2KCAA

Gp16
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
109
structure length
109
Chain Sequence
b'MYEEFRDVITFQSYVEQSNGEGGKTYKWVDEFTAAAHVQPISQEEYYKAQQLQTPIGYNIYTPYDDRIDKKMRVIYRGKIVTFIGDPVDLSGLQEITRIKGKEDGAYVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriophage SPP1 complete nucleotide sequence
publication title Structure of bacteriophage SPP1 head-to-tail connection reveals mechanism for viral DNA gating.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
total genus 14
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05521 Phage_H_T_join Phage head-tail joining protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.270 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2kcaA00
2KCAA 2KZ4A
chains in the Genus database with same CATH superfamily
5AFYH 2A2QH 1S81A 1OWJA 2CK3D 1XXFA 2ANYA 1LKAA 3S7HB 4K60A 1GL1A 1HAPH 1AKSA 1C2IA 4RKOB 1GI0A 2KR7A 1GJ7B 1SG8B 4AG2A 1L4ZA 1MMJN 3A80A 3T25A 3KQEA 1V2UT 2GMTB 1ZLRA 1L1NA 2WPIS 2HLDD 5EW2H 2OC1A 3CENA 3GDVA 2ANMH 3RXFA 3OY6U 1CO7E 3SW2B 2ODQA 1GJ9B 2J4IA 2VIPA 1NZQH 2ZFTA 1C1MA 1GHXH 1O5CB 2R2WU 1QJ7B 3SU1A 2H9EH 1GDQA 3PWBA 3A7VA 4FUCA 2PW8H 5E2OA 1AO5A 3LGIA 1HB0B 1DWEH 3BG8A 1FZZA 4IS5A 1NO9H 5GIBA 1O3PB 3MH5A 5JBCS 2FZZA 1GJBB 1MKXH 4NIVA 1IOEA 3F68H 4IMQA 1G36A 1SLVB 2XW9A 3ZZ9A 1GBBA 2ANKH 4BNRA 4X1RU 3TNSA 4B1TA 1NFYA 1O3KA 2J34A 1C5ZB 3ATWA 5SGAE 2VWNA 1P9SA 5HIYA 4K2YA 4MVNA 4JYUH 5GDSH 1E1RD 1SC8U 1PYTD 2Y5FA 1QR3E 5EU8A 2PFEA 5B6LA 1ELAA 5F6MA 3OU0A 1OWIA 2ZDMA 1Y8TA 3RU4T 1BTWA 2KCYA 3FANA 2JIZD 1KLJH 4R0IA 1FI8A 1YF4A 4UFEH 2HOBA 3E0PB 1AWHB 1RTKA 1UW7A 5JYIA 2FODA 3HK6B 3BIVH 4NA9H 5T6GA 3MFJA 4I8LA 4WMDA 5G4BA 1TRYA 5EJZA 1YLDA 2GMTC 2HLCA 3SNEA 3T29A 1W0YH 1ELBA 1K1OA 3ZZCA 3TH2H 1UHBB 5C5OA 1UVPA 2WPKS 3ENSB 3A7WA 1SPJA 2JJ2D 1K21H 4JZDH 5DGJA 2Z3EA 1OKXA 2R9PA 2GV7A 1SVPA 5C0TA 2B0FA 4TT3D 1PJPA 4ABBA 2HWLB 2ZG0H 4NIYA 2ZGJA 2W7SA 1LVYA 1V2KT 4NIXA 2AYWA 2R3YA 3VPKA 2CJIA 3ZVEA 1PPFE 3P70B 1OWKA 2OD3B 9LPRA 3A7YA 2BLQA 4Q63A 3VG8A 4MPXA 4MLFB 4JZEH 2O8TA 1SKYE 2ZFSA 3RMNH 2H5DA 1J17T 2AIPA 2ZHQH 1BRBE 4TYDA 2HALA 2EI6A 2ZHWH 3CP7A 1RRKA 3UWIA 1GMCG 1NFWA 1E36B 1W8BH 1MBQA 3OTJE 2KM0A 4BXSA 5E2PA 2Z9IA 3RXMA 1W7XH 2WYJA 2ZU3A 3KYFA 5HYOA 1C4V2 4A1TA 3C1KA 1BCUH 5IDKA 1KIGH 1SHHB 4BTIB 1J9CH 4ZXXH 4BOHA 1O5AB 1FAXA 4WY3A 3M5OA 4NGAH 1W12U 4ABJA 1KTSB 1O3FA 1Z6JH 1S6FA 4IC6A 1KTTB 2AIQA 4NWKA 1ANDA 4HI3A 5L2YH 2H2ZA 1GI3A 3KQDA 2G5NA 4WMFA 4IBLH 1AHTH 1LQEA 3RM2H 2P94A 2YMSB 1DOJA 1NU7B 1GHAG 4FVDA 2UUFB 3I78A 1A3BH 1SGNE 1GDNA 1N6XA 2R0LA 4F55A 4DVAU 3NUMA 1CQQA 1WBGB 3DSGA 3L3TA 2VH0A 4CRBA 4FU7A 1TMUH 2QXJA 3ZZ4A 3OAAD 3AK5A 2Q6FA 3RXQA 3RXCA 1TMTH 5HXFA 4B6EA 3SU2A 1NT1A 3HPTB 3RXGA 1HAGE 1AUTC 1ETTH 5LPRA 4I8JA 4X2VA 3H7OA 1K1JA 1GHVH 3B9FH 5TJXA 1K22H 5B6OA 1W13U 2BHGA 2WUCA 4A5TS 2D26C 3MHWU 1F0TA 1NFXA 3NRLA 5C94A 1XUFA 1EPTB 5EODA 2BDBA 1ABJH 5A0AE 3LKWA 1ZMJA 5K7RA 1G3DA 2FS8A 3A81A 3UNSA 4XSKU 5BPEA 3RU4E 3KNXA 2OC7A 5F8TA 1W11U 3TK5A 4AG1A 2DE9A 3TU7H 2ZDLA 4AX9H 2KAIB 1MU6B 1QRWA 4YO9A 1Z71A 1JRSA 1JWTA 1VITH 2HNTE 4O9VA 1BITA 3KCGH 3RC5A 3U8TH 1C4U2 3VXFH 2QN5T 1KXCA 1YYY1 4RI0A 3SJIA 1WSSH 4Q2KA 2UWPA 2V35A 1O35A 1NRQH 1O3DA 1KXDA 1OWDA 4A1XA 3TJUA 1AY6H 3PTBA 3UWJH 1TX8A 4B76A 3STJA 2TRMA 4AC9A 1SGTA 5CHBA 5I25A 1EKBB 1MTWA 2ANWA 1EZUC 1HLTH 1GCTB 2I6QA 5A0CA 4YOIA 2FTLE 1P0SH 4WWYA 4DW2U 2YMSC 4ZCNA 1AE5A 3DD2H 5JDUB 3BIUH 2F4LA 2HGTH 4IN1A 1Y5UT 1WXRA 2BDGA 4INHA 4FUHA 1E35B 1TNGA 2CV3A 3HK3B 2AEIH 3S9AA 1D4PB 2LP6A 3QUMP 3MH4A 1BBRH 1MBMA 4XD7D 3TH4H 2GDEH 1CT4E 1EOLA 5A0BA 2ZU1A 2GTBA 4MQAA 4AYVB 3UUZA 1C5LH 3BEFB 2KCPA 2XCFA 1LKBA 1CA8B 2A45B 4WH6A 1QBOA 1SGDE 2ZU4A 5EXNA 2VINA 1TBQH 1LHEH 4E05H 2G00A 1O3IA 2SGAA 4B2AA 5LH8A 3SUFA 5DJ7A 2GCHG 5AFZH 2WINI 2O8UA 4CRFA 1EAIA 5DP9A 1HRTH 4KTCA 3AVZA 4BAMB 1RFNA 1CGIE 6ESTA 2QV1A 4Y7BA 5E0JA 5FX6A 3ZYDA 2G5VA 3ZZBA 3ZV9A 1UTNA 3BTKE 1EPTC 1EAWA 5FCRA 3KF2A 1BRUP 1KXFA 4X8TH 2ZNKH 5EQRA 1A0HB 4P02A 3K65B 3RXPA 4BTTB 1GPZA 1AGJA 2FDAA 3W1EA 1IQHA 3OEHD 5AHGH 3EYDA 1MTVA 1H4WA 1GBCA 4FETA 5GXPA 2SGQE 2FYQA 1PQ7A 5DG6A 4Z1MD 1SGEE 2J97A 1EOJA 1SGYE 1XUHA 1O2VA 1TBZH 2F9BH 1WUNH 2RDLA 1ANCA 8GCHF 5JB8S 1GHBG 2WPJS 4GAWA 1GJAB 1HBTH 4UE7H 4PROA 4I8KA 3UR6A 4YLUA 2D8WA 1XVOA 3KL6A 1O3NA 4RKJB 4Y7AA 5EXMA 3TIUA 1GCTC 3DT0H 3TGIE 3EGKH 1F5KU 3P8NA 2GP9B 1G37A 2I6SA 2XBWA 1UMAH 1ZJKA 2VIQA 1DM4B 1XUGA 2VWOA 2AS9A 3ZZAA 5F8XA 3ZVCA 3SNBA 1YPHE 3RXEA 4FUEA 4FUIA 5A2MH 2IJOB 2QE7D 4UFDH 3U28C 3UOPA 1Z6EA 3ZZ3A 2XCNA 3GY7A 1K1IA 3D65E 3FN8A 4I33A 1Q3XA 2XTTB 2WPDD 1QCPA 1LCYA 3LH1A 4ABFA 1QGFA 2RA0A 1HNEE 4J2YB 3K2UA 3UNQA 1G3CA 2Q6GA 3OFND 4WF8A 2Z9JA 3SHCH 3GY4A 2Y80A 3SORA 3MWIU 4FUDA 4TSFD 1K28D 2IPHA 1QURH 1GHWH 3ZV8A 1MU8B 2GX4A 5T6DA 3VB4A 5FX5A 3MH6A 2NU1E 4OGXA 4DIIH 3GDSA 2A4RA 1FXYA 1HXFH 3BN9A 3N7OA 3RLWH 1O2HA 2SNWA 2BVXH 2Q1JA 3M5LA 2WHXA 4CH8B 1P2OA 1NROH 5TCCA 1C1SA 4UFFH 1CE5A 1Y3XA 4YT6H 1TNJA 1GBHA 3BTDE 2W3KA 4M9FA 1NBMD 2G4TA 2ZPSA 4LK4A 1IQJA 4FOUC 4X1SU 3KQCA 1BOQA 1C2GA 3V12A 2AGGX 2QF4A 3K6YA 3DHKH 3Q77A 1O2WA 3RUOA 1VJAU 4O03A 1D6RA 2FOMB 4AGKA 2ZFFH 4XRNA 2TGTA 1YCPH 2ZECA 3RXVA 4Y71A 1XKBC 1CGHA 3PV2A 1FN6A 3MU5A 1VCWA 1E0FD 3MQKC 1VGCB 1WU1A 1BTPA 4MNYA 4ESTE 5T6FA 1EB1H 2Y5HA 1GBLA 1C2MA 2O8MA 5GCHF 2ZCKP 1ZJDA 1S82A 2YNAA 3U9AH 1EZQA 3V3MA 4ACBA 4AFZA 4D76A 5DN6D 1HIAB 1ESBA 5A09A 2GGVB 4JK5A 3SGAE 2UUYA 1BA8B 3P8FA 3SYJA 5C0UA 4K8BA 3E91A 1ELEE 1V2OT 2LELA 1XUJA 2ZGBH 2BOHB 1XXDA 4UD9H 3DA9B 1JMOH 4F49A 1O3OA 3RXOA 1V2MT 3M7QA 3LGYA 3LGWA 1OP2A 1E38B 3ATLA 2VBCA 4CBNA 3PB1E 1PPEE 2A5IA 2Y7XA 1W10U 1OPHB 1VZQH 1BT7A 5C67A 4X6MA 5L2ZH 3P95A 3E16B 1GHYH 4FUGA 3RXAA 3PMHB 4ZHLU 1NS3A 3VGCB 1HAHH 5J4QA 1MCVA 3ITIA 1TGNA 5A8YA 2Z6BD 3F3BA 2QF5A 3BTHE 3SQEE 1OWEA 