5JYIA 4IW4E 3RMOH 2PFEA 2B0FA 1P0SH 2WPMS 1DT2A 4OS7A 1K21H 3E0PB 1YCPK 3UR6A 3FOAA 2F83A 4IN2A 4A7IB 8KME2 2PSXA 5EPYA 2W6JD 4FXGH 3TK6A 3OX7U 2OBOA 3RLWH 3AW1A 2ZP0H 4DT4A 3GDUA 1T8OA 4DIHH 1FUJA 1ZLRA 5HIZA 2BD3A 4WMEA 4IS5A 1BMFD 1EFRD 1SC8U 2GD4B 1TGSZ 1KLIH 2RA0A 1AVGH 2VINA 3A86A 1P04A 2A1DB 2PTNA 3U8TH 2Y7XA 1LHGH 4Y8ZA 2OLGA 2OTVA 1AU8A 3RXRA 1DLEA 3PV2A 2EC9H 2F9OA 2B5TB 1N6XA 1Y5AT 2UUFB 1Q3XA 2A4GA 2WINI 4SGAE 5C2ZA 1PPZA 1MQ5A 2CV3A 2O8TA 2R3UA 3OEHD 3MH5A 4Y10E 6CHAB 3U1JB 1GJ4H 4Y0ZE 1F0SA 2P8OB 1ZMJA 4LK4A 3P8FA 1BTYA 1TNLA 4ZKSU 3ATMA 3B9FH 2AMDA 3M37A 3A7XA 5A0BA 4CRFA 4GHTA 2AFQB 1F0RA 4ABHA 2QA9E 1C5ZB 1VCWA 1SGPE 2BY6X 4OS1A 4NZQA 2FOCA 3ZZ7A 4NGAH 2A7CA 1MUEB 4MPUA 5E8EH 3HGNA 2BZAA 5IYTA 4CR5A 2DE8A 1O3AA 3EE7A 2ODQA 4Q63A 1GVKB 1HAOH 3ATIA 5DPAA 1QFKH 3SV8A 3RU4D 5JB8S 2C4FH 1PPFE 1HFDA 3ELAH 1W12U 3RXJA 3UNRA 3FP7E 1WCZA 2VH6A 5DSFA 2J2UA 2BX4A 3AK5A 1L1JA 1P9UA 2KM0A 1TMBH 1SGFA 1TABE 1XUKA 2IPHA 3F6UH 5CDFE 1D3TB 2ANKH 1QR3E 1F5RA 2YOLA 4HTCH 4MTBA 3DD2H 3SI3H 2XRCA 3FZZA 5TCAA 3SU3A 2Z6BD 2NU2E 2OCVB 3UR9A 3V12A 1LCYA 1ESAA 4AOQA 3E0NB 4FUGA 2BD9A 4Y7AA 1TPAE 1IHTH 2A4QA 4BAHB 5B6LA 1EOJA 3DA9B 5FX5A 2ANMH 4DIIH 2PP6A 1VJAU 3IWMA 3GDSA 3OAAD 1ESTA 2KX4A 2FOMB 1YY3A 2ZHFH 4MNVA 1QRWA 2BX3A 2QXJA 1FJSA 1LPKB 3BTDE 3I29A 1HAPH 1LDTT 2EQNA 4MPWA 1LMWB 1Z8RA 4Z1MD 1GHBF 1T8NA 1TBRH 2PUQH 1UCYH 1ANDA 2FOHA 4JMYA 1P09A 3LH3A 3TH4H 1HPGA 3GCTG 3KQDA 3TNSA 1CU1A 1F7ZA 3F2HA 4GUXA 1HV7A 1SB1H 1K1MA 1WAYB 4HG6A 4X1RU 3CS7A 1JIMA 1MTUA 1MD7A 1AUTC 2ZDKA 1CHGA 1YPHC 1LHEH 1QGFA 4NA7A 4BTIB 2KR7A 1E36B 1HB0B 4OGXA 3RU4T 2ZDLA 1BZXE 1UHBA 1YLDA 5E2PA 1NN6A 3GY2A 3PMHB 4A1VA 3SN8A 2BY9X 3P6ZB 3TNTA 1PFXC 1PPBH 1SI5H 3LJJA 2XNIA 2A45B 2BDIA 2TGDA 5EJ1A 2I6QA 5LGOA 3DFLA 1QCPA 1DWBH 1O5AB 2A31A 5DP8A 1S84A 5ETXA 2LP6A 4X6MA 9ESTA 3M7QA 3O8RA 4AX9H 1FXYA 2PLXA 1AO5A 1TNJA 2GTBA 3SZEA 5FBEA 4X2YA 2ZCKP 1K1JA 1Y5UT 5T6DA 2ZWLH 2OINA 5HIYA 1XUIA 1DDJA 4JK5A 1HIAB 4FOUC 1V2WT 1SLXB 1UO6A 1O5BB 4ZMAH 2EI6A 2OQ5A 1GG6B 1DXWA 1DWDH 2RA3A 4BAQB 1G9IE 3DSGA 4RT0A 1TRMA 1C5XB 3M3VA 4I32A 2L74A 1W10U 4XBCA 4XOJA 3MNXA 4OS2A 1HAXB 1ORFA 2W3KA 1O2QA 4WY3A 1B0FA 3OEED 1BA8B 3BTEE 2G52A 3KYFA 2F9UA 2WPKS 4TSFD 4UDWH 2FYQA 1WYKA 3TJNA 4DOQA 2BMGB 1SGEE 4IMQA 2BD8A 1C2GA 3K6YA 3QUMP 1BMMH 5TCCA 1ID5H 1ZSKA 2FTMA 1MKXK 1EX3A 1H8ED 1VCQA 1MKWK 3RC6A 1OPHB 1BT7A 4JZ1A 2HWLB 3T5FH 3W95A 1LPZB 2DE9A 3ESTA 2GJGA 4ZXYH 2SNWA 1VR1H 3MFJA 1MZDA 3M5MA 1C2DA 3ZZ5A 2H1UA 4AC9A 1ARCA 2Q6GA 3ZVAA 3ZVGA 1V2NT 3SJ9A 3UTUH 1QTFA 2PR3A 3ZZAA 3BTME 2SNVA 2STAE 4FVBA 5C3NA 4D76A 4YLQH 5HYOA 1EQ9A 4I8KA 1H9IE 1XX9A 7LPRA 1WQVH 3FFGA 3F0OA 1C4V2 1C5MD 1GMHG 2QF3A 2BQ7B 4AB8A 3PTNA 3SGQE 1OXGA 1DOJA 4AFUA 3W94A 1BTHH 1P2KA 2GZ9A 1Z6JH 3U8RH 3MU4A 1QL9A 4BTTB 3SORA 5C1YA 3R0FA 1GG6C 2ULLA 2PKAA 4K5ZA 1TA2A 2GT7A 5HMAA 1SQOA 2EI7A 3K6ZA 3KQCA 3SNCA 5HXFA 4B73A 2Z94A 1Z8JB 1FV9A 1YBWA 2QN5T 4LXBH 3ZVEA 1GBEA 2J97A 3N7DA 3MO6A 3H7TA 4UFGH 1SOZA 1KXAA 3DHKH 3UREA 1KXBA 1EXFA 5GIBA 3NCLA 5T1VA 1QNJA 2FX6A 1S81A 1CGIE 3OTPA 2C8WB 1WQSA 1S6HA 2J92A 1V2UT 4ISOA 3VG8A 3RUOA 3RDZA 1J15A 1SGFG 4I8JA 1WOFA 2ZPRA 3MHWU 5E0GA 1A3EH 3NKKA 1EATA 1PPCE 3A82A 4E7RG 7GCHG 1DVAH 2PKAB 3MNSA 5GNDA 2XBVA 3RXFA 1E0FD 1XXDA 2P59A 4X8VH 1O5CB 1V2QT 2GKVE 1W7GH 1F2SE 1MABB 1LVBA 2ZGBH 2GT8A 5HKKD 4O97A 4DJZB 1HGTH 4YOIA 4BTUB 1K2I1 1A5HA 3BG8A 1P3EA 1PPGE 1UTOA 4F55A 1NRSH 4PROA 1BMAA 1FAXA 2PUXB 1C1PA 3TJOA 1QURH 2JH0D 1ZMNA 3ZVCA 1SKYE 4CH2B 1QIXB 2WPIS 2GDEH 1SG8B 3M5OA 3V13A 4O9VA 4RT1A 3PMAB 1MKWH 1MQ6A 2V6NA 1W0ZU 4AFSA 9LPRA 4YLUA 3MWIU 1O2MA 2ALVA 1Q31A 4ASHA 1AMHA 1OX1A 2O8UA 1ELDE 2Y82A 2FOGA 2ZQ1A 1NTPA 4AGKA 4I86A 3SUFA 1TRYA 1E79D 1HAVA 2AIPA 2ZDVH 1PQAA 3FP6E 5C17A 3BTGE 1QRXA 1QBOA 3RXMA 2Q6DA 4NIWA 2SGEE 1K1IA 4IMZA 3NXPA 1C5WB 1BJVA 1OSSA 2KCYA 3PYHA 1LHCH 2GCTC 1HIAA 3SGBE 1NFYA 1XKAC 1GBCA 1SQRA 5EJZA 2A2QH 8GCHG 3HKJB 5EG4A 2FLBH 1GDNA 2GX4A 1T32A 2BD5A 2PKSB 3RM2H 3JZ2B 5C0UA 2XBYA 4F4OC 1Y3VA 4TPIZ 1H8HD 1GI0A 2ZHEH 2XW9A 3QX5H 1F0UA 3KQ5A 4MNWA 1EZSC 5FPYA 3UFAA 1V3XA 3MNBA 3SU0A 3ZZ4A 5I46H 3PO1B 5EJLA 3PROA 1O0DH 3MNCA 3N7EA 3UB0A 5JBCS 1FDPA 2QCYA 4R0IA 5GCHF 4CREA 3SJOA 2HRVA 5AFYH 3PRDA 1AN1E 4B6FA 1BBRH 2VGCB 3WWBA 2O8WA 1G37A 1UTMA 4MLFB 1O3NA 2A4OA 2VNTA 3BG4B 1FIWA 3BTHE 1C2IA 1GI8B 4VGCB 1ZSJA 2Q6FA 3TGKE 3F0PA 4BXWA 1V2TT 1TA6A 1PJPA 2M2AA 1TQ7B 1Z71A 4YT6H 2FPZA 2ZTYA 2FOAA 1HRTH 2WUCA 2FLRH 4LOYH 4WVPE 3DCLA 4DT7B 3RXCA 2CMYA 3CP7A 2O8LA 5CHBA 3SV7A 2QC2A 1P2NA 3PV5A 2QF0A 3GOVB 2ESTE 2Y6TA 2RG3A 4NFFA 1O3MA 1AWFH 4KGAA 3URDA 1EP6A 4TYDA 5FPTA 2BLQA 3TK9A 2BOKA 3LGWA 3QK1A 3S9AA 1LHDH 3QTOH 3RXQA 4FUHA 2HVYB 3FZDA 1TGCA 1XUHA 3Q3YA 4OM9A 2JETB 4Y71A 2ZTXA 1O39A 2Q1JA 3QDZB 3DSOA 1EAIA 1QB1A 4X0WU 3F2GA 1PQ5A 2NWNA 2V7QD 3EDXB 3RXOA 1NFXA 1GBIA 1BTXA 1EPTA 3F9HA 3BTTE 2IN2A 1RRKA 5L30H 1BTWA 4KTSA 2JH6D 3ATKA 1MTNC 1AWHB 2H2ZA 1QHRB 2OUAA 3TGJE 1G3CA 1ZRKA 1UCYE 1C5PA 2H5CA 3RXSA 2VBCA 1MAXA 1SGNE 4K60A 5ESTE 1O2OA 1A46H 1C5QA 3BTWE 3PO1C 1VCPA 2A7JA 1YPHE 1J8AA 1LVMA 1W0JD 1J16A 3RXHA 6LPRA 1EJNA 1D3QB 2QF4A 2ZPQA 2FWWA 2ODYB 1UJ1A 4X6PA 1QQUA 1MKXH 2BLWA 3QO6A 3A8AA 4Y6DA 5FHTA 1C5OH 4INKA 2CGAA 1YLCA 2ZIQH 4DVAU 1UTPA 3IG6B 5GJ4B 4K69A 4NWLA 1RGQA 4AB9A 2QXGA 1BTPA 5GDSH 2J9NA 2OP9A 2ZFRH 1KDQA 1IAUA 1NRQH 1LKBA 1T4VH 1D3PB 3SZNA 1CVWH 1GWAA 3F2FA 3M7TA 1MD8A 1TQ0B 2JJ2D 2D2DA 2I6SA 3MTYA 5H4IB 1O2IA 1GCDA 1O2TA 1DPOA 1LTOA 2HNTC 1TFXA 3KL6A 1DWCH 3T26A 3SU4A 1ZMLA 1T31A 3RXUA 1C1SA 4WXVA 3Q77A 3RXLA 1BBRK 4KTCA 5T6GA 1GI7B 5DJ7A 4AG2A 4FUDA 3ZZ6A 4YXWD 3ZZ9A 5LPRA 