1F5LA 1A5HA 2FI3E 1QRXA 2FP7B 1QBNA 3M5MA 8KME2 1TGTA 2DE8A 3CS0A 1GDUA 3A7XA 5J4SA 3EDXB 4DCDA 2QF0A 2HVYB 2ALPA 1SMFE 1V2VT 4GSOA 3MTYA 3M3TA 1O39A 1RS0A 1GJ8B 4TWWA 3PMAB 2WV4A 2W5EA 4JYVH 2AMQA 1YPJH 1TNIA 4B71A 4INLA 4UONA 3NCLA 1VGCC 4O3UA 4NZQA 1C2EA 3BTTE 3TGKE 2ZDVH 1O3LA 2XC0A 4ASUD 2RCEA 1FAKH 3NXPA 1PPBH 1GI9B 2KZ4A 2PSYA 1IQMA 1YC0A 4YOGA 5FAHA 1IQFA 5EQQA 3W94A 1C2LA 4Y0YE 1UVSH 1L1JA 1VCPA 3W95A 5ETXA 1S83A 2GD4B 4I31A 4X6PA 3MU8A 4OS4A 4DG4A 1QRZA 3BSQA 4K1TA 3Q00A 1GGDB 2FOEA 3A86A 2K0QA 3MO3A 1V2NT 2VJ1A 4OS2A 1V2LT 3EA7A 1ZR0A 2WPLS 3SJ9A 2BY8X 2KCOA 2FLRH 3FFGA 1INCA 1LHDH 1ZHPA 2G81E 5HM2A 5L6NH 1O5EH 3O8CA 1MCTA 1F0SA 1ZZZA 4KELA 3D49H 1D3PB 3VGCC 1QZ8A 1O3CA 3M3VA 1LTOA 1F0UA 4WH8A 4AN7A 1NESE 1FY1A 4YZUA 3SZNA 3UFAA 2K1QA 1UJ1A 3UNRA 1FY8E 1V2TT 3HGPA 3LDXH 1NRRH 1O2MA 4MPUA 1RGQA 3FVFB 2STAE 1TMBH 2H6MA 2A5KA 2UUKB 3L6PA 2HRVA 4F48B 1O31A 3BG4B 1QNJA 1TIOA 3FAOA 2OLGA 4K8YA 8LPRA 5DK1A 1O3JA 1EQ9A 4Y79A 3SUDA 3RXBA 1ZHMA 2FX6A 3URCA 1TRMA 2ZO3H 1TFXA 1FIWA 3E1XB 3DSPA 1DT2A 1O2RA 4X8UH 2ZQ1A 4D9RA 3K9XB 1SGQE 1AKSB 1QFKH 1UTKA 1LPZB 1LPGB 1MTUA 4ZKOU 2OBOA 1ELDE 1IQEA 2WYGA 2P3FH 1IQLA 1QBVH 3B8JA 4A1VA 2BDIA 1C2HA 4ABAA 4YOJA 5GPIB 4LZ4B 2WV9A 1TOCB 1GBTA 3UPEA 3UB0A 3LH3A 1ELCA 4X1PU 3VB3A 4OS7A 1P05A 1O3HA 1OYQA 3DSOA 2BOKA 1IHSH 2WPHS 1NTPA 1CHOF 2BX4A 2IOTA 4SGBE 3LONA 1S85A 2OBQA 3ELAH 2BD7A 3SJKA 2Y6TA 3LJOA 3ZZ6A 2SNVA 1GGDC 1GJ6A 1C4Y2 1GI6A 1SBWA 4IC5A 3BTGE 5A8ZA 3RXDA 2FEQH 1P01A 4ABDA 2W6JD 4MNWA 3F9GA 4FU9A 7GCHF 2PTCE 3HGNA 1QL9A 2XXLA 1GBJA 1ZTLA 3BTME 1OOKB 1O2KA 1S6LA 1YPMH 4AB9A 2SGFE 3WWFA 1JBUH 1HCGA 1C1VH 1P3EA 5GNDA 3RXJA 1TNKA 1O2UA 1V2JT 1TYNA 3WY8A 5C17A 4DT7B 2BZ6H 2VIDA 8ESTE 2WV5A 2CHAB 4X6OA 3SNDA 2F83A 4GVUA 4UDWH 1O2XA 1TGSZ 3BG4C 3OE7D 2KFWA 5C1XA 1UCYH 1C1UH 2A1DB 2V6NA 1C1PA 4ZHAA 2BD8A 2JH6D 3GICB 1P02A 2GZ8A 3ZZDA 3SJ8A 2BDAA 3M3SA 2BD4A 1ORFA 3F9HA 1DWBH 1O3AA 3KEEA 3RU4D 1GBMA 2YMSD 4YXWD 4GLYA 2ZHEH 1WCZA 4K1EA 3CS7A 3I77A 1QA0A 3N7EA 1T8MA 2G4UA 4B2CA 1E34B 3KYGA 1C1NA 3M61U 2ZFPH 5DP3A 5F8ZA 1SGIB 1AZ8A 4BXWA 5HIZA 4AFSA 4ZHMU 2BB4A 1BBRK 1W3CA 2NWNA 3ESTA 3P92A 3SQHE 1SLUB 1TPPA 1DWCH 3F9EA 2ZTZA 5FCKA 2AGEX 2KX4A 1KLIH 3M7UA 1TPSA 4M7GA 2C4FH 1HAIH 1OHHD 3SGBE 1Z7KA 3BTEE 2BTCE 1C2DA 3QZQA 2W26A 1L4DA 1BUIA 2P95A 5HMAA 4D7GA 1FY5A 2FMJA 1C5XB 1P9UA 1HDTH 1QB9A 1FN8A 2BY9X 1LVOA 1O2TA 1DVAH 1W0KD 3MU0A 3TK9A 1GI1A 1GL0E 2C8XB 3OX7U 5GJ4B 5E0GA 2JJ1D 1NRPH 4H4FA 4BANB 1A5IA 1SQAA 2QIQA 1YLNA 1ARCA 1C5YB 3RXLA 1ELGA 1RTLA 3FP6E 2V3HH 1DITH 1SFQB 2BQ6B 2BDYA 2CHAC 4KKDA 1OS8A 2J94A 5HM9A 3AAUA 4ABGA 4NA8A 1LMWB 1HFDA 2ZGCA 3MNBA 1F2SE 1M9UA 4OS5A 5C3NA 2F43B 7KMEH 3U98H 1O2PA 1WTHD 1DSUA 4THNH 3RXTA 3F0PA 1KXAA 1Z8RA 3WW7A 2EY4C 1O3MA 1O38A 1SGFA 2A31A 3T2NA 2VNTA 3PV5A 1SHYA 1A3EH 5JB9S 1XM1A 3N99A 1BTYA 4B2BA 2C8WB 3TLOA 1O30A 4X8SH 3E90B 3H09A 2FOGA 1Y3WA 2Z3DA 1EZSC 2W6ID 1NY22 5FPTA 3RC4A 4DY7B 2A32A 5C2ZA 3UAIC 1Y3UA 1C5SA 1TALA 2ZU2A 3SUEA 4XBDA 2OC8A 4ZKNU 2C3SA 1UVTH 2B9LA 3KQ5A 1DANH 2GV6A 4RT0A 1ANBA 1ZSKA 3RP2A 2VB0A 3MYWA 2Z94A 5KGOA 2V7QD 3UR9A 1XX9A 2BMGB 1IHTH 1E79D 3GCTF 2BVRH 2IPQX 3A88A 1DXWA 2Z7FE 3EA8A 2B5TB 2GT7A 3VFEA 1Q31A 1KDQA 1O2GH 1C1RA 1GG6B 2SGDE 4Q80A 3SU5A 1P12E 1BIOA 1N6YA 2EC9H 3A8CA 4E7RG 1T31A 1OXGA 1DE7H 3FO8D 2DUCA 4DIHH 1QIXB 4OM9A 3UTUH 3G01A 1E37B 1V2WT 1SGRE 2XBXA 5FBIA 3ZZ8A 3TVJB 1O2JA 1S0QA 2M2AA 2PHBA 3GCOA 2PKAA 2H9TH 2AERH 1MZAA 1AE8H 1MD7A 2J9NA 3F2FA 1Y59T 5EPYA 5EQSA 4JZ1A 1BHXF 2ZGHA 2BM2A 3MO9A 2YOLA 1P8VC 2PR3A 3SU6A 1UTLM 3QTVH 1O37A 1QQ4A 5HKKD 1G2LA 2BXTH 1MUEB 1H9HE 8GCHG 4D8NA 1TONA 1TRNA 1K1PA 2VU8E 3Q3YA 1NPMA 3KN2A 1DLEA 1PFXC 1P3CA 2OINA 4Z0KA 1YCPK 3LU9B 3OSYA 3SO3A 3M37A 1XUIA 4CRCA 1UTMA 1PPGE 2QC2A 3BV9B 1JIMA 1P2JA 1Y5BT 2D2DA 1P11E 2CMYA 1EJMA 2GVFA 2ZCLP 1SLXB 1YLCA 3V0XA 4ACAA 3TNTA 2A7CA 1UTJA 4O3TA 4H42U 2BVSH 1YCPM 1GJCB 4WJG2 1V2ST 1HJ9A 3NWUA 1GI2A 4NWLA 1C5OH 1CBWB 1SFIA 3IG6B 4K69A 1Y5AT 3OEED 4NZLA 1BQYA 2A4QA 4P00A 3SNAA 3MI4A 2ZFQH 3NZIA 2L74A 2F3CE 3AW1A 4WXIA 3UQOA 1GG6C 3L33A 1FQ3A 4HFPB 1SGPE 3B23B 1KXBA 1HAYB 3F9FA 5ABWA 2FPZA 1D3DB 4MG3A 2QXHA 1AU8A 3T5FH 3MNXA 3TJVA 1P2QA 1ABIH 3PM3A 1H8ED 2OXSA 4IGDA 1FJSA 3F0OA 1K1NA 3M35A 3LC3A 3SJOA 5FXLA 4X2XA 1EATA 1F5RA 1SOZA 4K3JA 2UUJB 5JBAS 1VKYA 2BXUH 1AZZA 4DT4A 4YLQH 1DX5M 5DPAA 2WUBA 5C1YA 4Q7YA 1A61H 1YP9A 2A0QB 1ZRKA 2PGQB 4TY7A 1OWHA 1HJ8A 1A5GH 1DY9A 2BQ7B 4KP0A 1AVWA 1NM6A 2BX3A 5FPSA 1ZYOA 2F9VA 2D1JA 3GISB 1F92A 2R3UA 2UWLA 3UIRA 3KGPA 1BJUA 2BD3A 2GDDA 1GBDA 1MH0A 2PP6A 4XBBA 1KYNA 1HAOH 1ZPZA 4BTUB 3LPRA 1YPHC 1LO6A 1WV7H 4NFFA 3RXHA 1P2NA 3SZEA 1P06A 1GMHF 4CREA 3ZVDA 3A82A 3T27A 4X1QU 5KECA 2ULLA 5E8EH 2FI4E 1AD8H 5GCHG 1GMDF 1V2RT 3A8AA 4KGAA 3RXRA 3SV7A 1GI4A 1O2NA 1QJ6B 6GCHF 1BRCE 1DPOA 1THRH 3O8RA 5C1UA 1SB1H 1C5PA 2PWXA 3MNSA 3R0FA 5HGGA 3IWMA 1CBWC 1GI8B 1EJNA 1FONA 2ZFRH 3KHVA 1AMHA 1BBRE 5TCAA 5IK2D 2THFB 2PKSB 1GBIA 1MZDA 2CF9H 1UK2A 1ELTA 3QZRA 1GI7B 3T62A 2TGPZ 4Y8YA 4IW4E 1VCQA 1WAYB 3QGNB 3U1IB 1U6QA 1V2PT 1G3BA 1RXPA 2FTMA 3MNCA 2R2MB 3RXUA 2CF8H 2Y5GA 2J98A 4J1YA 4XE4A 2HNTF 1TX7A 1ZRBA 3M5NA 3MOCA 3C27B 1TE0A 1LHCH 2GCTB 4BAHB 2BY7X 1B5GH 3TGJE 1QJ1B 1J15A 3GY3A 1FPCH 4X1NU 4ISNA 3SNCA 1HAVA 4HZHA 2ZA5A 1MTSA 2LNCA 5T3HA 1ARBA 1FX0B 3O8DA 1QQUA 1E1QD 2P59A 4RN6A 1O33A 3M7TA 1L2EA 4ISHH 1LDTT 4NIWA 1ZGVA 3QGJA 1YGCH 4ABIA 1Y3YA 1W0JD 1A46H 3OY5U 3P17H 4ZXYH 2GZ9A 5DP7A 1JIRA 2FO9A 2IN2A 3U69H 1A0LA 1TPOA 4ZKSU 3ODDA 1Z8JB 3SV6A 3GY6A 3RLYH 1MTNB 4X2YA 1GBKA 2FESH 3P6ZB 4R8TB 1IQKA 2F9NA 2PGBB 4AYYB 1H9LB 3VB6A 3A7TA 1W7GH 4U2WA 1V2QT 2ILNA 5DP8A 2F9UA 4GCHF 1OP8A 2ZHDA 3DCLA 1TGCA 3PLKA 1GVZA 2ZDNA 5LGOA 1H8IH 1GVKB 3TK6A 4HGCA 2XBVA 2ZHFH 1H8HD 2ZEBA 5EG4A 2PV9B 1TX6A 6CHAB 2P3UB 2R0KA 1AB9B 4TY6A 1C2KA 5DP5A 1ID5H 2PKSC 2VIOA 4IMZA 3SU0A 5AF9H 5EPNA 1TQ7B 1RTFB 2CGAA 1TAWA 1CU1A 2L6OA 3JZ1B 3SGQE 3WWBA 5L30H 1HAXB 1PPCE 5AVDA 2JETB 2FYRA 3DUXH 4FUBA 4NCYA 2J92A 3U8RH 1IQGA 1KSNA 4Z6AH 4ABHA 1O3BA 3FKSD 3GYMA 3IITA 1QL8A 3BTWE 2A4OA 4UFGH 2ZF0H 1AUJA 1SGFG 2QXIA 1MQ5A 3UY9A 1SQRA 2XBYA 2ZKSA 4B75A 2G55A 2GCTC 1NC6A 1EXFA 1TBRH 4LZ1H 2VWLA 1DUEA 4NFEA 3Q3KA 2ZTYA 2TIOA 3H7TA 2XNIA 1JRTA 2KCAA 4JZFH 2HPQH 1ZMNA 5F03A 4KTUA 4U32A 1KLTA 1YPEH 4AGJA 5K0HA 2QYIA 4I7YH 1HXEH 5EW1H 1BTZA 1O2SA 2QAAA 4D9QA 1DDJA 1O2OA 1SI5H 4ISIH 4MDSA 1Q2WA 1T8LA 2AGIX 1BHXB 4AB8A 5LPEA 1O3GA 1C1TA 1ZSJA 5DKMA 1UCYK 1MKWH 1J16A 3FP7E 4H6TA 4INKA 1SLWB 1YBWA 3VXEH 5GWZA 4ISOA 1TA2A 1UHBA 3A83A 4Q4LA 1MTNC 2XWBI 3QO6A 1GJ4H 2ZDAH 4OS1A 2AFQB 4I8GA 3EE7A 1O2LA 1G30B 1L0ZA 4B73A 3Q76A 1K2I1 2H9HA 1DXPA 4Y11E 3LC5A 1OYTH 2FLBH 3UREA 2C8ZB 1W0ZU 1BMAA 1YM0A 1IQIA 1GBEA 1TOMH 2B7DH 1KXEA 4AZ2B 2QY0B 3PLBA 1S5SA 6CHAC 1AB9C 1D9IA 1EAUA 2VIWA 5CDFE 2JDID 1EUFA 4WMEA 3T26A 1CHOG 1UO6A 1VITG 4HG6A 3JZ2B 5DO4H 1P09A 4CBOA 1VR1H 2FS9A 1CHGA 2FOCA 1X7AC 1W14U 5EXLA 3TPIZ 1TA6A 3MO6A 4CR9A 2JETC 3SI4H 1DSTA 1WYKA 3QTOH 4RT1A 4F4OC 2P16A 7GCHG 1VITF 1F0RA 3S9CA 2FOAA 3GYLB 2O9QA 3Q3XA 5FL7D 1Y3VA 1QL7A 1YWUA 2STBE 2W7UA 1XKAC 3LIWA 7ESTE 3DFLA 3A8BA 3QWCH 1UTPA 1PQAA 2WZQA 2AMDA 4TPYA 2ZU5A 1FPHH 4CRAA 3MU1A 2BDCA 2K8IA 2QXGA 1NRSH 4HTCH 1A1RA 4UEHH 2A5AA 1EASA 1LVMA 1O5GH 3HKIB 3RXIA 1ZSLA 4GHTA 1C2JA 4AORA 3EE0B 1V3XA 2BY5X 4H6SB 3PRDA 1CT2E 1BZXE 1B0EA 1LHFH 1G3EA 1FY3A 4ZMAH 2A4GA 1C1QA 1F7ZA 4FUFA 1ZOMA 2C90B 1N1LA 1TWXB 2LPRA 3SI3H 1T4VH 7LPRA 1B0FA 2ZCHP 3ATMA 1QY6A 1DICA 1FV9A 2A7HA 1BJVA 1UTQA 1H8DH 1A7SA 4ISLA 1T32A 2P3TB 4RSPA 1AFEH 3PTNA 3GY5A 1SOTA 1P03A 1BTHH 2RDEA 5DP4A 3QLPH 1O5FH 2Z3CA 4WXVA 2B8OH 1IAUA 3V13A 2AH4X 4Y6DA 2ZPRA 5CHAB 1DY8A 2NU3E 2J5UA 2G52A 3GY2A 2P93A 3TJOA 1EPTA 3F1SB 2JKHA 5EJLA 1OP0A 1ZPCA 2BLOA 5JBTA 3PO1B 2OP9A 2V0BA 4JMYA 1GMCF 4B6FA 4LOYH 3STIA 1ZTKA 2FM2A 1COWD 4CRGA 1MD8A 2KAIA 3PYHA 2ALVA 2SGEE 3S69A 3SU4A 1Z1IA 2AMPA 1O2QA 5H4IB 3NPSA 2YNBA 2AHME 3E8LA 1D3QB 1EAXA 3UOUA 1PYTC 1BMNH 2BZAA 5BRRE 3NK8A 2OQUA 1PQ5A 1DLKB 2JH0D 1FIZA 2NU4E 2XNDD 2BY6X 4KTSA 3P8GA 5EOKA 1QB6A 1L1GA 3U1JB 1JOUB 4O97A 1RIWB 1IQNA 4MPWA 1DUAA 1B7XB 1BMMH 3E3TA 2RG3A 1C1OA 2ASUB 5CMXH 3TJNA 3TITA 1GHAF 2XOKD 4Y8XA 2EEKA 3BEIB 3PRBA 1XUKA 3RDZA 1HJAB 3KQBA 5F53A 2OQ5A 1C2FA 2ZQ2A 3RC6A 3RM0H 1HUTH 3M36A 1YKTA 1UVOA 2BLVA 2TGDA 1AVXA 1TLDA 1H1BA 1DFPA 3BEUA 4JYTA 2ZI2H 1P57B 1FNIA 1GWAA 1C5NH 2EI8A 1ANEA 2J95A 2ZC9H 1AI8H 1MABB 1D6WA 1O3EA 1SQTA 4X0WU 1EB2A 3AW0A 1AWFH 2M5TA 1WDIA 1GI5A 1Z1JA 4X2WA 5KEDA 2IJD1 4ZKRU 1PQ8A 1T4UH 1WQSA 5ESBA 4MNXA 3URDA 2OTVA 1FY4A 2C93B 1ELFA 2HPPH 3EAJA 3QN7A 3RXSA 5EGMA 1EP6A 5CHAC 2Z9GA 3R3GB 1GBFA 2TBSA 1LQDB 2CXVA 3PO1C 2Y82A 4QT8C 2NU2E 3HATH 1BB0B 3GCTG 1CGJE 3T28A 1LHGH 4X8VH 1SQOA 3BTFE 1UTOA 4DJZB 4X6NA 3LGVA 3AAVA 4E06H 2Y7ZA 3SHAH 1O36A 1AFQB 2SFAA 4YM9A 2ZIQH 1ACBE 3NKKA 4GHQA 5PTPA 1EP5A 2VGCB 4SGAE 5ESTE 1C1WH 1RIWC 1O5BB 2HNTC 3FP8E 4IN2A 3SUGA 1PPHE 2FOBA 4YESB 2CN0H 3FZDA 4A92A 1C5VA 5FBEA 3A7ZA 3GOVB 4B74A 2EQNA 2F9OA 3SBKA 2F91A 1HJAC 2A7JA 1ELVA 1YY3A 2VVUA 1D3TB 2V3MA 1CVWH 1N8OB 1ZPBA 4AFQA 3OTPA 1HGTH 1PPZA 5DP6A 3RMMH 2ODYB 4A6LA 2GJGA 3GCHB 3AASA 1K0HA 1UCYE 2V3OH 1K1MA 1BMFD 4K1SA 4NG9H 5EIYA 2TGAA 2BD5A 1WTGH 2ZTXA 2GCHF 2VVVA 4XFQA 2WPMS 4CR5A 2VIVA 4VGCB 2J2UA 1LPKB 3VEQB 3PV4A 4DOQA 3SV9A 1O5DH 2QA9E 2VH6A 5FHTA 4YTAA 1CSOE 2FOFA 3PMJA 4Q7XA 4BAOB 3QDZB 3D23A 1KMHB 1UVUH 4Y0ZE 5DSFA 2FI5E 2QCYA 2FWWA 1SR5C 1C5RA 3EA9A 3A87A 5T1VA 2H5CA 2QF3A 1KDQB 3ODFA 1DWDH 3F6UH 2P8OB 4Y10E 1TNHA 3MU4A 1SGCA 1AVGH 3QX5H 4XBCA 1ETRH 2BD9A 1XVMA 1VJ9U 3LT3A 1J14A 3FOAA 1FUJA 3VB5A 4Y8ZA 2PLXA 2ZDKA 2PKAB 3ZVAA 1JXPA 2ZGXH 4I86A 1AFQC 4MTBA 2Z9KA 4MPVA 3ATIA 3SN8A 1K9OE 1GHBF 3BTQE 3E6PH 5I46H 1BTXA 3GS9A 5IYTA 2VGCC 1KY9A 1EJAA 4WVPE 3KIDU 1WOFA 1HPGA 1C9TA 4NSVA 4JK6A 3F2HA 1OX1A 4LXBH 2ODPA 3ATKA 4GUXA 3S9BA 1P10A 1C5TA 1RD3B 3ZIAD 1YPLH 1AIXH 1A4WH 1G32B 1THSH 3SV8A 2SGPE 3N7DA 3ZZ7A 4CRDA 1GCDA 1N8OC 5C5NA 1H9IE 1C9PA 1TABE 2PSXA 2RA3A 3I29A 1CA0B 1Z8IB 4NSYA 5A8XA 1J8AA 1HIAA 3GCHC 2GKVE 2Y81A 5JPMH 2PUQH 4TWYA 1T7CA 2XC5A 3ZVGA 2EA3A 3U8OH 1FLEE 2XC4A 1ZTJA 2H1UA 1GMHG 2GT8A 1YPGH 4JCNA 3PMBB 1DS2E 3PWCA 4I8HA 1NN6A 1ZHRA 2O8WA 1RJXB 2ZWLH 4VGCC 6LPRA 3ZVFA 1K1LA 2FOHA 1GMDG 1QB1A 2QGRA 1GJ5H 2RFKC 4BAKB 3LGUA 4CHAB 6GCHG 3TH3H 3QK1A 2A2XH 2BQWB 4TPIZ 2ZP0H 3S0NA 3HKJB 1Z8GA 2UWOA 3PROA 2OK5A 2BDHA 2TPIZ 1C5QA 4OS6A 1A0JA 3V7TA 9ESTA 1HAZB 1TQ0B 2JH5D 1C5UA 2VWMA 2P8OC 2ZZUH 1O2ZA 2XYAA 4BAQB 3VB7A 3MH7A 2GZ7A 2BYAX 4A7IB 4I32A 1QHRB 1FDPA 3RMOH 1P2KA 1C5MD 2ZPQA 4DURA 1FMGA 5LPFA 3DFJA 1LVBA 1A2CH 1AN1E 1G2MA 2J38A 4FXGH 1ETSH 3GCNA 4DGJA 1ZMLA 1O32A 3EQ0H 1T8OA 3ZVBA 1GBAA 1O34A 1MQ6A 1GJDB 1SSXA 3A84A 4FUJA 1C5WB 4OGYA 2G51A 3ZYEA 3SOSA 1TGBA 4XDEA 2FX4A 2XWAA 4GPGA 1QTFA 4AFUA 1W2KH 1O2IA 4Y76A 1BTUA 1NU9A 2PTNA 5CE1A 4MNVA 3H5CB 2F9PA 2FIRH 3BF6H 3A8DA 4XOJA 3P8OA 3LJJA 1AQ7A 1V6DA 1MAXA 5FPYA 1TPAE 1QA7A 1EFRD 2Z9LA 4K5ZA 4ZUHA 1MKWK 4YT7H 1O0DH 4U30A 1UK3A 1CA0C 1YPKH 1ESTA 4JZIA 2C8YB 4ASHA 1EZXC 3SU3A 3UQVA 3A89A 1UK4A 2Q6DA 1EX3A 1MKXK 1O2YA 3CNRA 1NRNH 1ZGIA 2PUXB 4ZROA 1HYLA 3K6ZA 1P2IA 1THPB 3MMGA 2OUAA 4U01A 3ZZ5A 4ABEA 4GCHG 2BLWA 2FXRA 1S0RA 1NBME 2OC0A 2W3IA 4CHAC 3PLPA 1NFUA 1CT0E 4Q7ZA 1S6HA 4E7NA 4CH2B 1WQVH 2G8TA 2XRCA 4NA7A 1T8NA 3SV2H 5C20A 3RXKA 1BDAA 2ESTE 2VVCA 5E0HA 5JBBS 1BRAA 1MAYA 3LGTA 1ESAA 4FU8A 3GDUA 2EI7A 1HV7A 2WSSD 3GY8A 3OYPA 3S7KB 3D62A 3RMLH 1XMNB 1GVLA 1P04A 3E0NB 1OSSA 1G9IE 3LOXA 1P2MA 1TNLA 1TB6H 2BD2A 2J98B 4ZH8A 5EJ1A 4D7FA 3O8BA 3F2GA 1GHZA 4ZAEA 2O8LA 1BMLA 2HVXA 1SL3A 2OCVB 3FZZA 4AOQA 2NU0E 4FVBA 1HAVB 3A85A 1S84A