1MTVA 3S69A 1CGJE 3VB7A 1GI9B 2R2WU 1LPGB 4WMDA 3E3TA 2TBSA 4INLA 1OOKB 4JYVH 3VXFH 3SNAA 4AGJA 4XRNA 4YOGA 1WTGH 1GJAB 2KFWA 3A8CA 3AAUA 5GCHG 4X2XA 1TWXB 1O35A 2FOBA 3VB6A 1CA0C 2TRMA 5A8ZA 2ZA5A 3W1EA 1NESE 2Z9JA 3A7VA 1MU8B 4Z6AH 4A92A 1OP8A 1H8DH 3KYGA 2ZFPH 3EA9A 3SHCH 1XXFA 2B9LA 4Z0KA 4CBOA 1WBGB 4B75A 5GXPA 3CNRA 1OYQA 2Z3CA 5B6OA 1AFEH 2G4TA 1CGHA 3N7OA 2H9TH 5EQRA 1XUGA 2CN0H 1L4ZA 2IOTA 2G51A 1VITH 2BVRH 1P11E 2F43B 1C9TA 3P8NA 2AGGX 3RXDA 1GJ6A 2A5AA 1JWTA 2FP7B 1ELVA 1EOLA 2XTTB 5A0AE 1EAUA 3M3TA 2ODPA 1ELFA 1GJBB 4D9RA 1H9LB 4M9FA 4E05H 1S5SA 2TGPZ 1S6LA 2A5IA 1RD3B 5K7RA 3F9FA 5F6MA 1NBMD 3GY5A 3WW7A 1O5FH 3KHVA 1S85A 2AEIH 1O2SA 4P02A 1KY9A 2V35A 1HAIH 3VGCC 2K1QA 4XDEA 2NU3E 4JZDH 3GISB 1SGRE 2ZDNA 3RXEA 3SQHE 3GYMA 2ZFTA 2Z9IA 3TH2H 2VVVA 5C67A 2G5NA 3SJ8A 4HGCA 2GV7A 1JMOH 1N1LA 2M5TA 5DP7A 4KP0A 3ZZ3A 1EZXC 1GBKA 1W11U 1ACBE 1GMDG 4UFFH 1YPEH 3M5NA 1C5VA 5LH8A 3TJUA 1A7SA 3MQKC 2NU0E 3BG4C 1V6DA 1O3KA 2FOFA 5PTPA 3OU0A 2BDGA 1NBME 1RXPA 1O2XA 2EI8A 4OS5A 3F9GA 5T6FA 1QA0A 2J94A 3UUZA 1MTSA 1DXPA 4ZROA 4X8UH 1C5YB 5DO4H 1T7CA 3C27B 1IQHA 2BD4A 5C94A 1VZQH 1TLDA 4CBNA 1C2EA 3BEUA 1C1NA 1O3LA 1MTWA 3T28A 5AHGH 5EOKA 1DANH 3MYWA 2ZGXH 1YP9A 2D26C 1ELEE 1EPTB 1SFIA 4H6SB 1NRRH 4K1SA 5G4BA 3EA8A 4KTUA 1H1BA 1T4UH 5A0CA 4NA8A 1UK4A 1V2KT 2FEQH 3A85A 2JDID 1SGDE 1WXRA 3UQOA 1EAXA 1P02A 2ASUB 3U28C 2R0KA 1E38B 1CQQA 1LQEA 4YTAA 3MU1A 1SPJA 2OBQA 3LGUA 2O8MA 1DICA 1TMUH 1TYNA 2BLOA 2QIQA 2HOBA 1NROH 1UVPA 4MDSA 3SYJA 1S0RA 4AG1A 3AW0A 2NU4E 1TMTH 1AZZA 1BQYA 3GICB 3SHAH 4ZKNU 1YF4A 3MU0A 4ISNA 3T62A 1ZRBA 2BQWB 4ZAEA 1K1LA 1UW7A 3PV4A 4UFEH 2QXIA 3PRBA 4WJG2 4AN7A 1E1RD 1N8OB 1W2KH 2J4IA 4THNH 4ZHMU 2WUBA 3MH6A 3D65E 1ZYOA 3U69H 6GCHG 2ZDAH 3NK8A 4MQAA 4D7FA 1BCUH 1C2KA 5HM2A 2BDYA 1HCGA 2ZU3A 1MH0A 2BXUH 3GY6A 1A61H 1TX6A 4ZHLU 1SFQB 5E2OA 3P8OA 3FP8E 4GCHG 1W8BH 3VB3A 1W0YH 1C1QA 1A2CH 1AVXA 1HYLA 1HXFH 3LDXH 3LH1A 2HGTH 3PWCA 2R2MB 3L3TA 3SJIA 2P93A 2FODA 1TPOA 1TGNA 1ZOMA 2ZG0H 3ZYDA 3SU1A 5FL7D 5J4SA 3WY8A 3H5CB 4ABDA 3ZVBA 5A8XA 2FS9A 3SNBA 1HXEH 4U32A 2FESH 4RKJB 4X1NU 3VB4A 5DN6D 4CHAC 2FI3E 3A7YA 3QZRA 1O2HA 2V3MA 2HPPH 1ZPBA 1G3EA 1Q2WA 3GS9A 1RIWB 3I78A 3VXEH 3ATLA 1V2MT 2VWOA 1O34A 2FXRA 5CHAC 2XYAA 3AVZA 5L6NH 2ZU4A 1DM4B 2Z3EA 1SMFE 1SGCA 4UONA 3S9CA 1C1MA 1Z7KA 3OYPA 1EJMA 3F1SB 1OWDA 2L6OA 1JBUH 1FI8A 5A2MH 2V0BA 1L1GA 3UWJH 1YLNA 3URCA 2SGAA 2AGIX 4GSOA 1KIGH 2A32A 2UWPA 4H4FA 3MH7A 5DG6A 3EAJA 3H7OA 4YT7H 1ELBA 5F53A 1MCVA 1DITH 3K9XB 2LELA 5K0HA 2XXLA 1FAKH 4JZIA 2HNTF 1ELCA 1O3FA 2XOKD 1ZGVA 3PMBB 3KGPA 1QRZA 1QJ7B 5DP3A 1GI4A 1AE5A 1SVPA 1OP0A 1PPEE 4ZUHA 1GMHF 3IITA 4U2WA 1BRAA 1KLJH 4X2VA 5EODA 2GCHG 2BOHB 3K65B 4OGYA 5F8XA 4Q7XA 4QT8C 3ZVDA 4XBBA 2ZPSA 1NRPH 5J4QA 1O2YA 1Y3WA 4HZHA 1UVUH 4OS6A 3U8OH 4UD9H 2H6MA 1A1RA 3A7ZA 2VIOA 3SQEE 1EUFA 1GJDB 1O36A 1L2EA 2QXHA 1A5IA 1HBTH 3SUEA 2ZCLP 1NFWA 2ZFQH 1B5GH 1O2KA 2AS9A 1JOUB 1NM6A 1EAWA 1Y8TA 3ITIA 5HGGA 2WV4A 4JYUH 1GPZA 4ISHH 4IC5A 1O2VA 4UEHH 4OS4A 5GWZA 1O5DH 1B7XB 4ZCNA 4FU8A 2PW8H 2ZQ2A 1OKXA 1TNHA 4E06H 1YPGH 4I8HA 4I31A 1ANBA 2C8YB 2VH0A 1UK3A 3TK5A 1QBVH 1RS0A 3ZZDA 3GCHC 2VB0A 5L2ZH 5LPFA 2A0QB 6CHAC 1GI5A 5BPEA 2ZU2A 3D49H 1DS2E 1C1VH 1QJ1B 3SNEA 1O37A 1YWUA 5KGOA 5CHAB 3RMNH 7KMEH 6GCHF 4DCDA 1O38A 1AI8H 3O8CA 1NC6A 4CH8B 1ABIH 2Y80A 3QTVH 1ARBA 1V2PT 2HLDD 2XWBI 1B0EA 2Y7ZA 1VGCB 3Q3XA 4ABFA 1FY1A 1D3DB 2LNCA 4X6NA 2Z7FE 2TGTA 1NY22 1C2JA 1GHVH 2XBXA 1DY9A 1TGTA 1ANCA 1O2GH 2BYAX 5C5OA 3T29A 3T25A 2SGQE 2UWLA 4ACBA 4E7NA 3SV2H 4WXIA 1G3DA 1YPMH 4K8BA 2WHXA 1K28D 1Z1IA 1QL7A 1XM1A 2J5UA 4ABGA 2OD3B 4O3UA 5DGJA 3RXKA 3L6PA 1VGCC 3EA7A 3OSYA 1ZTKA 1WU1A 1O32A 1AD8H 2K8IA 4TWWA 3PLPA 4ZHAA 1O33A 2EEKA 4D8NA 8LPRA 1CBWC 1O2NA 1BITA 1KMHB 4YM9A 2KZ4A 1P03A 2B7DH 4Q7ZA 1GGDC 1O2WA 3B23B 1GHXH 4MPXA 3LC3A 2OC7A 4VGCC 2XC4A 1YPLH 4FUIA 1C2MA 2H9EH 2HPQH 4WWYA 5JDUB 1AFQC 5JBBS 1IQJA 1Z1JA 2J98B 1GI6A 2P3UB 3DFJA 1M9UA 1FLEE 4UE7H 2W7SA 1GJ5H 1L4DA 4ZKOU 5C1UA 2C90B 1DUEA 2V3OH 4ABJA 1P01A 4WMFA 3UOPA 1YCPM 2QYIA 3EE0B 3MO3A 3LGTA 1VITG 2BDCA 3NZIA 4Y79A 3U98H 1EP5A 1IQFA 1QB6A 3M61U 5AF9H 2ZF0H 1FPHH 1EB1H 3E8LA 3R3GB 5JBAS 1DSUA 7ESTE 3NWUA 1UTNA 1ZHPA 2Y5HA 1O3OA 4I8LA 4NIXA 4CR9A 3V3MA 3RC5A 1WTHD 2AH4X 1EKBB 2F9NA 1FPCH 1CA0B 3TU7H 2GV6A 1FNIA 1CT0E 2QV1A 1YPJH 4YESB 1TX7A 2A4RA 5A8YA 5IK2D 3RXAA 3P95A 1DFPA 4NCYA 3NUMA 1O5GH 2YNBA 1BRCE 1FY3A 1PPHE 1O31A 3ZZCA 1C5TA 4D7GA 1YPKH 2WPLS 2XCFA 5F8TA 3PLKA 1LVYA 4O03A 1WDIA 3P92A 1P10A 4I8GA 1C5RA 5DP5A 3T27A 4MG3A 2WPDD 1P06A 3M5LA 3TVJB 2PHBA 1BTZA 1GCTC 2KAIB 4FU7A 3UPEA 2ZFFH 1ZSLA 4TY6A 2VIVA 1SOTA 3T2NA 1SLVB 4NG9H 1C5UA 1C5SA 1RTKA 3LT3A 4IGDA 3B8JA 1G3BA 3PB1E 3OY6U 1MBMA 3PM3A 4GLYA 3SOSA 4CHAB 4FUJA 4TPYA 2KCPA 4X8TH 1NU7B 1UHBB 1O3EA 2ZU5A 1GL0E 2FX4A 3EQ0H 1UVTH 4F49A 4JYTA 1BHXB 1KSNA 1F0TA 1LO6A 4ACAA 3AASA 1SGTA 3RXBA 1EJAA 4B1TA 1FIZA 1GJ8B 3S9BA 2Z9LA 3F9EA 3S0NA 3ZV9A 5KECA 1FQ3A 2NU1E 1S0QA 2SGFE 3GCNA 2J38A 4ABEA 1ZGIA 1Y5BT 1YM0A 2TIOA 1D6RA 1NRNH 1ZPCA 2K0QA 2OC0A 1G30B 2RFKC 5EW2H 1NZQH 3HK6B 3L33A 2EA3A 2Z3DA 2B8OH 1F5KU 1CT4E 1XVMA 3RP2A 4B2CA 1TPSA 1ZTJA 3ZVFA 2AIQA 2Y81A 1ZPZA 1W3CA 3TITA 1EZQA 5DP4A 1FY8E 5L2YH 4INHA 2FOEA 1O3IA 3F3BA 3FN8A 1ELGA 1WUNH 1DUAA 1KXFA 2PSYA 5EW1H 2FIRH 4NIVA 1CO7E 1BHXF 2WPHS 3GY4A 4JZFH 4X6OA 4F48B 5I25A 1N6YA 4JCNA 1Z8GA 2ALPA 3KCGH 4X8SH 1AQ7A 2VJ1A 5BRRE 4B2AA 1E1QD 1FY5A 3BIUH 3HPTB 4JK6A 1V2LT 3A8DA 1ELTA 3A7TA 2GGVB 1G2LA 2ZGHA 5DP9A 1C2LA 2BDHA 2ANYA 1HAZB 1C9PA 3P8GA 2OQUA 1GHBG 1DY8A 1UTQA 3RMMH 3SUDA 3A87A 1JRSA 2CHAC 5ABWA 1HNEE 1GI3A 