chains in the Genus database with same CATH topology
2FP7B 2IJD1 3M5MA 5T1VA 2V7QD 4B6EA 2QV1A 5ESBA 2CK3D 3M5LA 3SU2A 2WHXA 1E79D 1DXWA 1W3CA 2OBOA 3SU5A 1FX0B 3KF2A 3O8DA 2KR7A 4M9FA 1E1QD 1H8ED 1NBMD 2P59A 4A1VA 3FOAA 3F0OA 5EQRA 2JJ2D 5GPIB 3FO8D 4Q4LA 2WV9A 2QF4A 1JXPA 1OHHD 3NRLA 4OM9A 3W1EA 1W0JD 3OEHD 4B71A 2HLDD 3UB0A 5C0TA 4TT3D 4B73A 2M2AA 2OC1A 3EYDA 4DT4A 4FETA 1DY8A 3LKWA 2J5UA 2FOMB 1DXPA 3DSOA 3SV6A 3GS9A 3F2FA 1DY9A 5EPYA 3KNXA 5EQSA 4ASUD 4Z1MD 3P8OA 2OC7A 2OBQA 3LONA 2F9VA 4JMYA 4R8TB 5FPSA 5FPYA 3SU1A 1EFRD 2KZ4A 3PV2A 4B6FA 3VG8A 3F2HA 4Q63A 1W0KD 2YOLA 5EQQA 1SKYE 3SU6A 2FM2A 1COWD 2F9UA 5GJ4B 3RC5A 2W6JD 3ZIAD 2JJ1D 2O8MA 2JDID 3DCLA 5ETXA 4TYDA 4RI0A 5CDFE 3SU3A 3SU4A 4I31A 3SV8A 5HKKD 3N7DA 5H4IB 3SZEA 3SUGA 5DN6D 1RTLA 2GGVB 2AHME 4A1XA 4U01A 1H8HD 1S6LA 2KM0A 3P8NA 4A92A 3WWFA 3SYJA 4B76A 5C0UA 3KN2A 4K8BA 2K0QA 5GNDA 4B74A 2OINA 5CHBA 1NBME 2LELA 2XNDD 4A1TA 5C17A 2OC0A 3U1JB 3SV7A 5IDKA 2KCOA 2F43B 3SU0A 5EPNA 5FL7D 3OTPA 2IJOB 2QE7D 3O8RA 3F0PA 2YMSC 1CU1A 2L6OA 2XCNA 3M5OA 3WWBA 3WW7A 2GVFA 4ZCNA 3O8CA 3FN8A 2VBCA 2XOKD 1E1RD 3PRBA 4I33A 2F4LA 2WZQA 4NWKA 2WPDD 5IK2D 1WXRA 4WH8A 3PV5A 3FKSD 2K8IA 2KFWA 2WSSD 3OE7D 1BMFD 5B6LA 2K1QA 3OYPA 3N99A 5F53A 1BT7A 4XD7D 1A1RA 3E90B 4NWLA 2YMSB 3H09A 3OFND 2KCYA 1RGQA 4WF8A 3RC6A 4B75A 1NS3A 3OEED 2A4QA 2JIZD 2W6ID 3LOXA 3L6PA 5FPTA 2OK5A 3RC4A 3U1IB 2KCPA 2XCFA 3KEEA 4WH6A 2YMSD 3PRDA 4YXWD 4TSFD 3SV9A 4F55A 2XNIA 3O8BA 3SUDA 2KCAA 3F2GA 3SUEA 2OC8A 3SUFA 2A4GA 3M5NA 1MABB 3F3BA 3N7EA 2QF5A 1KMHB 4KTCA 3OAAD 5DSFA 3AK5A 1N1LA 4I32A 3DSPA 2A4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCA A;  2KZ4 A; 
#chains in the Genus database with same CATH topology
 5AFY H;  2A2Q H;  1S81 A;  1OWJ A;  2CK3 D;  1XXF A;  2ANY A;  1LKA A;  3S7H B;  4K60 A;  1GL1 A;  1HAP H;  1AKS A;  1C2I A;  4RKO B;  1GI0 A;  2KR7 A;  1GJ7 B;  1SG8 B;  4AG2 A;  1L4Z A;  1MMJ N;  3A80 A;  3T25 A;  3KQE A;  1V2U T;  2GMT B;  1ZLR A;  1L1N A;  2WPI S;  2HLD D;  5EW2 H;  2OC1 A;  3CEN A;  3GDV A;  2ANM H;  3RXF A;  3OY6 U;  1CO7 E;  3SW2 B;  2ODQ A;  1GJ9 B;  2J4I A;  2VIP A;  1NZQ H;  2ZFT A;  1C1M A;  1GHX H;  1O5C B;  2R2W U;  1QJ7 B;  3SU1 A;  2H9E H;  1GDQ A;  3PWB A;  3A7V A;  4FUC A;  2PW8 H;  5E2O A;  1AO5 A;  3LGI A;  1HB0 B;  1DWE H;  3BG8 A;  1FZZ A;  4IS5 A;  1NO9 H;  5GIB A;  1O3P B;  3MH5 A;  5JBC S;  2FZZ A;  1GJB B;  1MKX H;  4NIV A;  1IOE A;  3F68 H;  4IMQ A;  1G36 A;  1SLV B;  2XW9 A;  3ZZ9 A;  1GBB A;  2ANK H;  4BNR A;  4X1R U;  3TNS A;  4B1T A;  1NFY A;  1O3K A;  2J34 A;  1C5Z B;  3ATW A;  5SGA E;  2VWN A;  1P9S A;  5HIY A;  4K2Y A;  4MVN A;  4JYU H;  5GDS H;  1E1R D;  1SC8 U;  1PYT D;  2Y5F A;  1QR3 E;  5EU8 A;  2PFE A;  5B6L A;  1ELA A;  5F6M A;  3OU0 A;  1OWI A;  2ZDM A;  1Y8T A;  3RU4 T;  1BTW A;  2KCY A;  3FAN A;  2JIZ D;  1KLJ H;  4R0I A;  1FI8 A;  1YF4 A;  4UFE H;  2HOB A;  3E0P B;  1AWH B;  1RTK A;  1UW7 A;  5JYI A;  2FOD A;  3HK6 B;  3BIV H;  4NA9 H;  5T6G A;  3MFJ A;  4I8L A;  4WMD A;  5G4B A;  1TRY A;  5EJZ A;  1YLD A;  2GMT C;  2HLC A;  3SNE A;  3T29 A;  1W0Y H;  1ELB A;  1K1O A;  3ZZC A;  3TH2 H;  1UHB B;  5C5O A;  1UVP A;  2WPK S;  3ENS B;  3A7W A;  1SPJ A;  2JJ2 D;  1K21 H;  4JZD H;  5DGJ A;  2Z3E A;  1OKX A;  2R9P A;  2GV7 A;  1SVP A;  5C0T A;  2B0F A;  4TT3 D;  1PJP A;  4ABB A;  2HWL B;  2ZG0 H;  4NIY A;  2ZGJ A;  2W7S A;  1LVY A;  1V2K T;  4NIX A;  2AYW A;  2R3Y A;  3VPK A;  2CJI A;  3ZVE A;  1PPF E;  3P70 B;  1OWK A;  2OD3 B;  9LPR A;  3A7Y A;  2BLQ A;  4Q63 A;  3VG8 A;  4MPX A;  4MLF B;  4JZE H;  2O8T A;  1SKY E;  2ZFS A;  3RMN H;  2H5D A;  1J17 T;  2AIP A;  2ZHQ H;  1BRB E;  4TYD A;  2HAL A;  2EI6 A;  2ZHW H;  3CP7 A;  1RRK A;  3UWI A;  1GMC G;  1NFW A;  1E36 B;  1W8B H;  1MBQ A;  3OTJ E;  2KM0 A;  4BXS A;  5E2P A;  2Z9I A;  3RXM A;  1W7X H;  2WYJ A;  2ZU3 A;  3KYF A;  5HYO A;  1C4V 2;  4A1T A;  3C1K A;  1BCU H;  5IDK A;  1KIG H;  1SHH B;  4BTI B;  1J9C H;  4ZXX H;  4BOH A;  1O5A B;  1FAX A;  4WY3 A;  3M5O A;  4NGA H;  1W12 U;  4ABJ A;  1KTS B;  1O3F A;  1Z6J H;  1S6F A;  4IC6 A;  1KTT B;  2AIQ A;  4NWK A;  1AND A;  4HI3 A;  5L2Y H;  2H2Z A;  1GI3 A;  3KQD A;  2G5N A;  4WMF A;  4IBL H;  1AHT H;  1LQE A;  3RM2 H;  2P94 A;  2YMS B;  1DOJ A;  1NU7 B;  1GHA G;  4FVD A;  2UUF B;  3I78 A;  1A3B H;  1SGN E;  1GDN A;  1N6X A;  2R0L A;  4F55 A;  4DVA U;  3NUM A;  1CQQ A;  1WBG B;  3DSG A;  3L3T A;  2VH0 A;  4CRB A;  4FU7 A;  1TMU H;  2QXJ A;  3ZZ4 A;  3OAA D;  3AK5 A;  2Q6F A;  3RXQ A;  3RXC A;  1TMT H;  5HXF A;  4B6E A;  3SU2 A;  1NT1 A;  3HPT B;  3RXG A;  1HAG E;  1AUT C;  1ETT H;  5LPR A;  4I8J A;  4X2V A;  3H7O A;  1K1J A;  1GHV H;  3B9F H;  5TJX A;  1K22 H;  5B6O A;  1W13 U;  2BHG A;  2WUC A;  4A5T S;  2D26 C;  3MHW U;  1F0T A;  1NFX A;  3NRL A;  5C94 A;  1XUF A;  1EPT B;  5EOD A;  2BDB A;  1ABJ H;  5A0A E;  3LKW A;  1ZMJ A;  5K7R A;  1G3D A;  2FS8 A;  3A81 A;  3UNS A;  4XSK U;  5BPE A;  3RU4 E;  3KNX A;  2OC7 A;  5F8T A;  1W11 U;  3TK5 A;  4AG1 A;  2DE9 A;  3TU7 H;  2ZDL A;  4AX9 H;  2KAI B;  1MU6 B;  1QRW A;  4YO9 A;  1Z71 A;  1JRS A;  1JWT A;  1VIT H;  2HNT E;  4O9V A;  1BIT A;  3KCG H;  3RC5 A;  3U8T H;  1C4U 2;  3VXF H;  2QN5 T;  1KXC A;  1YYY 1;  4RI0 A;  3SJI A;  1WSS H;  4Q2K A;  2UWP A;  2V35 A;  1O35 A;  1NRQ H;  1O3D A;  1KXD A;  1OWD A;  4A1X A;  3TJU A;  1AY6 H;  3PTB A;  3UWJ H;  1TX8 A;  4B76 A;  3STJ A;  2TRM A;  4AC9 A;  1SGT A;  5CHB A;  5I25 A;  1EKB B;  1MTW A;  2ANW A;  1EZU C;  1HLT H;  1GCT B;  2I6Q A;  5A0C A;  4YOI A;  2FTL E;  1P0S H;  4WWY A;  4DW2 U;  2YMS C;  4ZCN A;  1AE5 A;  3DD2 H;  5JDU B;  3BIU H;  2F4L A;  2HGT H;  4IN1 A;  1Y5U T;  1WXR A;  2BDG A;  4INH A;  4FUH A;  1E35 B;  1TNG A;  2CV3 A;  3HK3 B;  2AEI H;  3S9A A;  1D4P B;  