2DUCA 3BN9A 4Y11E 2F4LA 5HM9A 2HNTE 2W5EA 1RTFB 2G4UA 2BDBA 2OK5A 1TIOA 1E35B 1CSOE 2CF9H 4X1SU 4ZH8A 3SI4H 4CRDA 2FI5E 5FBIA 1A0LA 2IPQX 2BVSH 1KXCA 3STIA 2CXVA 1NO9H 1GI1A 4Q7YA 1W13U 1AFQB 2UUYA 3GCHB 2WV9A 2F9PA 1KTSB 2GMTC 2G81E 1ESBA 1BMLA 3RC4A 2JIZD 3QLPH 3E91A 4ABBA 1YYY1 1SGQE 4TWYA 1VKYA 1A5GH 1TRNA 2KCAA 1GBFA 1O3JA 1Y3UA 4I7YH 2PV9B 2ZO3H 1HUTH 1C1TA 1ZZZA 5EPNA 4B74A 1SSXA 4SGBE 4MNXA 4B71A 1ELAA 3QGJA 2BY5X 3HKIB 1W7XH 2VWNA 2AMQA 3RXPA 1BBRE 1GHWH 1HAHH 4XBDA 1YC0A 2OC1A 4B2BA 5SGAE 2G8TA 3BEFB 4JZEH 5C5NA 5CE1A 1OWIA 3VFEA 5E0JA 1SL3A 4HI3A 2FZZA 2G00A 2GP9B 4X1PU 4ABIA 4GVUA 1G36A 1PYTD 1EZUC 1QY6A 1ETSH 2KCOA 2UUKB 3KQBA 1IQIA 2WZQA 1TALA 4J1YA 4K3JA 4ASUD 2AGEX 1SGIB 1BRUP 1MMJN 3KEEA 2C93B 2FI4E 3UNQA 1HLTH 1P3CA 5CMXH 1ZJKA 3M35A 1P9SA 1V2JT 1RFNA 3ZYEA 3M3SA 4FU9A 2XCNA 4H6TA 2UWOA 4ESTE 3UNSA 2G55A 1HAGE 3KF2A 1SLWB 5AFZH 4Q2KA 2IJD1 1CT2E 1U6QA 2CJIA 2QAAA 3E6PH 3KNXA 3DT0H 2P8OC 2YNAA 4R8TB 1HJAC 3GYLB 2JETC 1MU6B 1GL1A 1SGYE 1TB6H 3ZV8A 4A6LA 2EY4C 3A89A 4P00A 5EXMA 2H5DA 3BV9B 1O3HA 1GMCG 1GBDA 1IOEA 1BJUA 1GBJA 4KELA 1FMGA 4B76A 1NU9A 1X7AC 2GMTB 3SU2A 2V3HH 1T8MA 2RDEA 5JBTA 3UAIC 2P95A 2ZHWH 5FXLA 2F91A 4Y0YE 1K22H 2ZGJA 3I77A 3GDVA 5TJXA 2LPRA 1ZHRA 4NZLA 2Y5GA 1TPPA 5F03A 2OXSA 4RI0A 2ANWA 4Y7BA 3ZZBA 1O2LA 3OFND 1LQDB 4K1EA 1TBZH 2BY7X 1V2OT 1D9IA 3V7TA 2YMSD 4GPGA 1KXEA 1DSTA 2FDAA 3Q3KA 2A5KA 1TBQH 3FAOA 4BNRA 2WV5A 5EGMA 4TT3D 3A81A 5T3HA 4NSYA 4U01A 3U1IB 3SNDA 1BRBE 2G5VA 1GCTB 2BY8X 2VIWA 5ESBA 1EB2A 1K1PA 5C0TA 3TLOA 3STJA 4GCHF 2YMSC 1TNGA 4K8YA 1VJ9U 1S6FA 3OTJE 2O9QA 4NWKA 4RKOB 3VEQB 1BDAA 3LGYA 2Z9KA 1INCA 2VVUA 3AAVA 2F9BH 1P2MA 1H4WA 1IQKA 1L0ZA 4U30A 3OE7D 1GMCF 4AORA 1P2QA 5AVDA 1NFUA 1C4U2 4YZUA 2C8XB 4B6EA 2ZI2H 3TH3H 2VIDA 2VWMA 1PQ7A 3KN2A 2FM2A 2STBE 5EU8A 3P17H 1S82A 2PKSC 1BB0B 4Y76A 1Y59T 4IC6A 1F5LA 2QGRA 1HDTH 3UOUA 1GHAG 3MH4A 3LC5A 5EIYA 3KIDU 1FN6A 5EQSA 1HAYB 2J34A 3SGAE 1O2UA 2SGPE 1L1NA 1GDUA 4H42U 1EASA 3M7UA 4A1TA 3VGCB 1C2FA 1O3DA 1QL8A 4NA9H 2ZU1A 3MO9A 1GBMA 3SU5A 1H9HE 1QB9A 2F3CE 1TONA 1K1OA 1THPB 2C3SA 1VITF 3VB5A 1RTLA 1AE8H 1P2OA 2ZNKH 1V2RT 2AMPA 4XFQA 4FUBA 5DP6A 4FVDA 3BF6H 3HGPA 2ZHDA 2FYRA 2R3YA 1GGDB 3LIWA 2W6ID 4BAMB 1MTNB 1THRH 4BOHA 3FVFB 2GZ8A 1UTJA 4ZXXH 2VIPA 5IDKA 1IQGA 1ABJH 2SGDE 1DE7H 1O3BA 1MAYA 2XBWA 1OWEA 4Y8YA 2WSSD 4X2WA 3UIRA 5EXLA 4Q80A 4NSVA 1LHFH 4KKDA 2CHAB 2P94A 1MBQA 2WYJA 4M7GA 4CRBA 5EQQA 3PTBA 1GJ7B 3EYDA 1O2PA 1XKBC 2WPJS 3G01A 1O5EH 3LGIA 1K0HA 4FETA 1OHHD 3BTQE 1GMDF 1J14A 1SHHB 4LZ1H 3RXIA 1O2ZA 1EPTC 3RXTA 1FN8A 1UVOA 1HJ8A 3O8DA 4X1QU 3PWBA 1P2IA 3P70B 3O8BA 1TAWA 1W0KD 4DGJA 1DX5M 3SUGA 1F92A 5KEDA 1ETRH 2ZECA 4DW2U 1WV7H 3QZQA 3RXGA 1JIRA 3QWCH 4BXSA 1P8VC 4DURA 8GCHF 1BUIA 1AKSB 1QA7A 3F68H 1MCTA 4GAWA 1LVOA 2BTCE 3TPIZ 2FTLE 1OWJA 4RN6A 2JKHA 1C4Y2 4IBLH 4MVNA 5LPEA 1Y3YA 2QY0B 3A8BA 3ATWA 3H09A 4XSKU 4YO9A 4GHQA 4D9QA 1TNIA 1OWKA 2ZKSA 4AYVB 2ZC9H 2JJ1D 2P16A 2ZFSA 1HJ9A 1AIXH 1SHYA 3JZ1B 3ENSB 3HK3B 3UWIA 1AVWA 4K2YA 1G2MA 1A4WH 3SU6A 1TE0A 2TPIZ 2FO9A 1V2VT 1THSH 3NRLA 2AERH 6ESTA 3GY7A 3S7KB 7GCHF 1AKSA 1GHAF 5FCKA 2RCEA 2KAIA 3Q76A 4I33A 1G32B 1YGCH 2GDDA 2R0LA 3E1XB 4NIYA 3E16B 2CF8H 4J2YB 1O2JA 3ZZ8A 1WSSH 3PLBA 8ESTE 1O3GA 4BAKB 1QZ8A 1C1RA 2YMSB 3FANA 2D8WA 1GVZA 4BANB 2XNDD 1GHYH 3MI4A 5JB9S 4AZ2B 1V2ST 1HJAB 2BQ6B 3SO3A 2QE7D 4Q4LA 4CRAA 1GBTA 1PQ8A 3GCOA 2ILNA 3A83A 1A0JA 2Z9GA 2RDLA 1XUFA 1RIWC 2F9VA 1PYTC 1GI2A 1UK2A 2IJOB 2XC0A 1C2HA 2GZ7A 2JH5D 4CRCA 2D1JA 3LJOA 1SBWA 1TOMH 2GVFA 2BD2A 4WF8A 1P12E 1IQNA 3BTKE 1CHOG 3A88A 3A7WA 3LOXA 2P3TB 3QN7A 3SBKA 1H8IH 3C1KA 3LPRA 4FUEA 2ZTZA 2BVXH 4HFPB 3D23A 3SV9A 1D6WA 5C20A 1BTUA 2ZDMA 1JRTA 1BOQA 1K1NA 3CENA 1OP2A 1GBLA 1AGJA 2W26A 1CA8B 1J17T 3N99A 2ZZUH 4LZ4B 1ZR0A 3RXVA 3VPKA 1FX0B 3TJVA 5JPMH 1CE5A 1TOCB 4XD7D 1NT1A 1TNKA 3Q00A 4DY7B 1K9OE 4XE4A 1AUJA 1XVOA 1MZAA 1P57B 1ANEA 1C5NH 1J9CH 1A3BH 3EGKH 4A5TS 4FUFA 3UQVA 1ZTLA 5A09A 3FKSD 3SJKA 1A0HB 1E34B 1AB9C 5E0HA 1SLUB 1YKTA 3BIVH 3OY5U 4TY7A 1IHSH 2CK3D 1P2JA 2A7HA 3RU4E 2FS8A 4ISLA 3FO8D 1W14U 1N8OC 1ZJDA 2H9HA 2BLVA 1SQTA 3HATH 1FY4A 1S83A 2HLCA 1IQEA 1JXPA 2J95A 1RJXB 2BZ6H 3PMJA 5FX6A 1GVLA 2W7UA 3MU8A 4MPVA 5C1XA 4K1TA 1GHZA 1FONA 2ZHQH 4ISIH 1KDQB 2C8ZB 4FUCA 4MNYA 4ABAA 1C1OA 3M36A 3TIUA 2PTCE 3DUXH 5FCRA 1KXDA 4RSPA 2XC5A 2P3FH 1KLTA 1GBBA 3LGVA 1GBHA 1NS3A 2QF5A 1YCPH 2BHGA 2GCTB 3K2UA 1IQLA 5DK1A 2R9PA 3GY8A 2PWXA 1SR5C 3D62A 2PGQB 3WWFA 2J98A 3DSPA 2VVCA 3U9AH 4O3TA 3CS0A 2AHME 1ZHMA 3UY9A 4Y8XA 1C1WH 5FAHA 3ODFA 3ODDA 1UTLM 2ZCHP 1E37B 4AYYB 2BB4A 3SV6A 1OYTH 1UCYK 4UFDH 3BTFE 3BEIB
chains in the Genus database with same CATH topology
4ASUD 3SUGA 4A1XA 4JMYA 2M2AA 3F3BA 3KEEA 3FN8A 3PV2A 3F2FA 3P8OA 1CU1A 3M5MA 2A4GA 3N99A 4ZCNA 3F2HA 3OEHD 3DCLA 4F55A 2JJ2D 3OE7D 3U1JB 1FX0B 4I31A 5CHBA 3SV7A 1N1LA 3PV5A 5H4IB 3LKWA 4B6EA 4XD7D 4WH8A 3KN2A 2XCNA 2FM2A 1SKYE 1E1QD 3M5NA 3SU1A 2KR7A 5FL7D 3RC5A 3SU4A 3M5OA 2GGVB 3KF2A 4TYDA 5FPTA 3F0OA 4KTCA 5EQSA 2IJD1 4A1VA 3FKSD 3KNXA 1NBME 2QV1A 3H09A 4YXWD 5DN6D 2XNIA 2OC8A 3O8CA 5GPIB 1DY8A 2A4RA 4OM9A 3SUDA 4R8TB 4A1TA 5IK2D 2CK3D 2JJ1D 1DXPA 3DSOA 2F4LA 2HLDD 3FO8D 3GS9A 5ETXA 3F2GA 3SUFA 3SU5A 3O8RA 2OK5A 1E79D 3LONA 2V7QD 4Q63A 2KFWA 2XCFA 4WH6A 3SU6A 3SV8A 1DY9A 3ZIAD 5C17A 3SZEA 4B76A 1RTLA 5FPSA 3SU2A 3W1EA 3OYPA 2L6OA 2WPDD 1JXPA 3M5LA 5DSFA 2OINA 3AK5A 4A92A 2KM0A 3NRLA 4K8BA 2KCYA 2WHXA 2W6ID 4B73A 2J5UA 2VBCA 4I33A 4B75A 5F53A 5CDFE 2WV9A 3N7DA 2JDID 2LELA 3L6PA 1WXRA 4RI0A 1DXWA 2K8IA 2XOKD 2YOLA 5IDKA 2KCPA 2JIZD 3RC4A 1W0JD 3E90B 3OFND 1COWD 5C0UA 2YMSB 1H8HD 2OBQA 5T1VA 3SU3A 2WSSD 2YMSD 4I32A 5EQRA 2XNDD 2O8MA 1KMHB 3FOAA 2KCAA 3OTPA 5EPYA 1NS3A 2KZ4A 2QF5A 2QF4A 5FPYA 3SU0A 2W6JD 2F43B 2QE7D 4Q4LA 3SYJA 3P8NA 5EPNA 4B74A 2OBOA 5EQQA 2FP7B 2A4QA 3OEED 3UB0A 3N7EA 3VG8A 3EYDA 3WWFA 4TT3D 4B71A 5B6LA 2F9VA 2OC7A 4DT4A 2F9UA 3DSPA 4TSFD 2IJOB 4FETA 1OHHD 4U01A 3U1IB 3OAAD 4M9FA 2OC1A 3PRDA 2K0QA 2GVFA 2OC0A 2FOMB 1BMFD 1EFRD 1S6LA 2AHME 4B6FA 5ESBA 4WF8A 3WWBA 3PRBA 5GNDA 3LOXA 1E1RD 5C0TA 1A1RA 1NBMD 3WW7A 2P59A 2YMSC 2KCOA 3O8DA 5GJ4B 3SUEA 1H8ED 3SV9A 4NWLA 1RGQA 3SV6A 2WZQA 3RC6A 1BT7A 4Z1MD 1W3CA 4NWKA 1MABB 2K1QA 3O8BA 1W0KD 3F0PA 5HKKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZ4 A;  2KCA A; 