2LP6 A;  3QUM P;  3MH4 A;  1BBR H;  1MBM A;  4XD7 D;  3TH4 H;  2GDE H;  1CT4 E;  1EOL A;  5A0B A;  2ZU1 A;  2GTB A;  4MQA A;  4AYV B;  3UUZ A;  1C5L H;  3BEF B;  2KCP A;  2XCF A;  1LKB A;  1CA8 B;  2A45 B;  4WH6 A;  1QBO A;  1SGD E;  2ZU4 A;  5EXN A;  2VIN A;  1TBQ H;  1LHE H;  4E05 H;  2G00 A;  1O3I A;  2SGA A;  4B2A A;  5LH8 A;  3SUF A;  5DJ7 A;  2GCH G;  5AFZ H;  2WIN I;  2O8U A;  4CRF A;  1EAI A;  5DP9 A;  1HRT H;  4KTC A;  3AVZ A;  4BAM B;  1RFN A;  1CGI E;  6EST A;  2QV1 A;  4Y7B A;  5E0J A;  5FX6 A;  3ZYD A;  2G5V A;  3ZZB A;  3ZV9 A;  1UTN A;  3BTK E;  1EPT C;  1EAW A;  5FCR A;  3KF2 A;  1BRU P;  1KXF A;  4X8T H;  2ZNK H;  5EQR A;  1A0H B;  4P02 A;  3K65 B;  3RXP A;  4BTT B;  1GPZ A;  1AGJ A;  2FDA A;  3W1E A;  1IQH A;  3OEH D;  5AHG H;  3EYD A;  1MTV A;  1H4W A;  1GBC A;  4FET A;  5GXP A;  2SGQ E;  2FYQ A;  1PQ7 A;  5DG6 A;  4Z1M D;  1SGE E;  2J97 A;  1EOJ A;  1SGY E;  1XUH A;  1O2V A;  1TBZ H;  2F9B H;  1WUN H;  2RDL A;  1ANC A;  8GCH F;  5JB8 S;  1GHB G;  2WPJ S;  4GAW A;  1GJA B;  1HBT H;  4UE7 H;  4PRO A;  4I8K A;  3UR6 A;  4YLU A;  2D8W A;  1XVO A;  3KL6 A;  1O3N A;  4RKJ B;  4Y7A A;  5EXM A;  3TIU A;  1GCT C;  3DT0 H;  3TGI E;  3EGK H;  1F5K U;  3P8N A;  2GP9 B;  1G37 A;  2I6S A;  2XBW A;  1UMA H;  1ZJK A;  2VIQ A;  1DM4 B;  1XUG A;  2VWO A;  2AS9 A;  3ZZA A;  5F8X A;  3ZVC A;  3SNB A;  1YPH E;  3RXE A;  4FUE A;  4FUI A;  5A2M H;  2IJO B;  2QE7 D;  4UFD H;  3U28 C;  3UOP A;  1Z6E A;  3ZZ3 A;  2XCN A;  3GY7 A;  1K1I A;  3D65 E;  3FN8 A;  4I33 A;  1Q3X A;  2XTT B;  2WPD D;  1QCP A;  1LCY A;  3LH1 A;  4ABF A;  1QGF A;  2RA0 A;  1HNE E;  4J2Y B;  3K2U A;  3UNQ A;  1G3C A;  2Q6G A;  3OFN D;  4WF8 A;  2Z9J A;  3SHC H;  3GY4 A;  2Y80 A;  3SOR A;  3MWI U;  4FUD A;  4TSF D;  1K28 D;  2IPH A;  1QUR H;  1GHW H;  3ZV8 A;  1MU8 B;  2GX4 A;  5T6D A;  3VB4 A;  5FX5 A;  3MH6 A;  2NU1 E;  4OGX A;  4DII H;  3GDS A;  2A4R A;  1FXY A;  1HXF H;  3BN9 A;  3N7O A;  3RLW H;  1O2H A;  2SNW A;  2BVX H;  2Q1J A;  3M5L A;  2WHX A;  4CH8 B;  1P2O A;  1NRO H;  5TCC A;  1C1S A;  4UFF H;  1CE5 A;  1Y3X A;  4YT6 H;  1TNJ A;  1GBH A;  3BTD E;  2W3K A;  4M9F A;  1NBM D;  2G4T A;  2ZPS A;  4LK4 A;  1IQJ A;  4FOU C;  4X1S U;  3KQC A;  1BOQ A;  1C2G A;  3V12 A;  2AGG X;  2QF4 A;  3K6Y A;  3DHK H;  3Q77 A;  1O2W A;  3RUO A;  1VJA U;  4O03 A;  1D6R A;  2FOM B;  4AGK A;  2ZFF H;  4XRN A;  2TGT A;  1YCP H;  2ZEC A;  3RXV A;  4Y71 A;  1XKB C;  1CGH A;  3PV2 A;  1FN6 A;  3MU5 A;  1VCW A;  1E0F D;  3MQK C;  1VGC B;  1WU1 A;  1BTP A;  4MNY A;  4EST E;  5T6F A;  1EB1 H;  2Y5H A;  1GBL A;  1C2M A;  2O8M A;  5GCH F;  2ZCK P;  1ZJD A;  1S82 A;  2YNA A;  3U9A H;  1EZQ A;  3V3M A;  4ACB A;  4AFZ A;  4D76 A;  5DN6 D;  1HIA B;  1ESB A;  5A09 A;  2GGV B;  4JK5 A;  3SGA E;  2UUY A;  1BA8 B;  3P8F A;  3SYJ A;  5C0U A;  4K8B A;  3E91 A;  1ELE E;  1V2O T;  2LEL A;  1XUJ A;  2ZGB H;  2BOH B;  1XXD A;  4UD9 H;  3DA9 B;  1JMO H;  4F49 A;  1O3O A;  3RXO A;  1V2M T;  3M7Q A;  3LGY A;  3LGW A;  1OP2 A;  1E38 B;  3ATL A;  2VBC A;  4CBN A;  3PB1 E;  1PPE E;  2A5I A;  2Y7X A;  1W10 U;  1OPH B;  1VZQ H;  1BT7 A;  5C67 A;  4X6M A;  5L2Z H;  3P95 A;  3E16 B;  1GHY H;  4FUG A;  3RXA A;  3PMH B;  4ZHL U;  1NS3 A;  3VGC B;  1HAH H;  5J4Q A;  1MCV A;  3ITI A;  1TGN A;  5A8Y A;  2Z6B D;  3F3B A;  2QF5 A;  3BTH E;  3SQE E;  1OWE A;  1F5L A;  1A5H A;  2FI3 E;  1QRX A;  2FP7 B;  1QBN A;  3M5M A;  8KME 2;  1TGT A;  2DE8 A;  3CS0 A;  1GDU A;  3A7X A;  5J4S A;  3EDX B;  4DCD A;  2QF0 A;  2HVY B;  2ALP A;  1SMF E;  1V2V T;  4GSO A;  3MTY A;  3M3T A;  1O39 A;  1RS0 A;  1GJ8 B;  4TWW A;  3PMA B;  2WV4 A;  2W5E A;  4JYV H;  2AMQ A;  1YPJ H;  1TNI A;  4B71 A;  4INL A;  4UON A;  3NCL A;  1VGC C;  4O3U A;  4NZQ A;  1C2E A;  3BTT E;  3TGK E;  2ZDV H;  1O3L A;  2XC0 A;  4ASU D;  2RCE A;  1FAK H;  3NXP A;  1PPB H;  1GI9 B;  2KZ4 A;  2PSY A;  1IQM A;  1YC0 A;  4YOG A;  5FAH A;  1IQF A;  5EQQ A;  3W94 A;  1C2L A;  4Y0Y E;  1UVS H;  1L1J A;  1VCP A;  3W95 A;  5ETX A;  1S83 A;  2GD4 B;  4I31 A;  4X6P A;  3MU8 A;  4OS4 A;  4DG4 A;  1QRZ A;  3BSQ A;  4K1T A;  3Q00 A;  1GGD B;  2FOE A;  3A86 A;  2K0Q A;  3MO3 A;  1V2N T;  2VJ1 A;  4OS2 A;  1V2L T;  3EA7 A;  1ZR0 A;  2WPL S;  3SJ9 A;  2BY8 X;  2KCO A;  2FLR H;  3FFG A;  1INC A;  1LHD H;  1ZHP A;  2G81 E;  5HM2 A;  5L6N H;  1O5E H;  3O8C A;  1MCT A;  1F0S A;  1ZZZ A;  4KEL A;  3D49 H;  1D3P B;  3VGC C;  1QZ8 A;  1O3C A;  3M3V A;  1LTO A;  1F0U A;  4WH8 A;  4AN7 A;  1NES E;  1FY1 A;  4YZU A;  3SZN A;  3UFA A;  2K1Q A;  1UJ1 A;  3UNR A;  1FY8 E;  1V2T T;  3HGP A;  3LDX H;  1NRR H;  1O2M A;  4MPU A;  1RGQ A;  3FVF B;  2STA E;  1TMB H;  2H6M A;  2A5K A;  2UUK B;  3L6P A;  2HRV A;  4F48 B;  1O31 A;  3BG4 B;  1QNJ A;  1TIO A;  3FAO A;  2OLG A;  4K8Y A;  8LPR A;  5DK1 A;  1O3J A;  1EQ9 A;  4Y79 A;  3SUD A;  3RXB A;  1ZHM A;  2FX6 A;  3URC A;  1TRM A;  2ZO3 H;  1TFX A;  1FIW A;  3E1X B;  3DSP A;  1DT2 A;  1O2R A;  4X8U H;  2ZQ1 A;  4D9R A;  3K9X B;  1SGQ E;  1AKS B;  1QFK H;  1UTK A;  1LPZ B;  1LPG B;  1MTU A;  4ZKO U;  2OBO A;  1ELD E;  1IQE A;  2WYG A;  2P3F H;  1IQL A;  1QBV H;  3B8J A;  4A1V A;  2BDI A;  1C2H A;  4ABA A;  4YOJ A;  5GPI B;  4LZ4 B;  2WV9 A;  1TOC B;  1GBT A;  3UPE A;  3UB0 A;  3LH3 A;  1ELC A;  4X1P U;  3VB3 A;  4OS7 A;  1P05 A;  1O3H A;  1OYQ A;  3DSO A;  2BOK A;  1IHS H;  2WPH S;  1NTP A;  1CHO F;  2BX4 A;  2IOT A;  4SGB E;  3LON A;  1S85 A;  2OBQ A;  3ELA H;  2BD7 A;  3SJK A;  2Y6T A;  3LJO A;  3ZZ6 A;  2SNV A;  1GGD C;  1GJ6 A;  1C4Y 2;  1GI6 A;  1SBW A;  4IC5 A;  3BTG E;  5A8Z A;  3RXD A;  2FEQ H;  1P01 A;  4ABD A;  2W6J D;  4MNW A;  3F9G A;  4FU9 A;  7GCH F;  2PTC E;  3HGN A;  1QL9 A;  2XXL A;  1GBJ A;  1ZTL A;  3BTM E;  1OOK B;  1O2K A;  1S6L