#chains in the Genus database with same CATH topology
 2BD7 A;  4A1X A;  1CBW B;  1UVS H;  1GJC B;  4AFQ A;  1OWH A;  4BAO B;  4NFE A;  3TGI E;  2BXT H;  2VGC C;  3RML H;  1QJ6 B;  1GDQ A;  1Z6E A;  4CRG A;  1NPM A;  3RM0 H;  1KYN A;  1QBN A;  2THF B;  5F8Z A;  4DG4 A;  1GBA A;  3MMG A;  2AYW A;  1IQM A;  3LKW A;  1AB9 B;  2XWA A;  1SQA A;  1LKA A;  2PGB B;  4WH8 A;  1GJ9 B;  1O3C A;  2GCH F;  2W3I A;  1DWE H;  3S7H B;  1OS8 A;  1TGB A;  1UTK A;  3LU9 B;  3V0X A;  3A84 A;  2ZGC A;  1D4P B;  1C1U H;  2OC8 A;  1XMN B;  5GPI B;  1BIO A;  2UUJ B;  1ETT H;  1FZZ A;  1Y3X A;  4YOJ A;  1P05 A;  1O3P B;  1AY6 H;  1T8L A;  3NPS A;  1Z8I B;  5DKM A;  1KTT B;  1HAV B;  2FMJ A;  2ZEB A;  3GY3 A;  1UMA H;  1AHT H;  1O2R A;  4AFZ A;  3LON A;  5EXN A;  3MOC A;  4IN1 A;  1O30 A;  2VWL A;  4WH6 A;  3ZIA D;  3SW2 B;  3A80 A;  3MU5 A;  5FPS A;  1DLK B;  2VIQ A;  2Y5F A;  3QGN B;  2VU8 E;  4ZKR U;  2HAL A;  3RLY H;  1CHO F;  2WYG A;  1QQ4 A;  2BDA A;  1C5L H;  3KQE A;  1TX8 A;  2SFA A;  3GCT F;  2BM2 A;  2HVX A;  2A2X H;  1AZ8 A;  1XUJ A;  1BMN H;  3BSQ A;  2TGA A;  3E90 B;  1COW D;  5JYI A;  4IW4 E;  3RMO H;  2PFE A;  2B0F A;  1P0S H;  2WPM S;  1DT2 A;  4OS7 A;  1K21 H;  3E0P B;  1YCP K;  3UR6 A;  3FOA A;  2F83 A;  4IN2 A;  4A7I B;  8KME 2;  2PSX A;  5EPY A;  2W6J D;  4FXG H;  3TK6 A;  3OX7 U;  2OBO A;  3RLW H;  3AW1 A;  2ZP0 H;  4DT4 A;  3GDU A;  1T8O A;  4DIH H;  1FUJ A;  1ZLR A;  5HIZ A;  2BD3 A;  4WME A;  4IS5 A;  1BMF D;  1EFR D;  1SC8 U;  2GD4 B;  1TGS Z;  1KLI H;  2RA0 A;  1AVG H;  2VIN A;  3A86 A;  1P04 A;  2A1D B;  2PTN A;  3U8T H;  2Y7X A;  1LHG H;  4Y8Z A;  2OLG A;  2OTV A;  1AU8 A;  3RXR A;  1DLE A;  3PV2 A;  2EC9 H;  2F9O A;  2B5T B;  1N6X A;  1Y5A T;  2UUF B;  1Q3X A;  2A4G A;  2WIN I;  4SGA E;  5C2Z A;  1PPZ A;  1MQ5 A;  2CV3 A;  2O8T A;  2R3U A;  3OEH D;  3MH5 A;  4Y10 E;  6CHA B;  3U1J B;  1GJ4 H;  4Y0Z E;  1F0S A;  2P8O B;  1ZMJ A;  4LK4 A;  3P8F A;  1BTY A;  1TNL A;  4ZKS U;  3ATM A;  3B9F H;  2AMD A;  3M37 A;  3A7X A;  5A0B A;  4CRF A;  4GHT A;  2AFQ B;  1F0R A;  4ABH A;  2QA9 E;  1C5Z B;  1VCW A;  1SGP E;  2BY6 X;  4OS1 A;  4NZQ A;  2FOC A;  3ZZ7 A;  4NGA H;  2A7C A;  1MUE B;  4MPU A;  5E8E H;  3HGN A;  2BZA A;  5IYT A;  4CR5 A;  2DE8 A;  1O3A A;  3EE7 A;  2ODQ A;  4Q63 A;  1GVK B;  1HAO H;  3ATI A;  5DPA A;  1QFK H;  3SV8 A;  3RU4 D;  5JB8 S;  2C4F H;  1PPF E;  1HFD A;  3ELA H;  1W12 U;  3RXJ A;  3UNR A;  3FP7 E;  1WCZ A;  2VH6 A;  5DSF A;  2J2U A;  2BX4 A;  3AK5 A;  1L1J A;  1P9U A;  2KM0 A;  1TMB H;  1SGF A;  1TAB E;  1XUK A;  2IPH A;  3F6U H;  5CDF E;  1D3T B;  2ANK H;  1QR3 E;  1F5R A;  2YOL A;  4HTC H;  4MTB A;  3DD2 H;  3SI3 H;  2XRC A;  3FZZ A;  5TCA A;  3SU3 A;  2Z6B D;  2NU2 E;  2OCV B;  3UR9 A;  3V12 A;  1LCY A;  1ESA A;  4AOQ A;  3E0N B;  4FUG A;  2BD9 A;  4Y7A A;  1TPA E;  1IHT H;  2A4Q A;  4BAH B;  5B6L A;  1EOJ A;  3DA9 B;  5FX5 A;  2ANM H;  4DII H;  2PP6 A;  1VJA U;  3IWM A;  3GDS A;  3OAA D;  1EST A;  2KX4 A;  2FOM B;  1YY3 A;  2ZHF H;  4MNV A;  1QRW A;  2BX3 A;  2QXJ A;  1FJS A;  1LPK B;  3BTD E;  3I29 A;  1HAP H;  1LDT T;  2EQN A;  4MPW A;  1LMW B;  1Z8R A;  4Z1M D;  1GHB F;  1T8N A;  1TBR H;  2PUQ H;  1UCY H;  1AND A;  2FOH A;  4JMY A;  1P09 A;  3LH3 A;  3TH4 H;  1HPG A;  3GCT G;  3KQD A;  3TNS A;  1CU1 A;  1F7Z A;  3F2H A;  4GUX A;  1HV7 A;  1SB1 H;  1K1M A;  1WAY B;  4HG6 A;  4X1R U;  3CS7 A;  1JIM A;  1MTU A;  1MD7 A;  1AUT C;  2ZDK A;  1CHG A;  1YPH C;  1LHE H;  1QGF A;  4NA7 A;  4BTI B;  2KR7 A;  1E36 B;  1HB0 B;  4OGX A;  3RU4 T;  2ZDL A;  1BZX E;  1UHB A;  1YLD A;  5E2P A;  1NN6 A;  3GY2 A;  3PMH B;  4A1V A;  3SN8 A;  2BY9 X;  3P6Z B;  3TNT A;  1PFX C;  1PPB H;  1SI5 H;  3LJJ A;  2XNI A;  2A45 B;  2BDI A;  2TGD A;  5EJ1 A;  2I6Q A;  5LGO A;  3DFL A;  1QCP A;  1DWB H;  1O5A B;  2A31 A;  5DP8 A;  1S84 A;  5ETX A;  2LP6 A;  4X6M A;  9EST A;  3M7Q A;  3O8R A;  4AX9 H;  1FXY A;  2PLX A;  1AO5 A;  1TNJ A;  2GTB A;  3SZE A;  5FBE A;  4X2Y A;  2ZCK P;  1K1J A;  1Y5U T;  5T6D A;  2ZWL H;  2OIN A;  5HIY A;  1XUI A;  1DDJ A;  4JK5 A;  1HIA B;  4FOU C;  1V2W T;  1SLX B;  1UO6 A;  1O5B B;  4ZMA H;  2EI6 A;  2OQ5 A;  1GG6 B;  1DXW A;  1DWD H;  2RA3 A;  4BAQ B;  1G9I E;  3DSG A;  4RT0 A;  1TRM A;  1C5X B;  3M3V A;  4I32 A;  2L74 A;  1W10 U;  4XBC A;  4XOJ A;  3MNX A;  4OS2 A;  1HAX B;  1ORF A;  2W3K A;  1O2Q A;  4WY3 A;  1B0F A;  3OEE D;  1BA8 B;  3BTE E;  2G52 A;  3KYF A;  2F9U A;  2WPK S;  4TSF D;  4UDW H;  2FYQ A;  1WYK A;  3TJN A;  4DOQ A;  2BMG B;  1SGE E;  4IMQ A;  2BD8 A;  1C2G A;  3K6Y A;  3QUM P;  1BMM H;  5TCC A;  1ID5 H;  1ZSK A;  2FTM A;  1MKX K;  1EX3 A;  1H8E D;  1VCQ A;  1MKW K;  3RC6 A;  1OPH B;  1BT7 A;  4JZ1 A;  2HWL B;  3T5F H;  3W95 A;  1LPZ B;  2DE9 A;  3EST A;  2GJG A;  4ZXY H;  2SNW A;  1VR1 H;  3MFJ A;  1MZD A;  3M5M A;  1C2D A;  3ZZ5 A;  2H1U A;  4AC9 A;  1ARC A;  2Q6G A;  3ZVA A;  3ZVG A;  1V2N T;  3SJ9 A;  3UTU H;  1QTF A;  2PR3 A;  3ZZA A;  3BTM E;  2SNV A;  2STA E;  4FVB A;  5C3N A;  4D76 A;  4YLQ H;  5HYO A;  1EQ9 A;  4I8K A;  1H9I E;  1XX9 A;  7LPR A;  1WQV H;  3FFG A;  3F0O A;  1C4V 2;  1C5M D;  1GMH G;  2QF3 A;  2BQ7 B;  4AB8 A;  3PTN A;  3SGQ E;  1OXG A;  1DOJ A;  4AFU A;  3W94 A;  1BTH H;  1P2K A;  2GZ9 A;  1Z6J H;  3U8R H;  3MU4 A;  1QL9 A;  4BTT B;  3SOR A;  5C1Y A;  3R0F A;  1GG6 C;  2ULL A;  2PKA A;  4K5Z A;  1TA2 A;  2GT7 A;  5HMA A;  1SQO A;  2EI7 A;  3K6Z A;  3KQC A;  3SNC A;  5HXF A;  4B73 A;  2Z94 A;  1Z8J B;  1FV9 A;  1YBW A;  2QN5 T;  4LXB H;  3ZVE A;  1GBE A;  2J97 A;  3N7D A;  3MO6 A;  3H7T A;  4UFG H;  1SOZ A;  1KXA A;  3DHK H;  3URE A;  1KXB A;  1EXF A;  5GIB A;  3NCL A;  5T1V A;  1QNJ A;  2FX6 A;  1S81 A;  1CGI E;  3OTP A;  2C8W B;  1WQS A;  1S6H A;  2J92 A;  1V2U T;  4ISO A;  3VG8 A;  3RUO A;  3RDZ A;  1J15 A;  1SGF G;  4I8J A;  1WOF A;  2ZPR A;  3MHW U;  5E0G A;  1A3E H;  3NKK A;  1EAT A;  1PPC E;  3A82 A;  4E7R G;  7GCH G;  1DVA H;  2PKA B;  3MNS A;  5GND A;  2XBV A;  3RXF A;  1E0F D;  1XXD A;  2P59 A;  4X8V H;  1O5C B;  1V2Q T;  2GKV E;  1W7G H;  1F2S E;  1MAB B;  1LVB A;  2ZGB H;  2GT8 A;  5HKK D;  4O97 A;  4DJZ B;  1HGT H;  4YOI A;  4BTU B;  1K2I 1;  1A5H A;  3BG8 A;  1P3E A;  1PPG E;  1UTO A;  4F55 A;  1NRS H;  4PRO A;  1BMA A;  1FAX A;  2PUX B;  1C1P A;  3TJO A;  1QUR H;  2JH0 D;  1ZMN A;  3ZVC A;  1SKY E;  4CH2 B;  1QIX B;  2WPI S;  2GDE H;  1SG8 B;  3M5O A;  3V13 A;  4O9V A;  4RT1 A;  3PMA B;  1MKW H;  1MQ6 A;  2V6N A;  1W0Z U;  4AFS A;  9LPR A;  4YLU A;  3MWI U;  1O2M A;  2ALV A;  1Q31 A;  4ASH A;  1AMH A;  1OX1 A;  2O8U A;  1ELD E;  2Y82 A;  2FOG A;  2ZQ1 A;  1NTP A;  4AGK A;  4I86 A;  3SUF A;  1TRY A;  1E79 D;  1HAV A;  2AIP A;  2ZDV H;  1PQA A;  3FP6 E;  5C17 A;  3BTG E;  1QRX A;  1QBO A;  3RXM A;  2Q6D A;  4NIW A;  2SGE E;  1K1I A;  4IMZ A;  3NXP A;  1C5W B;  1BJV A;  1OSS A;  2KCY A;  3PYH A;  1LHC H;  2GCT C;  1HIA A;  3SGB E;  1NFY A;  1XKA C;  1GBC A;  1SQR A;  5EJZ A;  2A2Q H;  8GCH G;  3HKJ B;  5EG4 A;  2FLB H;  1GDN A;  2GX4 A;  1T32 A;  2BD5 A;  2PKS B;  3RM2 H;  3JZ2 B;  5C0U A;  2XBY A;  4F4O C;  1Y3V A;  4TPI Z;  1H8H D;  1GI0 A;  2ZHE H;  2XW9 A;  3QX5 H;  1F0U A;  3KQ5 A;  4MNW A;  1EZS C;  5FPY A;  3UFA A;  1V3X A;  3MNB A;  3SU0 A;  3ZZ4 A;  5I46 H;  3PO1 B;  5EJL A;  3PRO A;  1O0D H;  3MNC A;  3N7E A;  3UB0 A;  5JBC S;  1FDP A;  2QCY A;  4R0I A;  5GCH F;  4CRE A;  3SJO A;  2HRV A;  5AFY H;  3PRD A;  1AN1 E;  4B6F A;  1BBR H;  2VGC B;  3WWB A;  2O8W A;  1G37 A;  1UTM A;  4MLF B;  1O3N A;  2A4O A;  2VNT A;  3BG4 B;  1FIW A;  3BTH E;  1C2I A;  1GI8 B;  4VGC B;  1ZSJ A;  2Q6F A;  3TGK E;  3F0P A;  4BXW A;  1V2T T;  1TA6 A;  1PJP A;  2M2A A;  1TQ7 B;  1Z71 A;  4YT6 H;  2FPZ A;  2ZTY A;  2FOA A;  1HRT H;  2WUC A;  2FLR H;  4LOY H;  4WVP E;  3DCL A;  4DT7 B;  3RXC A;  2CMY A;  3CP7 A;  2O8L A;  5CHB A;  3SV7 A;  2QC2 A;  1P2N A;  3PV5 A;  2QF0 A;  3GOV B;  2EST E;  2Y6T A;  2RG3 A;  4NFF A;  1O3M A;  1AWF H;  4KGA A;  3URD A;  1EP6 A;  4TYD A;  5FPT A;  2BLQ A;  3TK9 A;  2BOK A;  3LGW A;  3QK1 A;  3S9A A;  1LHD H;  3QTO H;  3RXQ A;  4FUH A;  2HVY B;  3FZD A;  1TGC A;  1XUH A;  3Q3Y A;  4OM9 A;  2JET B;  4Y71 A;  2ZTX A;  1O39 A;  2Q1J A;  3QDZ B;  3DSO A;  1EAI A;  1QB1 A;  4X0W U;  3F2G A;  1PQ5 A;  2NWN A;  2V7Q D;  3EDX B;  3RXO A;  1NFX A;  1GBI A;  1BTX A;  1EPT A;  3F9H A;  3BTT E;  2IN2 A;  1RRK A;  5L30 H;  1BTW A;  4KTS A;  2JH6 D;  3ATK A;  1MTN C;  1AWH B;  2H2Z A;  1QHR B;  2OUA A;  3TGJ E;  1G3C A;  1ZRK A;  1UCY E;  1C5P A;  2H5C A;  3RXS A;  2VBC A;  1MAX A;  1SGN E;  4K60 A;  5EST E;  1O2O A;  1A46 H;  1C5Q A;  3BTW E;  3PO1 C;  1VCP A;  2A7J A;  1YPH E;  1J8A A;  1LVM A;  1W0J D;  1J16 A;  3RXH A;  6LPR A;  1EJN A;  1D3Q B;  2QF4 A;  2ZPQ A;  2FWW A;  2ODY B;  1UJ1 A;  4X6P A;  1QQU A;  1MKX H;  2BLW A;  3QO6 A;  3A8A A;  4Y6D A;  5FHT A;  1C5O H;  4INK A;  2CGA A;  1YLC A;  2ZIQ H;  4DVA U;  1UTP A;  3IG6 B;  5GJ4 B;  4K69 A;  4NWL A;  1RGQ A;  4AB9 A;  2QXG A;  1BTP A;  5GDS H;  2J9N A;  2OP9 A;  2ZFR H;  1KDQ A;  1IAU A;  1NRQ H;  1LKB A;  1T4V H;  1D3P B;  3SZN A;  1CVW H;  1GWA A;  3F2F A;  3M7T A;  1MD8 A;  1TQ0 B;  2JJ2 D;  2D2D A;  2I6S A;  3MTY A;  5H4I B;  1O2I A;  1GCD A;  1O2T A;  1DPO A;  1LTO A;  2HNT C;  1TFX A;  3KL6 A;  1DWC H;  3T26 A;  3SU4 A;  1ZML A;  1T31 A;  3RXU A;  1C1S A;  4WXV A;  3Q77 A;  3RXL A;  1BBR K;  4KTC A;  5T6G A;  1GI7 B;  5DJ7 A;  4AG2 A;  4FUD A;  3ZZ6 A;  4YXW D;  3ZZ9 A;  5LPR A;  1MTV A;  3S69 A;  1CGJ E;  3VB7 A;  1GI9 B;  2R2W U;  1LPG B;  4WMD A;  3E3T A;  2TBS A;  4INL A;  1OOK B;  4JYV H;  3VXF H;  3SNA A;  4AGJ A;  4XRN A;  4YOG A;  1WTG H;  1GJA B;  2KFW A;  3A8C A;  3AAU A;  5GCH G;  4X2X A;  1TWX B;  1O35 A;  2FOB A;  3VB6 A;  1CA0 C;  2TRM A;  5A8Z A;  2ZA5 A;  3W1E A;  1NES E;  2Z9J A;  3A7V A;  1MU8 B;  4Z6A H;  4A92 A;  1OP8 A;  1H8D H;  3KYG A;  2ZFP H;  3EA9 A;  3SHC H;  1XXF A;  2B9L A;  4Z0K A;  4CBO A;  1WBG B;  4B75 A;  5GXP A;  3CNR A;  1OYQ A;  2Z3C A;  5B6O A;  1AFE H;  2G4T A;  1CGH A;  3N7O A;  2H9T H;  5EQR A;  1XUG A;  2CN0 H;  1L4Z A;  2IOT A;  2G51 A;  1VIT H;  2BVR H;  1P11 E;  2F43 B;  1C9T A;  3P8N A;  2AGG X;  3RXD A;  1GJ6 A;  2A5A A;  1JWT A;  2FP7 B;  1ELV A;  1EOL A;  2XTT B;  5A0A E;  1EAU A;  3M3T A;  2ODP A;  1ELF A;  1GJB B;  4D9R A;  1H9L B;  4M9F A;  4E05 H;  1S5S A;  2TGP Z;  1S6L A;  2A5I A;  1RD3 B;  5K7R A;  3F9F A;  5F6M A;  1NBM D;  3GY5 