A;  1YPM H;  4AB9 A;  2SGF E;  3WWF A;  1JBU H;  1HCG A;  1C1V H;  1P3E A;  5GND A;  3RXJ A;  1TNK A;  1O2U A;  1V2J T;  1TYN A;  3WY8 A;  5C17 A;  4DT7 B;  2BZ6 H;  2VID A;  8EST E;  2WV5 A;  2CHA B;  4X6O A;  3SND A;  2F83 A;  4GVU A;  4UDW H;  1O2X A;  1TGS Z;  3BG4 C;  3OE7 D;  2KFW A;  5C1X A;  1UCY H;  1C1U H;  2A1D B;  2V6N A;  1C1P A;  4ZHA A;  2BD8 A;  2JH6 D;  3GIC B;  1P02 A;  2GZ8 A;  3ZZD A;  3SJ8 A;  2BDA A;  3M3S A;  2BD4 A;  1ORF A;  3F9H A;  1DWB H;  1O3A A;  3KEE A;  3RU4 D;  1GBM A;  2YMS D;  4YXW D;  4GLY A;  2ZHE H;  1WCZ A;  4K1E A;  3CS7 A;  3I77 A;  1QA0 A;  3N7E A;  1T8M A;  2G4U A;  4B2C A;  1E34 B;  3KYG A;  1C1N A;  3M61 U;  2ZFP H;  5DP3 A;  5F8Z A;  1SGI B;  1AZ8 A;  4BXW A;  5HIZ A;  4AFS A;  4ZHM U;  2BB4 A;  1BBR K;  1W3C A;  2NWN A;  3EST A;  3P92 A;  3SQH E;  1SLU B;  1TPP A;  1DWC H;  3F9E A;  2ZTZ A;  5FCK A;  2AGE X;  2KX4 A;  1KLI H;  3M7U A;  1TPS A;  4M7G A;  2C4F H;  1HAI H;  1OHH D;  3SGB E;  1Z7K A;  3BTE E;  2BTC E;  1C2D A;  3QZQ A;  2W26 A;  1L4D A;  1BUI A;  2P95 A;  5HMA A;  4D7G A;  1FY5 A;  2FMJ A;  1C5X B;  1P9U A;  1HDT H;  1QB9 A;  1FN8 A;  2BY9 X;  1LVO A;  1O2T A;  1DVA H;  1W0K D;  3MU0 A;  3TK9 A;  1GI1 A;  1GL0 E;  2C8X B;  3OX7 U;  5GJ4 B;  5E0G A;  2JJ1 D;  1NRP H;  4H4F A;  4BAN B;  1A5I A;  1SQA A;  2QIQ A;  1YLN A;  1ARC A;  1C5Y B;  3RXL A;  1ELG A;  1RTL A;  3FP6 E;  2V3H H;  1DIT H;  1SFQ B;  2BQ6 B;  2BDY A;  2CHA C;  4KKD A;  1OS8 A;  2J94 A;  5HM9 A;  3AAU A;  4ABG A;  4NA8 A;  1LMW B;  1HFD A;  2ZGC A;  3MNB A;  1F2S E;  1M9U A;  4OS5 A;  5C3N A;  2F43 B;  7KME H;  3U98 H;  1O2P A;  1WTH D;  1DSU A;  4THN H;  3RXT A;  3F0P A;  1KXA A;  1Z8R A;  3WW7 A;  2EY4 C;  1O3M A;  1O38 A;  1SGF A;  2A31 A;  3T2N A;  2VNT A;  3PV5 A;  1SHY A;  1A3E H;  5JB9 S;  1XM1 A;  3N99 A;  1BTY A;  4B2B A;  2C8W B;  3TLO A;  1O30 A;  4X8S H;  3E90 B;  3H09 A;  2FOG A;  1Y3W A;  2Z3D A;  1EZS C;  2W6I D;  1NY2 2;  5FPT A;  3RC4 A;  4DY7 B;  2A32 A;  5C2Z A;  3UAI C;  1Y3U A;  1C5S A;  1TAL A;  2ZU2 A;  3SUE A;  4XBD A;  2OC8 A;  4ZKN U;  2C3S A;  1UVT H;  2B9L A;  3KQ5 A;  1DAN H;  2GV6 A;  4RT0 A;  1ANB A;  1ZSK A;  3RP2 A;  2VB0 A;  3MYW A;  2Z94 A;  5KGO A;  2V7Q D;  3UR9 A;  1XX9 A;  2BMG B;  1IHT H;  1E79 D;  3GCT F;  2BVR H;  2IPQ X;  3A88 A;  1DXW A;  2Z7F E;  3EA8 A;  2B5T B;  2GT7 A;  3VFE A;  1Q31 A;  1KDQ A;  1O2G H;  1C1R A;  1GG6 B;  2SGD E;  4Q80 A;  3SU5 A;  1P12 E;  1BIO A;  1N6Y A;  2EC9 H;  3A8C A;  4E7R G;  1T31 A;  1OXG A;  1DE7 H;  3FO8 D;  2DUC A;  4DIH H;  1QIX B;  4OM9 A;  3UTU H;  3G01 A;  1E37 B;  1V2W T;  1SGR E;  2XBX A;  5FBI A;  3ZZ8 A;  3TVJ B;  1O2J A;  1S0Q A;  2M2A A;  2PHB A;  3GCO A;  2PKA A;  2H9T H;  2AER H;  1MZA A;  1AE8 H;  1MD7 A;  2J9N A;  3F2F A;  1Y59 T;  5EPY A;  5EQS A;  4JZ1 A;  1BHX F;  2ZGH A;  2BM2 A;  3MO9 A;  2YOL A;  1P8V C;  2PR3 A;  3SU6 A;  1UTL M;  3QTV H;  1O37 A;  1QQ4 A;  5HKK D;  1G2L A;  2BXT H;  1MUE B;  1H9H E;  8GCH G;  4D8N A;  1TON A;  1TRN A;  1K1P A;  2VU8 E;  3Q3Y A;  1NPM A;  3KN2 A;  1DLE A;  1PFX C;  1P3C A;  2OIN A;  4Z0K A;  1YCP K;  3LU9 B;  3OSY A;  3SO3 A;  3M37 A;  1XUI A;  4CRC A;  1UTM A;  1PPG E;  2QC2 A;  3BV9 B;  1JIM A;  1P2J A;  1Y5B T;  2D2D A;  1P11 E;  2CMY A;  1EJM A;  2GVF A;  2ZCL P;  1SLX B;  1YLC A;  3V0X A;  4ACA A;  3TNT A;  2A7C A;  1UTJ A;  4O3T A;  4H42 U;  2BVS H;  1YCP M;  1GJC B;  4WJG 2;  1V2S T;  1HJ9 A;  3NWU A;  1GI2 A;  4NWL A;  1C5O H;  1CBW B;  1SFI A;  3IG6 B;  4K69 A;  1Y5A T;  3OEE D;  4NZL A;  1BQY A;  2A4Q A;  4P00 A;  3SNA A;  3MI4 A;  2ZFQ H;  3NZI A;  2L74 A;  2F3C E;  3AW1 A;  4WXI A;  3UQO A;  1GG6 C;  3L33 A;  1FQ3 A;  4HFP B;  1SGP E;  3B23 B;  1KXB A;  1HAY B;  3F9F A;  5ABW A;  2FPZ A;  1D3D B;  4MG3 A;  2QXH A;  1AU8 A;  3T5F H;  3MNX A;  3TJV A;  1P2Q A;  1ABI H;  3PM3 A;  1H8E D;  2OXS A;  4IGD A;  1FJS A;  3F0O A;  1K1N A;  3M35 A;  3LC3 A;  3SJO A;  5FXL A;  4X2X A;  1EAT A;  1F5R A;  1SOZ A;  4K3J A;  2UUJ B;  5JBA S;  1VKY A;  2BXU H;  1AZZ A;  4DT4 A;  4YLQ H;  1DX5 M;  5DPA A;  2WUB A;  5C1Y A;  4Q7Y A;  1A61 H;  1YP9 A;  2A0Q B;  1ZRK A;  2PGQ B;  4TY7 A;  1OWH A;  1HJ8 A;  1A5G H;  1DY9 A;  2BQ7 B;  4KP0 A;  1AVW A;  1NM6 A;  2BX3 A;  5FPS A;  1ZYO A;  2F9V A;  2D1J A;  3GIS B;  1F92 A;  2R3U A;  2UWL A;  3UIR A;  3KGP A;  1BJU A;  2BD3 A;  2GDD A;  1GBD A;  1MH0 A;  2PP6 A;  4XBB A;  1KYN A;  1HAO H;  1ZPZ A;  4BTU B;  3LPR A;  1YPH C;  1LO6 A;  1WV7 H;  4NFF A;  3RXH A;  1P2N A;  3SZE A;  1P06 A;  1GMH F;  4CRE A;  3ZVD A;  3A82 A;  3T27 A;  4X1Q U;  5KEC A;  2ULL A;  5E8E H;  2FI4 E;  1AD8 H;  5GCH G;  1GMD F;  1V2R T;  3A8A A;  4KGA A;  3RXR A;  3SV7 A;  1GI4 A;  1O2N A;  1QJ6 B;  6GCH F;  1BRC E;  1DPO A;  1THR H;  3O8R A;  5C1U A;  1SB1 H;  1C5P A;  2PWX A;  3MNS A;  3R0F A;  5HGG A;  3IWM A;  1CBW C;  1GI8 B;  1EJN A;  1FON A;  2ZFR H;  3KHV A;  1AMH A;  1BBR E;  5TCA A;  5IK2 D;  2THF B;  2PKS B;  1GBI A;  1MZD A;  2CF9 H;  1UK2 A;  1ELT A;  3QZR A;  1GI7 B;  3T62 A;  2TGP Z;  4Y8Y A;  4IW4 E;  1VCQ A;  1WAY B;  3QGN B;  3U1I B;  1U6Q A;  1V2P T;  1G3B A;  1RXP A;  2FTM A;  3MNC A;  2R2M B;  3RXU A;  2CF8 H;  2Y5G A;  2J98 A;  4J1Y A;  4XE4 A;  2HNT F;  1TX7 A;  1ZRB A;  3M5N A;  3MOC A;  3C27 B;  1TE0 A;  1LHC H;  2GCT B;  4BAH B;  2BY7 X;  1B5G H;  3TGJ E;  1QJ1 B;  1J15 A;  3GY3 A;  1FPC H;  4X1N U;  4ISN A;  3SNC A;  1HAV A;  4HZH A;  2ZA5 A;  1MTS A;  2LNC A;  5T3H A;  1ARB A;  1FX0 B;  3O8D A;  1QQU A;  1E1Q D;  2P59 A;  4RN6 A;  1O33 A;  3M7T A;  1L2E A;  4ISH H;  1LDT T;  4NIW A;  1ZGV A;  3QGJ A;  1YGC H;  4ABI A;  1Y3Y A;  1W0J D;  1A46 H;  3OY5 U;  3P17 H;  4ZXY H;  2GZ9 A;  5DP7 A;  1JIR A;  2FO9 A;  2IN2 A;  3U69 H;  1A0L