A;  3WW7 A;  1O5F H;  3KHV A;  1S85 A;  2AEI H;  1O2S A;  4P02 A;  1KY9 A;  2V35 A;  1HAI H;  3VGC C;  2K1Q A;  4XDE A;  2NU3 E;  4JZD H;  3GIS B;  1SGR E;  2ZDN A;  3RXE A;  3SQH E;  3GYM A;  2ZFT A;  2Z9I A;  3TH2 H;  2VVV A;  5C67 A;  2G5N A;  3SJ8 A;  4HGC A;  2GV7 A;  1JMO H;  1N1L A;  2M5T A;  5DP7 A;  4KP0 A;  3ZZ3 A;  1EZX C;  1GBK A;  1W11 U;  1ACB E;  1GMD G;  4UFF H;  1YPE H;  3M5N A;  1C5V A;  5LH8 A;  3TJU A;  1A7S A;  3MQK C;  2NU0 E;  3BG4 C;  1V6D A;  1O3K A;  2FOF A;  5PTP A;  3OU0 A;  2BDG A;  1NBM E;  1RXP A;  1O2X A;  2EI8 A;  4OS5 A;  3F9G A;  5T6F A;  1QA0 A;  2J94 A;  3UUZ A;  1MTS A;  1DXP A;  4ZRO A;  4X8U H;  1C5Y B;  5DO4 H;  1T7C A;  3C27 B;  1IQH A;  2BD4 A;  5C94 A;  1VZQ H;  1TLD A;  4CBN A;  1C2E A;  3BEU A;  1C1N A;  1O3L A;  1MTW A;  3T28 A;  5AHG H;  5EOK A;  1DAN H;  3MYW A;  2ZGX H;  1YP9 A;  2D26 C;  1ELE E;  1EPT B;  1SFI A;  4H6S B;  1NRR H;  4K1S A;  5G4B A;  3EA8 A;  4KTU A;  1H1B A;  1T4U H;  5A0C A;  4NA8 A;  1UK4 A;  1V2K T;  2FEQ H;  3A85 A;  2JDI D;  1SGD E;  1WXR A;  3UQO A;  1EAX A;  1P02 A;  2ASU B;  3U28 C;  2R0K A;  1E38 B;  1CQQ A;  1LQE A;  4YTA A;  3MU1 A;  1SPJ A;  2OBQ A;  3LGU A;  2O8M A;  1DIC A;  1TMU H;  1TYN A;  2BLO A;  2QIQ A;  2HOB A;  1NRO H;  1UVP A;  4MDS A;  3SYJ A;  1S0R A;  4AG1 A;  3AW0 A;  2NU4 E;  1TMT H;  1AZZ A;  1BQY A;  3GIC B;  3SHA H;  4ZKN U;  1YF4 A;  3MU0 A;  4ISN A;  3T62 A;  1ZRB A;  2BQW B;  4ZAE A;  1K1L A;  1UW7 A;  3PV4 A;  4UFE H;  2QXI A;  3PRB A;  4WJG 2;  4AN7 A;  1E1R D;  1N8O B;  1W2K H;  2J4I A;  4THN H;  4ZHM U;  2WUB A;  3MH6 A;  3D65 E;  1ZYO A;  3U69 H;  6GCH G;  2ZDA H;  3NK8 A;  4MQA A;  4D7F A;  1BCU H;  1C2K A;  5HM2 A;  2BDY A;  1HCG A;  2ZU3 A;  1MH0 A;  2BXU H;  3GY6 A;  1A61 H;  1TX6 A;  4ZHL U;  1SFQ B;  5E2O A;  3P8O A;  3FP8 E;  4GCH G;  1W8B H;  3VB3 A;  1W0Y H;  1C1Q A;  1A2C H;  1AVX A;  1HYL A;  1HXF H;  3LDX H;  3LH1 A;  2HGT H;  3PWC A;  2R2M B;  3L3T A;  3SJI A;  2P93 A;  2FOD A;  1TPO A;  1TGN A;  1ZOM A;  2ZG0 H;  3ZYD A;  3SU1 A;  5FL7 D;  5J4S A;  3WY8 A;  3H5C B;  4ABD A;  3ZVB A;  5A8X A;  2FS9 A;  3SNB A;  1HXE H;  4U32 A;  2FES H;  4RKJ B;  4X1N U;  3VB4 A;  5DN6 D;  4CHA C;  2FI3 E;  3A7Y A;  3QZR A;  1O2H A;  2V3M A;  2HPP H;  1ZPB A;  1G3E A;  1Q2W A;  3GS9 A;  1RIW B;  3I78 A;  3VXE H;  3ATL A;  1V2M T;  2VWO A;  1O34 A;  2FXR A;  5CHA C;  2XYA A;  3AVZ A;  5L6N H;  2ZU4 A;  1DM4 B;  2Z3E A;  1SMF E;  1SGC A;  4UON A;  3S9C A;  1C1M A;  1Z7K A;  3OYP A;  1EJM A;  3F1S B;  1OWD A;  2L6O A;  1JBU H;  1FI8 A;  5A2M H;  2V0B A;  1L1G A;  3UWJ H;  1YLN A;  3URC A;  2SGA A;  2AGI X;  4GSO A;  1KIG H;  2A32 A;  2UWP A;  4H4F A;  3MH7 A;  5DG6 A;  3EAJ A;  3H7O A;  4YT7 H;  1ELB A;  5F53 A;  1MCV A;  1DIT H;  3K9X B;  2LEL A;  5K0H A;  2XXL A;  1FAK H;  4JZI A;  2HNT F;  1ELC A;  1O3F A;  2XOK D;  1ZGV A;  3PMB B;  3KGP A;  1QRZ A;  1QJ7 B;  5DP3 A;  1GI4 A;  1AE5 A;  1SVP A;  1OP0 A;  1PPE E;  4ZUH A;  1GMH F;  3IIT A;  4U2W A;  1BRA A;  1KLJ H;  4X2V A;  5EOD A;  2GCH G;  2BOH B;  3K65 B;  4OGY A;  5F8X A;  4Q7X A;  4QT8 C;  3ZVD A;  4XBB A;  2ZPS A;  1NRP H;  5J4Q A;  1O2Y A;  1Y3W A;  4HZH A;  1UVU H;  4OS6 A;  3U8O H;  4UD9 H;  2H6M A;  1A1R A;  3A7Z A;  2VIO A;  3SQE E;  1EUF A;  1GJD B;  1O36 A;  1L2E A;  2QXH A;  1A5I A;  1HBT H;  3SUE A;  2ZCL P;  1NFW A;  2ZFQ H;  1B5G H;  1O2K A;  2AS9 A;  1JOU B;  1NM6 A;  1EAW A;  1Y8T A;  3ITI A;  5HGG A;  2WV4 A;  4JYU H;  1GPZ A;  4ISH H;  4IC5 A;  1O2V A;  4UEH H;  4OS4 A;  5GWZ A;  1O5D H;  1B7X B;  4ZCN A;  4FU8 A;  2PW8 H;  2ZQ2 A;  1OKX A;  1TNH A;  4E06 H;  1YPG H;  4I8H A;  4I31 A;  1ANB A;  2C8Y B;  2VH0 A;  1UK3 A;  3TK5 A;  1QBV H;  1RS0 A;  3ZZD A;  3GCH C;  2VB0 A;  5L2Z H;  5LPF A;  2A0Q B;  6CHA C;  1GI5 A;  5BPE A;  2ZU2 A;  3D49 H;  1DS2 E;  1C1V H;  1QJ1 B;  3SNE A;  1O37 A;  1YWU A;  5KGO A;  5CHA B;  3RMN H;  7KME H;  6GCH F;  4DCD A;  1O38 A;  1AI8 H;  3O8C A;  1NC6 A;  4CH8 B;  1ABI H;  2Y80 A;  3QTV H;  1ARB A;  1V2P T;  2HLD D;  2XWB I;  1B0E A;  2Y7Z A;  1VGC B;  3Q3X A;  4ABF A;  1FY1 A;  1D3D B;  2LNC A;  4X6N A;  2Z7F E;  2TGT A;  1NY2 2;  1C2J A;  1GHV H;  2XBX A;  1DY9 A;  1TGT A;  1ANC A;  1O2G H;  2BYA X;  5C5O A;  3T29 A;  3T25 A;  2SGQ E;  2UWL A;  4ACB A;  4E7N A;  3SV2 H;  4WXI A;  1G3D A;  1YPM H;  4K8B A;  2WHX A;  1K28 D;  1Z1I A;  1QL7 A;  1XM1 A;  2J5U A;  4ABG A;  2OD3 B;  4O3U A;  5DGJ A;  3RXK A;  3L6P A;  1VGC C;  3EA7 A;  3OSY A;  1ZTK A;  1WU1 A;  1O32 A;  1AD8 H;  2K8I A;  4TWW A;  3PLP A;  4ZHA A;  1O33 A;  2EEK A;  4D8N A;  8LPR A;  1CBW C;  1O2N A;  1BIT A;  1KMH B;  4YM9 A;  2KZ4 A;  1P03 A;  2B7D H;  4Q7Z A;  1GGD C;  1O2W A;  3B23 B;  1GHX H;  4MPX A;  3LC3 A;  2OC7 A;  4VGC C;  2XC4 A;  1YPL H;  4FUI A;  1C2M A;  2H9E H;  2HPQ H;  4WWY A;  5JDU B;  1AFQ C;  5JBB S;  1IQJ A;  1Z1J A;  2J98 B;  1GI6 A;  2P3U B;  3DFJ A;  1M9U A;  1FLE E;  4UE7 H;  2W7S A;  1GJ5 H;  1L4D A;  4ZKO U;  5C1U A;  2C90 B;  1DUE A;  2V3O H;  4ABJ A;  1P01 A;  4WMF A;  3UOP A;  1YCP M;  2QYI A;  3EE0 B;  3MO3 A;  3LGT A;  1VIT G;  2BDC A;  3NZI A;  4Y79 A;  3U98 H;  1EP5 A;  1IQF A;  1QB6 A;  3M61 U;  5AF9 H;  2ZF0 H;  1FPH H;  1EB1 H;  3E8L A;  3R3G B;  5JBA S;  1DSU A;  7EST E;  3NWU A;  1UTN A;  1ZHP A;  2Y5H A;  1O3O A;  4I8L A;  4NIX A;  4CR9 A;  3V3M A;  3RC5 A;  1WTH D;  2AH4 X;  1EKB B;  2F9N A;  1FPC H;  1CA0 B;  3TU7 H;  2GV6 A;  1FNI A;  1CT0 E;  2QV1 A;  1YPJ H;  4YES B;  1TX7 A;  2A4R A;  5A8Y A;  5IK2 D;  3RXA A;  3P95 A;  1DFP A;  