A;  1TPO A;  4ZKS U;  3ODD A;  1Z8J B;  3SV6 A;  3GY6 A;  3RLY H;  1MTN B;  4X2Y A;  1GBK A;  2FES H;  3P6Z B;  4R8T B;  1IQK A;  2F9N A;  2PGB B;  4AYY B;  1H9L B;  3VB6 A;  3A7T A;  1W7G H;  4U2W A;  1V2Q T;  2ILN A;  5DP8 A;  2F9U A;  4GCH F;  1OP8 A;  2ZHD A;  3DCL A;  1TGC A;  3PLK A;  1GVZ A;  2ZDN A;  5LGO A;  1H8I H;  1GVK B;  3TK6 A;  4HGC A;  2XBV A;  2ZHF H;  1H8H D;  2ZEB A;  5EG4 A;  2PV9 B;  1TX6 A;  6CHA B;  2P3U B;  2R0K A;  1AB9 B;  4TY6 A;  1C2K A;  5DP5 A;  1ID5 H;  2PKS C;  2VIO A;  4IMZ A;  3SU0 A;  5AF9 H;  5EPN A;  1TQ7 B;  1RTF B;  2CGA A;  1TAW A;  1CU1 A;  2L6O A;  3JZ1 B;  3SGQ E;  3WWB A;  5L30 H;  1HAX B;  1PPC E;  5AVD A;  2JET B;  2FYR A;  3DUX H;  4FUB A;  4NCY A;  2J92 A;  3U8R H;  1IQG A;  1KSN A;  4Z6A H;  4ABH A;  1O3B A;  3FKS D;  3GYM A;  3IIT A;  1QL8 A;  3BTW E;  2A4O A;  4UFG H;  2ZF0 H;  1AUJ A;  1SGF G;  2QXI A;  1MQ5 A;  3UY9 A;  1SQR A;  2XBY A;  2ZKS A;  4B75 A;  2G55 A;  2GCT C;  1NC6 A;  1EXF A;  1TBR H;  4LZ1 H;  2VWL A;  1DUE A;  4NFE A;  3Q3K A;  2ZTY A;  2TIO A;  3H7T A;  2XNI A;  1JRT A;  2KCA A;  4JZF H;  2HPQ H;  1ZMN A;  5F03 A;  4KTU A;  4U32 A;  1KLT A;  1YPE H;  4AGJ A;  5K0H A;  2QYI A;  4I7Y H;  1HXE H;  5EW1 H;  1BTZ A;  1O2S A;  2QAA A;  4D9Q A;  1DDJ A;  1O2O A;  1SI5 H;  4ISI H;  4MDS A;  1Q2W A;  1T8L A;  2AGI X;  1BHX B;  4AB8 A;  5LPE A;  1O3G A;  1C1T A;  1ZSJ A;  5DKM A;  1UCY K;  1MKW H;  1J16 A;  3FP7 E;  4H6T A;  4INK A;  1SLW B;  1YBW A;  3VXE H;  5GWZ A;  4ISO A;  1TA2 A;  1UHB A;  3A83 A;  4Q4L A;  1MTN C;  2XWB I;  3QO6 A;  1GJ4 H;  2ZDA H;  4OS1 A;  2AFQ B;  4I8G A;  3EE7 A;  1O2L A;  1G30 B;  1L0Z A;  4B73 A;  3Q76 A;  1K2I 1;  2H9H A;  1DXP A;  4Y11 E;  3LC5 A;  1OYT H;  2FLB H;  3URE A;  2C8Z B;  1W0Z U;  1BMA A;  1YM0 A;  1IQI A;  1GBE A;  1TOM H;  2B7D H;  1KXE A;  4AZ2 B;  2QY0 B;  3PLB A;  1S5S A;  6CHA C;  1AB9 C;  1D9I A;  1EAU A;  2VIW A;  5CDF E;  2JDI D;  1EUF A;  4WME A;  3T26 A;  1CHO G;  1UO6 A;  1VIT G;  4HG6 A;  3JZ2 B;  5DO4 H;  1P09 A;  4CBO A;  1VR1 H;  2FS9 A;  1CHG A;  2FOC A;  1X7A C;  1W14 U;  5EXL A;  3TPI Z;  1TA6 A;  3MO6 A;  4CR9 A;  2JET C;  3SI4 H;  1DST A;  1WYK A;  3QTO H;  4RT1 A;  4F4O C;  2P16 A;  7GCH G;  1VIT F;  1F0R A;  3S9C A;  2FOA A;  3GYL B;  2O9Q A;  3Q3X A;  5FL7 D;  1Y3V A;  1QL7 A;  1YWU A;  2STB E;  2W7U A;  1XKA C;  3LIW A;  7EST E;  3DFL A;  3A8B A;  3QWC H;  1UTP A;  1PQA A;  2WZQ A;  2AMD A;  4TPY A;  2ZU5 A;  1FPH H;  4CRA A;  3MU1 A;  2BDC A;  2K8I A;  2QXG A;  1NRS H;  4HTC H;  1A1R A;  4UEH H;  2A5A A;  1EAS A;  1LVM A;  1O5G H;  3HKI B;  3RXI A;  1ZSL A;  4GHT A;  1C2J A;  4AOR A;  3EE0 B;  1V3X A;  2BY5 X;  4H6S B;  3PRD A;  1CT2 E;  1BZX E;  1B0E A;  1LHF H;  1G3E A;  1FY3 A;  4ZMA H;  2A4G A;  1C1Q A;  1F7Z A;  4FUF A;  1ZOM A;  2C90 B;  1N1L A;  1TWX B;  2LPR A;  3SI3 H;  1T4V H;  7LPR A;  1B0F A;  2ZCH P;  3ATM A;  1QY6 A;  1DIC A;  1FV9 A;  2A7H A;  1BJV A;  1UTQ A;  1H8D H;  1A7S A;  4ISL A;  1T32 A;  2P3T B;  4RSP A;  1AFE H;  3PTN A;  3GY5 A;  1SOT A;  1P03 A;  1BTH H;  2RDE A;  5DP4 A;  3QLP H;  1O5F H;  2Z3C A;  4WXV A;  2B8O H;  1IAU A;  3V13 A;  2AH4 X;  4Y6D A;  2ZPR A;  5CHA B;  1DY8 A;  2NU3 E;  2J5U A;  2G52 A;  3GY2 A;  2P93 A;  3TJO A;  1EPT A;  3F1S B;  2JKH A;  5EJL A;  1OP0 A;  1ZPC A;  2BLO A;  5JBT A;  3PO1 B;  2OP9 A;  2V0B A;  4JMY A;  1GMC F;  4B6F A;  4LOY H;  3STI A;  1ZTK A;  2FM2 A;  1COW D;  4CRG A;  1MD8 A;  2KAI A;  3PYH A;  2ALV A;  2SGE E;  3S69 A;  3SU4 A;  1Z1I A;  2AMP A;  1O2Q A;  5H4I B;  3NPS A;  2YNB A;  2AHM E;  3E8L A;  1D3Q B;  1EAX A;  3UOU A;  1PYT C;  1BMN H;  2BZA A;  5BRR E;  3NK8 A;  2OQU A;  1PQ5 A;  1DLK B;  2JH0 D;  1FIZ A;  2NU4 E;  2XND D;  2BY6 X;  4KTS A;  3P8G A;  5EOK A;  1QB6 A;  1L1G A;  3U1J B;  1JOU B;  4O97 A;  1RIW B;  1IQN A;  4MPW A;  1DUA A;  1B7X B;  1BMM H;  3E3T A;  2RG3 A;  1C1O A;  2ASU B;  5CMX H;  3TJN A;  3TIT A;  1GHA F;  2XOK D;  4Y8X A;  2EEK A;  3BEI B;  3PRB A;  1XUK A;  3RDZ A;  1HJA B;  3KQB A;  5F53 A;  2OQ5 A;  1C2F A;  2ZQ2 A;  3RC6 A;  3RM0 H;  1HUT H;  3M36 A;  1YKT A;  1UVO A;  2BLV A;  2TGD A;  1AVX A;  1TLD A;  1H1B A;  1DFP A;  3BEU A;  4JYT A;  2ZI2 H;  1P57 B;  1FNI A;  1GWA A;  1C5N H;  2EI8 A;  1ANE A;  2J95 A;  2ZC9 H;  1AI8 H;  1MAB B;  1D6W A;  1O3E A;  1SQT A;  4X0W U;  1EB2 A;  3AW0 A;  1AWF H;  2M5T A;  1WDI A;  1GI5 A;  1Z1J A;  4X2W A;  5KED A;  2IJD 1;  4ZKR U;  1PQ8 A;  1T4U H;  1WQS A;  5ESB A;  4MNX A;  3URD A;  2OTV A;  1FY4 A;  2C93 B;  1ELF A;  2HPP H;  3EAJ A;  3QN7 A;  3RXS A;  5EGM A;  1EP6 A;  5CHA C;  2Z9G A;  3R3G B;  1GBF A;  2TBS A;  1LQD B;  2CXV A;  3PO1 C;  2Y82 A;  4QT8 C;  2NU2 E;  3HAT H;  1BB0 B;  3GCT G;  1CGJ E;  3T28 A;  1LHG H;  4X8V H;  1SQO A;  3BTF E;  1UTO A;  4DJZ B;  4X6N A;  3LGV A;  3AAV A;  4E06 H;  2Y7Z A;  3SHA H;  1O36 A;  1AFQ B;  2SFA A;  4YM9 A;  2ZIQ H;  1ACB E;  3NKK A;  4GHQ A;  5PTP A;  1EP5 A;  2VGC B;  4SGA E;  5EST E;  1C1W H;  1RIW C;  1O5B B;  2HNT C;  3FP8 E;  4IN2 A;  3SUG A;  1PPH E;  2FOB A;  4YES B;  2CN0 H;  3FZD A;  4A92 A;  1C5V A;  5FBE A;  3A7Z A;  3GOV B;  4B74 A;  2EQN A;  2F9O A;  3SBK A;  2F91 A;  1HJA C;  2A7J A;  1ELV A;  1YY3 A;  2VVU A;  1D3T B;  2V3M A;  1CVW H;  1N8O B;  1ZPB A;  4AFQ A;  3OTP A;  1HGT H;  1PPZ A;  5DP6 A;  3RMM H;  2ODY B;  4A6L A;  2GJG A;  3GCH B;  3AAS A;  1K0H A;  1UCY E;  2V3O H;  1K1M A;  1BMF D;  4K1S A;  4NG9 H;  5EIY A;  2TGA A;  2BD5 A;  1WTG H;  2ZTX A;  2GCH F;  2VVV A;  4XFQ A;  2WPM S;  4CR5 A;  2VIV A;  4VGC B;  2J2U A;  1LPK B;  3VEQ B;  3PV4 A;  4DOQ A;  3SV9 A;  1O5D H;  2QA9 E;  2VH6 A;  5FHT A;  4YTA A;  1CSO E;  2FOF A;  3PMJ A;  4Q7X A;  4BAO B;  3QDZ B;  3D23 A;  1KMH B;  1UVU