4NCY A;  3NUM A;  1O5G H;  2YNB A;  1BRC E;  1FY3 A;  1PPH E;  1O31 A;  3ZZC A;  1C5T A;  4D7G A;  1YPK H;  2WPL S;  2XCF A;  5F8T A;  3PLK A;  1LVY A;  4O03 A;  1WDI A;  3P92 A;  1P10 A;  4I8G A;  1C5R A;  5DP5 A;  3T27 A;  4MG3 A;  2WPD D;  1P06 A;  3M5L A;  3TVJ B;  2PHB A;  1BTZ A;  1GCT C;  2KAI B;  4FU7 A;  3UPE A;  2ZFF H;  1ZSL A;  4TY6 A;  2VIV A;  1SOT A;  3T2N A;  1SLV B;  4NG9 H;  1C5U A;  1C5S A;  1RTK A;  3LT3 A;  4IGD A;  3B8J A;  1G3B A;  3PB1 E;  3OY6 U;  1MBM A;  3PM3 A;  4GLY A;  3SOS A;  4CHA B;  4FUJ A;  4TPY A;  2KCP A;  4X8T H;  1NU7 B;  1UHB B;  1O3E A;  2ZU5 A;  1GL0 E;  2FX4 A;  3EQ0 H;  1UVT H;  4F49 A;  4JYT A;  1BHX B;  1KSN A;  1F0T A;  1LO6 A;  4ACA A;  3AAS A;  1SGT A;  3RXB A;  1EJA A;  4B1T A;  1FIZ A;  1GJ8 B;  3S9B A;  2Z9L A;  3F9E A;  3S0N A;  3ZV9 A;  5KEC A;  1FQ3 A;  2NU1 E;  1S0Q A;  2SGF E;  3GCN A;  2J38 A;  4ABE A;  1ZGI A;  1Y5B T;  1YM0 A;  2TIO A;  1D6R A;  1NRN H;  1ZPC A;  2K0Q A;  2OC0 A;  1G30 B;  2RFK C;  5EW2 H;  1NZQ H;  3HK6 B;  3L33 A;  2EA3 A;  2Z3D A;  2B8O H;  1F5K U;  1CT4 E;  1XVM A;  3RP2 A;  4B2C A;  1TPS A;  1ZTJ A;  3ZVF A;  2AIQ A;  2Y81 A;  1ZPZ A;  1W3C A;  3TIT A;  1EZQ A;  5DP4 A;  1FY8 E;  5L2Y H;  4INH A;  2FOE A;  1O3I A;  3F3B A;  3FN8 A;  1ELG A;  1WUN H;  1DUA A;  1KXF A;  2PSY A;  5EW1 H;  2FIR H;  4NIV A;  1CO7 E;  1BHX F;  2WPH S;  3GY4 A;  4JZF H;  4X6O A;  4F48 B;  5I25 A;  1N6Y A;  4JCN A;  1Z8G A;  2ALP A;  3KCG H;  4X8S H;  1AQ7 A;  2VJ1 A;  5BRR E;  4B2A A;  1E1Q D;  1FY5 A;  3BIU H;  3HPT B;  4JK6 A;  1V2L T;  3A8D A;  1ELT A;  3A7T A;  2GGV B;  1G2L A;  2ZGH A;  5DP9 A;  1C2L A;  2BDH A;  2ANY A;  1HAZ B;  1C9P A;  3P8G A;  2OQU A;  1GHB G;  1DY8 A;  1UTQ A;  3RMM H;  3SUD A;  3A87 A;  1JRS A;  2CHA C;  5ABW A;  1HNE E;  1GI3 A;  2DUC A;  3BN9 A;  4Y11 E;  2F4L A;  5HM9 A;  2HNT E;  2W5E A;  1RTF B;  2G4U A;  2BDB A;  2OK5 A;  1TIO A;  1E35 B;  1CSO E;  2CF9 H;  4X1S U;  4ZH8 A;  3SI4 H;  4CRD A;  2FI5 E;  5FBI A;  1A0L A;  2IPQ X;  2BVS H;  1KXC A;  3STI A;  2CXV A;  1NO9 H;  1GI1 A;  4Q7Y A;  1W13 U;  1AFQ B;  2UUY A;  3GCH B;  2WV9 A;  2F9P A;  1KTS B;  2GMT C;  2G81 E;  1ESB A;  1BML A;  3RC4 A;  2JIZ D;  3QLP H;  3E91 A;  4ABB A;  1YYY 1;  1SGQ E;  4TWY A;  1VKY A;  1A5G H;  1TRN A;  2KCA A;  1GBF A;  1O3J A;  1Y3U A;  4I7Y H;  2PV9 B;  2ZO3 H;  1HUT H;  1C1T A;  1ZZZ A;  5EPN A;  4B74 A;  1SSX A;  4SGB E;  4MNX A;  4B71 A;  1ELA A;  3QGJ A;  2BY5 X;  3HKI B;  1W7X H;  2VWN A;  2AMQ A;  3RXP A;  1BBR E;  1GHW H;  1HAH H;  4XBD A;  1YC0 A;  2OC1 A;  4B2B A;  5SGA E;  2G8T A;  3BEF B;  4JZE H;  5C5N A;  5CE1 A;  1OWI A;  3VFE A;  5E0J A;  1SL3 A;  4HI3 A;  2FZZ A;  2G00 A;  2GP9 B;  4X1P U;  4ABI A;  4GVU A;  1G36 A;  1PYT D;  1EZU C;  1QY6 A;  1ETS H;  2KCO A;  2UUK B;  3KQB A;  1IQI A;  2WZQ A;  1TAL A;  4J1Y A;  4K3J A;  4ASU D;  2AGE X;  1SGI B;  1BRU P;  1MMJ N;  3KEE A;  2C93 B;  2FI4 E;  3UNQ A;  1HLT H;  1P3C A;  5CMX H;  1ZJK A;  3M35 A;  1P9S A;  1V2J T;  1RFN A;  3ZYE A;  3M3S A;  4FU9 A;  2XCN A;  4H6T A;  2UWO A;  4EST E;  3UNS A;  2G55 A;  1HAG E;  3KF2 A;  1SLW B;  5AFZ H;  4Q2K A;  2IJD 1;  1CT2 E;  1U6Q A;  2CJI A;  2QAA A;  3E6P H;  3KNX A;  3DT0 H;  2P8O C;  2YNA A;  4R8T B;  1HJA C;  3GYL B;  2JET C;  1MU6 B;  1GL1 A;  1SGY E;  1TB6 H;  3ZV8 A;  4A6L A;  2EY4 C;  3A89 A;  4P00 A;  5EXM A;  2H5D A;  3BV9 B;  1O3H A;  1GMC G;  1GBD A;  1IOE A;  1BJU A;  1GBJ A;  4KEL A;  1FMG A;  4B76 A;  1NU9 A;  1X7A C;  2GMT B;  3SU2 A;  2V3H H;  1T8M A;  2RDE A;  5JBT A;  3UAI C;  2P95 A;  2ZHW H;  5FXL A;  2F91 A;  4Y0Y E;  1K22 H;  2ZGJ A;  3I77 A;  3GDV A;  5TJX A;  2LPR A;  1ZHR A;  4NZL A;  2Y5G A;  1TPP A;  5F03 A;  2OXS A;  4RI0 A;  2ANW A;  4Y7B A;  3ZZB A;  1O2L A;  3OFN D;  1LQD B;  4K1E A;  1TBZ H;  2BY7 X;  1V2O T;  1D9I A;  3V7T A;  2YMS D;  4GPG A;  1KXE A;  1DST A;  2FDA A;  3Q3K A;  2A5K A;  1TBQ H;  3FAO A;  4BNR A;  2WV5 A;  5EGM A;  4TT3 D;  3A81 A;  5T3H A;  4NSY A;  4U01 A;  3U1I B;  3SND A;  1BRB E;  2G5V A;  1GCT B;  2BY8 X;  2VIW A;  5ESB A;  1EB2 A;  1K1P A;  5C0T A;  3TLO A;  3STJ A;  4GCH F;  2YMS C;  1TNG A;  4K8Y A;  1VJ9 U;  1S6F A;  3OTJ E;  2O9Q A;  4NWK A;  4RKO B;  3VEQ B;  1BDA A;  3LGY A;  2Z9K A;  1INC A;  2VVU A;  3AAV A;  2F9B H;  1P2M A;  1H4W A;  1IQK A;  1L0Z A;  4U30 A;  3OE7 D;  1GMC F;  4AOR A;  1P2Q A;  5AVD A;  1NFU A;  1C4U 2;  4YZU A;  2C8X B;  4B6E A;  2ZI2 H;  3TH3 H;  2VID A;  2VWM A;  1PQ7 A;  3KN2 A;  2FM2 A;  2STB E;  5EU8 A;  3P17 H;  1S82 A;  2PKS C;  1BB0 B;  4Y76 A;  1Y59 T;  4IC6 A;  1F5L A;  2QGR A;  1HDT H;  3UOU A;  1GHA G;  3MH4 A;  3LC5 A;  5EIY A;  3KID U;  1FN6 A;  5EQS A;  1HAY B;  2J34 A;  3SGA E;  1O2U A;  2SGP E;  1L1N A;  1GDU A;  4H42 U;  1EAS A;  3M7U A;  4A1T A;  3VGC B;  1C2F A;  1O3D A;  1QL8 A;  4NA9 H;  2ZU1 A;  3MO9 A;  1GBM A;  3SU5 A;  1H9H E;  1QB9 A;  2F3C E;  1TON A;  1K1O A;  1THP B;  2C3S A;  1VIT F;  3VB5 A;  1RTL A;  1AE8 H;  1P2O A;  2ZNK H;  1V2R T;  2AMP A;  4XFQ A;  4FUB A;  5DP6 A;  4FVD A;  3BF6 H;  3HGP A;  2ZHD A;  2FYR A;  2R3Y A;  1GGD B;  3LIW A;  2W6I D;  4BAM B;  1MTN B;  1THR H;  4BOH A;  3FVF B;  2GZ8 A;  1UTJ A;  4ZXX H;  2VIP A;  5IDK A;  1IQG A;  1ABJ H;  2SGD E;  1DE7 H;  1O3B A;  1MAY A;  2XBW A;  1OWE A;  4Y8Y A;  2WSS D;  4X2W A;  3UIR A;  5EXL A;  4Q80 A;  4NSV A;  1LHF H;  4KKD A;  2CHA B;  2P94 A;  1MBQ A;  2WYJ A;  4M7G A;  4CRB A;  5EQQ A;  3PTB A;  1GJ7 B;  3EYD A;  1O2P A;  1XKB C;  2WPJ S;  3G01 A;  1O5E H;  3LGI A;  1K0H A;  4FET A;  1OHH D;  3BTQ E;  1GMD F;  1J14 A;  1SHH B;  4LZ1 H;  3RXI A;  1O2Z A;  1EPT C;  3RXT A;  1FN8 A;  1UVO A;  1HJ8 A;  3O8D A;  4X1Q U;  3PWB A;  1P2I A;  3P70 B;  3O8B A;  1TAW A;  1W0K D;  4DGJ A;  1DX5 M;  3SUG A;  1F92 A;  5KED A;  1ETR H;  2ZEC A;  4DW2 U;  1WV7 H;  3QZQ A;  3RXG A;  1JIR A;  3QWC H;  4BXS A;  1P8V C;  4DUR A;  8GCH F;  1BUI A;  1AKS B;  1QA7 A;  3F68 H;  1MCT A;  4GAW A;  1LVO A;  2BTC E;  3TPI Z;  2FTL E;  1OWJ A;  4RN6 A;  2JKH A;  1C4Y 2;  4IBL H;  4MVN A;  5LPE A;  1Y3Y A;  2QY0 B;  3A8B A;  3ATW A;  3H09 A;  4XSK U;  4YO9 A;  4GHQ A;  4D9Q A;  1TNI A;  1OWK A;  2ZKS A;  4AYV B;  2ZC9 H;  2JJ1 D;  2P16 A;  2ZFS A;  1HJ9 A;  1AIX H;  1SHY A;  3JZ1 B;  3ENS B;  3HK3 B;  3UWI A;  1AVW A;  4K2Y A;  1G2M A;  1A4W H;  3SU6 A;  1TE0 A;  2TPI Z;  2FO9 A;  1V2V T;  1THS H;  3NRL A;  2AER H;  6EST A;  3GY7 A;  3S7K B;  7GCH F;  1AKS A;  1GHA F;  5FCK A;  2RCE A;  2KAI A;  3Q76 A;  4I33 A;  1G32 B;  1YGC H;  2GDD A;  2R0L A;  3E1X B;  4NIY A;  3E16 B;  2CF8 H;  4J2Y B;  1O2J A;  3ZZ8 A;  1WSS H;  3PLB A;  8EST E;  1O3G A;  4BAK B;  1QZ8 A;  1C1R A;  2YMS B;  3FAN A;  2D8W A;  1GVZ A;  4BAN B;  2XND D;  1GHY H;  3MI4 A;  5JB9 S;  4AZ2 B;  1V2S T;  1HJA B;  2BQ6 B;  3SO3 A;  2QE7 D;  4Q4L A;  4CRA A;  1GBT A;  1PQ8 A;  3GCO A;  2ILN A;  3A83 A;  1A0J A;  2Z9G A;  2RDL A;  1XUF A;  1RIW C;  2F9V A;  1PYT C;  1GI2 A;  1UK2 A;  2IJO B;  2XC0 A;  1C2H A;  2GZ7 A;  2JH5 D;  4CRC A;  2D1J A;  3LJO A;  1SBW A;  1TOM H;  2GVF A;  2BD2 A;  4WF8 A;  1P12 E;  1IQN A;  3BTK E;  1CHO G;  3A88 A;  3A7W A;  3LOX A;  2P3T B;  3QN7 A;  3SBK A;  1H8I H;  3C1K A;  3LPR A;  4FUE A;  2ZTZ A;  2BVX H;  4HFP B;  3D23 A;  3SV9 A;  1D6W A;  5C20 A;  1BTU A;  2ZDM A;  1JRT A;  1BOQ A;  1K1N A;  3CEN A;  1OP2 A;  1GBL A;  1AGJ A;  2W26 A;  1CA8 B;  1J17 T;  3N99 A;  2ZZU H;  4LZ4 B;  1ZR0 A;  3RXV A;  3VPK A;  1FX0 B;  3TJV A;  5JPM H;  1CE5 A;  1TOC B;  4XD7 D;  1NT1 A;  1TNK A;  3Q00 A;  4DY7 B;  1K9O E;  4XE4 A;  1AUJ A;  1XVO A;  1MZA A;  1P57 B;  1ANE A;  1C5N H;  1J9C H;  1A3B H;  3EGK H;  4A5T S;  4FUF A;  3UQV A;  1ZTL A;  5A09 A;  3FKS D;  3SJK A;  1A0H B;  1E34 B;  1AB9 C;  5E0H A;  1SLU B;  1YKT A;  3BIV H;  3OY5 U;  4TY7 A;  1IHS H;  2CK3 D;  1P2J A;  2A7H A;  3RU4 E;  2FS8 A;  4ISL A;  3FO8 D;  1W14 U;  1N8O C;  1ZJD A;  2H9H A;  2BLV A;  1SQT A;  3HAT H;  1FY4 A;  1S83 A;  2HLC A;  1IQE A;  1JXP A;  2J95 A;  1RJX B;  2BZ6 H;  3PMJ A;  5FX6 A;  1GVL A;  2W7U A;  3MU8 A;  4MPV A;  5C1X A;  4K1T A;  1GHZ A;  1FON A;  2ZHQ H;  4ISI H;  1KDQ B;  2C8Z B;  4FUC A;  4MNY A;  4ABA A;  1C1O A;  3M36 A;  3TIU A;  2PTC E;  3DUX H;  5FCR A;  1KXD A;  4RSP A;  2XC5 A;  2P3F H;  1KLT A;  1GBB A;  3LGV A;  1GBH A;  1NS3 A;  2QF5 A;  1YCP H;  2BHG A;  2GCT B;  3K2U A;  1IQL A;  5DK1 A;  2R9P A;  3GY8 A;  2PWX A;  1SR5 C;  3D62 A;  2PGQ B;  3WWF A;  2J98 A;  3DSP A;  2VVC A;  3U9A H;  4O3T A;  3CS0 A;  2AHM E;  1ZHM A;  3UY9 A;  4Y8X A;  1C1W H;  5FAH A;  3ODF A;  3ODD A;  1UTL M;  2ZCH P;  1E37 B;  4AYY B;  2BB4 A;  3SV6 A;  1OYT H;  1UCY K;  4UFD H;  3BTF E;  3BEI B; 
#chains in the Genus database with same CATH homology
 4ASU D;  3SUG A;  4A1X A;  4JMY A;  2M2A A;  3F3B A;  3KEE A;  3FN8 A;  3PV2 A;  3F2F A;  3P8O A;  1CU1 A;  3M5M A;  2A4G A;  3N99 A;  4ZCN A;  3F2H A;  3OEH D;  3DCL A;  4F55 A;  2JJ2 D;  3OE7 D;  3U1J B;  1FX0 B;  4I31 A;  5CHB A;  3SV7 A;  1N1L A;  3PV5 A;  5H4I B;  3LKW A;  4B6E A;  4XD7 D;  4WH8 A;  3KN2 A;  2XCN A;  2FM2 A;  1SKY E;  1E1Q D;  3M5N A;  3SU1 A;  2KR7 A;  5FL7 D;  3RC5 A;  3SU4 A;  3M5O A;  2GGV B;  3KF2 A;  4TYD A;  5FPT A;  3F0O A;  4KTC A;  5EQS A;  2IJD 1;  4A1V A;  3FKS D;  3KNX A;  1NBM E;  2QV1 A;  3H09 A;  4YXW D;  5DN6 D;  2XNI A;  2OC8 A;  3O8C A;  5GPI B;  1DY8 A;  2A4R A;  4OM9 A;  3SUD A;  4R8T B;  4A1T A;  5IK2 D;  2CK3 D;  2JJ1 D;  1DXP A;  3DSO A;  2F4L A;  2HLD D;  3FO8 D;  3GS9 A;  5ETX A;  3F2G A;  3SUF A;  3SU5 A;  3O8R A;  2OK5 A;  1E79 D;  3LON A;  2V7Q D;  4Q63 A;  2KFW A;  2XCF A;  4WH6 A;  3SU6 A;  3SV8 A;  1DY9 A;  3ZIA D;  5C17 A;  3SZE A;  4B76 A;  1RTL A;  5FPS A;  3SU2 A;  3W1E A;  3OYP A;  2L6O A;  2WPD D;  1JXP A;  3M5L A;  5DSF A;  2OIN A;  3AK5 A;  4A92 A;  2KM0 A;  3NRL A;  4K8B A;  2KCY A;  2WHX A;  2W6I D;  4B73 A;  2J5U A;  2VBC A;  4I33 A;  4B75 A;  5F53 A;  5CDF E;  2WV9 A;  3N7D A;  2JDI D;  2LEL A;  3L6P A;  1WXR A;  4RI0 A;  1DXW A;  2K8I A;  2XOK D;  2YOL A;  5IDK A;  2KCP A;  2JIZ D;  3RC4 A;  1W0J D;  3E90 B;  3OFN D;  1COW D;  5C0U A;  2YMS B;  1H8H D;  2OBQ A;  5T1V A;  3SU3 A;  2WSS D;  2YMS D;  4I32 A;  5EQR A;  2XND D;  2O8M A;  1KMH B;  3FOA A;  2KCA A;  3OTP A;  5EPY A;  1NS3 A;  2KZ4 A;  2QF5 A;  2QF4 A;  5FPY A;  3SU0 A;  2W6J D;  2F43 B;  2QE7 D;  4Q4L A;  3SYJ A;  3P8N A;  5EPN A;  4B74 A;  2OBO A;  5EQQ A;  2FP7 B;  2A4Q A;  3OEE D;  3UB0 A;  3N7E A;  3VG8 A;  3EYD A;  3WWF A;  4TT3 D;  4B71 A;  5B6L A;  2F9V A;  2OC7 A;  4DT4 A;  2F9U A;  3DSP A;  4TSF D;  2IJO B;  4FET A;  1OHH D;  4U01 A;  3U1I B;  3OAA D;  4M9F A;  2OC1 A;  3PRD A;  2K0Q A;  2GVF A;  2OC0 A;  2FOM B;  1BMF D;  1EFR D;  1S6L A;  2AHM E;  4B6F A;  5ESB A;  4WF8 A;  3WWB A;  3PRB A;  5GND A;  3LOX A;  1E1R D;  5C0T A;  1A1R A;  1NBM D;  3WW7 A;  2P59 A;  2YMS C;  2KCO A;  3O8D A;  5GJ4 B;  3SUE A;  1H8E D;  3SV9 A;  4NWL A;  1RGQ A;  3SV6 A;  2WZQ A;  3RC6 A;  1BT7 A;  4Z1M D;  1W3C A;  4NWK A;  1MAB B;  2K1Q A;  3O8B A;  1W0K D;  3F0P A;  5HKK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...