H;  4Y0Z E;  5DSF A;  2FI5 E;  2QCY A;  2FWW A;  1SR5 C;  1C5R A;  3EA9 A;  3A87 A;  5T1V A;  2H5C A;  2QF3 A;  1KDQ B;  3ODF A;  1DWD H;  3F6U H;  2P8O B;  4Y10 E;  1TNH A;  3MU4 A;  1SGC A;  1AVG H;  3QX5 H;  4XBC A;  1ETR H;  2BD9 A;  1XVM A;  1VJ9 U;  3LT3 A;  1J14 A;  3FOA A;  1FUJ A;  3VB5 A;  4Y8Z A;  2PLX A;  2ZDK A;  2PKA B;  3ZVA A;  1JXP A;  2ZGX H;  4I86 A;  1AFQ C;  4MTB A;  2Z9K A;  4MPV A;  3ATI A;  3SN8 A;  1K9O E;  1GHB F;  3BTQ E;  3E6P H;  5I46 H;  1BTX A;  3GS9 A;  5IYT A;  2VGC C;  1KY9 A;  1EJA A;  4WVP E;  3KID U;  1WOF A;  1HPG A;  1C9T A;  4NSV A;  4JK6 A;  3F2H A;  1OX1 A;  4LXB H;  2ODP A;  3ATK A;  4GUX A;  3S9B A;  1P10 A;  1C5T A;  1RD3 B;  3ZIA D;  1YPL H;  1AIX H;  1A4W H;  1G32 B;  1THS H;  3SV8 A;  2SGP E;  3N7D A;  3ZZ7 A;  4CRD A;  1GCD A;  1N8O C;  5C5N A;  1H9I E;  1C9P A;  1TAB E;  2PSX A;  2RA3 A;  3I29 A;  1CA0 B;  1Z8I B;  4NSY A;  5A8X A;  1J8A A;  1HIA A;  3GCH C;  2GKV E;  2Y81 A;  5JPM H;  2PUQ H;  4TWY A;  1T7C A;  2XC5 A;  3ZVG A;  2EA3 A;  3U8O H;  1FLE E;  2XC4 A;  1ZTJ A;  2H1U A;  1GMH G;  2GT8 A;  1YPG H;  4JCN A;  3PMB B;  1DS2 E;  3PWC A;  4I8H A;  1NN6 A;  1ZHR A;  2O8W A;  1RJX B;  2ZWL H;  4VGC C;  6LPR A;  3ZVF A;  1K1L A;  2FOH A;  1GMD G;  1QB1 A;  2QGR A;  1GJ5 H;  2RFK C;  4BAK B;  3LGU A;  4CHA B;  6GCH G;  3TH3 H;  3QK1 A;  2A2X H;  2BQW B;  4TPI Z;  2ZP0 H;  3S0N A;  3HKJ B;  1Z8G A;  2UWO A;  3PRO A;  2OK5 A;  2BDH A;  2TPI Z;  1C5Q A;  4OS6 A;  1A0J A;  3V7T A;  9EST A;  1HAZ B;  1TQ0 B;  2JH5 D;  1C5U A;  2VWM A;  2P8O C;  2ZZU H;  1O2Z A;  2XYA A;  4BAQ B;  3VB7 A;  3MH7 A;  2GZ7 A;  2BYA X;  4A7I B;  4I32 A;  1QHR B;  1FDP A;  3RMO H;  1P2K A;  1C5M D;  2ZPQ A;  4DUR A;  1FMG A;  5LPF A;  3DFJ A;  1LVB A;  1A2C H;  1AN1 E;  1G2M A;  2J38 A;  4FXG H;  1ETS H;  3GCN A;  4DGJ A;  1ZML A;  1O32 A;  3EQ0 H;  1T8O A;  3ZVB A;  1GBA A;  1O34 A;  1MQ6 A;  1GJD B;  1SSX A;  3A84 A;  4FUJ A;  1C5W B;  4OGY A;  2G51 A;  3ZYE A;  3SOS A;  1TGB A;  4XDE A;  2FX4 A;  2XWA A;  4GPG A;  1QTF A;  4AFU A;  1W2K H;  1O2I A;  4Y76 A;  1BTU A;  1NU9 A;  2PTN A;  5CE1 A;  4MNV A;  3H5C B;  2F9P A;  2FIR H;  3BF6 H;  3A8D A;  4XOJ A;  3P8O A;  3LJJ A;  1AQ7 A;  1V6D A;  1MAX A;  5FPY A;  1TPA E;  1QA7 A;  1EFR D;  2Z9L A;  4K5Z A;  4ZUH A;  1MKW K;  4YT7 H;  1O0D H;  4U30 A;  1UK3 A;  1CA0 C;  1YPK H;  1EST A;  4JZI A;  2C8Y B;  4ASH A;  1EZX C;  3SU3 A;  3UQV A;  3A89 A;  1UK4 A;  2Q6D A;  1EX3 A;  1MKX K;  1O2Y A;  3CNR A;  1NRN H;  1ZGI A;  2PUX B;  4ZRO A;  1HYL A;  3K6Z A;  1P2I A;  1THP B;  3MMG A;  2OUA A;  4U01 A;  3ZZ5 A;  4ABE A;  4GCH G;  2BLW A;  2FXR A;  1S0R A;  1NBM E;  2OC0 A;  2W3I A;  4CHA C;  3PLP A;  1NFU A;  1CT0 E;  4Q7Z A;  1S6H A;  4E7N A;  4CH2 B;  1WQV H;  2G8T A;  2XRC A;  4NA7 A;  1T8N A;  3SV2 H;  5C20 A;  3RXK A;  1BDA A;  2EST E;  2VVC A;  5E0H A;  5JBB S;  1BRA A;  1MAY A;  3LGT A;  1ESA A;  4FU8 A;  3GDU A;  2EI7 A;  1HV7 A;  2WSS D;  3GY8 A;  3OYP A;  3S7K B;  3D62 A;  3RML H;  1XMN B;  1GVL A;  1P04 A;  3E0N B;  1OSS A;  1G9I E;  3LOX A;  1P2M A;  1TNL A;  1TB6 H;  2BD2 A;  2J98 B;  4ZH8 A;  5EJ1 A;  4D7F A;  3O8B A;  3F2G A;  1GHZ A;  4ZAE A;  2O8L A;  1BML A;  2HVX A;  1SL3 A;  2OCV B;  3FZZ A;  4AOQ A;  2NU0 E;  4FVB A;  1HAV B;  3A85 A;  1S84 A; 
#chains in the Genus database with same CATH homology
 2FP7 B;  2IJD 1;  3M5M A;  5T1V A;  2V7Q D;  4B6E A;  2QV1 A;  5ESB A;  2CK3 D;  3M5L A;  3SU2 A;  2WHX A;  1E79 D;  1DXW A;  1W3C A;  2OBO A;  3SU5 A;  1FX0 B;  3KF2 A;  3O8D A;  2KR7 A;  4M9F A;  1E1Q D;  1H8E D;  1NBM D;  2P59 A;  4A1V A;  3FOA A;  3F0O A;  5EQR A;  2JJ2 D;  5GPI B;  3FO8 D;  4Q4L A;  2WV9 A;  2QF4 A;  1JXP A;  1OHH D;  3NRL A;  4OM9 A;  3W1E A;  1W0J D;  3OEH D;  4B71 A;  2HLD D;  3UB0 A;  5C0T A;  4TT3 D;  4B73 A;  2M2A A;  2OC1 A;  3EYD A;  4DT4 A;  4FET A;  1DY8 A;  3LKW A;  2J5U A;  2FOM B;  1DXP A;  3DSO A;  3SV6 A;  3GS9 A;  3F2F A;  1DY9 A;  5EPY A;  3KNX A;  5EQS A;  4ASU D;  4Z1M D;  3P8O A;  2OC7 A;  2OBQ A;  3LON A;  2F9V A;  4JMY A;  4R8T B;  5FPS A;  5FPY A;  3SU1 A;  1EFR D;  2KZ4 A;  3PV2 A;  4B6F A;  3VG8 A;  3F2H A;  4Q63 A;  1W0K D;  2YOL A;  5EQQ A;  1SKY E;  3SU6 A;  2FM2 A;  1COW D;  2F9U A;  5GJ4 B;  3RC5 A;  2W6J D;  3ZIA D;  2JJ1 D;  2O8M A;  2JDI D;  3DCL A;  5ETX A;  4TYD A;  4RI0 A;  5CDF E;  3SU3 A;  3SU4 A;  4I31 A;  3SV8 A;  5HKK D;  3N7D A;  5H4I B;  3SZE A;  3SUG A;  5DN6 D;  1RTL A;  2GGV B;  2AHM E;  4A1X A;  4U01 A;  1H8H D;  1S6L A;  2KM0 A;  3P8N A;  4A92 A;  3WWF A;  3SYJ A;  4B76 A;  5C0U A;  3KN2 A;  4K8B A;  2K0Q A;  5GND A;  4B74 A;  2OIN A;  5CHB A;  1NBM E;  2LEL A;  2XND D;  4A1T A;  5C17 A;  2OC0 A;  3U1J B;  3SV7 A;  5IDK A;  2KCO A;  2F43 B;  3SU0 A;  5EPN A;  5FL7 D;  3OTP A;  2IJO B;  2QE7 D;  3O8R A;  3F0P A;  2YMS C;  1CU1 A;  2L6O A;  2XCN A;  3M5O A;  3WWB A;  3WW7 A;  2GVF A;  4ZCN A;  3O8C A;  3FN8 A;  2VBC A;  2XOK D;  1E1R D;  3PRB A;  4I33 A;  2F4L A;  2WZQ A;  4NWK A;  2WPD D;  5IK2 D;  1WXR A;  4WH8 A;  3PV5 A;  3FKS D;  2K8I A;  2KFW A;  2WSS D;  3OE7 D;  1BMF D;  5B6L A;  2K1Q A;  3OYP A;  3N99 A;  5F53 A;  1BT7 A;  4XD7 D;  1A1R A;  3E90 B;  4NWL A;  2YMS B;  3H09 A;  3OFN D;  2KCY A;  1RGQ A;  4WF8 A;  3RC6 A;  4B75 A;  1NS3 A;  3OEE D;  2A4Q A;  2JIZ D;  2W6I D;  3LOX A;  3L6P A;  5FPT A;  2OK5 A;  3RC4 A;  3U1I B;  2KCP A;  2XCF A;  3KEE A;  4WH6 A;  2YMS D;  3PRD A;  4YXW D;  4TSF D;  3SV9 A;  4F55 A;  2XNI A;  3O8B A;  3SUD A;  2KCA A;  3F2G A;  3SUE A;  2OC8 A;  3SUF A;  2A4G A;  3M5N A;  1MAB B;  3F3B A;  3N7E A;  2QF5 A;  1KMH B;  4KTC A;  3OAA D;  5DSF A;  3AK5 A;  1N1L A;  4I32 A;  3DSP A;  2A4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...