2KCAA

Gp16
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
109
structure length
109
Chain Sequence
MYEEFRDVITFQSYVEQSNGEGGKTYKWVDEFTAAAHVQPISQEEYYKAQQLQTPIGYNIYTPYDDRIDKKMRVIYRGKIVTFIGDPVDLSGLQEITRIKGKEDGAYVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of bacteriophage SPP1 head-to-tail connection reveals mechanism for viral DNA gating.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
molecule keywords Bacteriophage SPP1 complete nucleotide sequence
total genus 14
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05521 Phage_H_T_join Phage head-tail joining protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.270 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2kcaA00
2KZ4A 2KCAA
chains in the Genus database with same CATH superfamily
3URCA 1ANCA 1ZPCA 2Z9KA 1S6LA 4K1SA 2AH4X 1H9LB 2ZPQA 1O38A 3M37A 1O5CB 1P06A 4OS7A 1TNKA 3Q3YA 5SGAE 1C5MD 3A7YA 1U6QA 1TNHA 3E16B 8KME2 1ZHMA 4VGCC 2Z3EA 3BG4C 2P93A 1ZJKA 2FLRH 2O9QA 5EW2H 2ZGJA 2GV6A 1GJ6A 2WPJS 2H9EH 1XUJA 1GI0A 1AY6H 2J97A 1GGDB 1G30B 4NIWA 1GJ8B 1NY22 1WBGB 3KCGH 5ESTE 2B5TB 1BRAA 4X6PA 2AFQB 3E91A 3SJKA 3WWBA 1DY8A 1A0LA 3QDZB 4IS5A 4Q80A 3P92A 1V2QT 3ZZ8A 1C5NH 2Q6DA 2BLWA 3PWCA 2R2MB 3SW2B 1SOTA 4K2YA 3RXUA 4CHAC 1A1RA 1Z71A 4SGBE 1VITH 3HATH 3WWFA 4LXBH 3ATKA 3BSQA 1O31A 1HLTH 3L3TA 1Z8RA 3GY7A 1LHEH 2ZEBA 3LH3A 2ZDKA 5FL7D 1KDQA 3A7VA 4X6NA 3LGVA 5A8YA 2KCPA 2HVYB 3U1IB 1AB9B 4MG3A 3VGCC 4AB8A 1PFXC 3RC6A 2OC1A 1UTMA 4UFGH 1YCPM 2K8IA 1IQHA 1DX5M 1B5GH 2JDID 2BTCE 2ZP0H 5EXLA 1JWTA 1UTPA 1EAWA 3W1EA 2O8TA 2O8LA 3SYJA 1QA7A 1QJ1B 1CGHA 2IOTA 2BLQA 1GG6C 2ZTZA 3T27A 1AGJA 1CU1A 2PR3A 2R3UA 1FIZA 1FNIA 1MTVA 1T32A 1PPBH 1QJ7B 3HKJB 1AZZA 1GJCB 1C5RA 1BMNH 1NRSH 6ESTA 1BIOA 2JJ1D 3PV2A 4RT0A 4XOJA 2SGDE 4Y79A 2UWLA 1UO6A 4RSPA 1WV7H 1NRPH 3UUZA 2ZDMA 3VPKA 1OWIA 1BRCE 3MHWU 1GBKA 2TGPZ 2ZCLP 1C1MA 1C5OH 2BD3A 2Q6GA 1SKYE 5AHGH 3PYHA 4BAHB 4CRAA 1DE7H 2C4FH 2FODA 1LHDH 2PFEA 1ANDA 2BY8X 4ACAA 1P2MA 4GPGA 4B2CA 1YKTA 3A8CA 2XBWA 4X8UH 1MCVA 3OYPA 3AASA 3CNRA 4MPWA 3TK5A 1W7GH 3V7TA 2BLOA 1MCTA 2FDAA 5I25A 2FZZA 3LGWA 1L4ZA 1O3PB 1TALA 1P3EA 4UFDH 3ZZDA 3RXCA 3TK9A 4CRDA 2D8WA 1G3BA 5DP3A 1D6RA 2J95A 4ABBA 1J9CH 1P3CA 1NT1A 3T25A 1A3EH 4E7RG 1Z1IA 5CDFE 2WPHS 3A80A 3N99A 1GI6A 3FN8A 3SU6A 3OEHD 3ATLA 2EQNA 3MI4A 2W26A 1C5TA 2HWLB 1UK3A 1O2UA 4MTBA 1TONA 3SU1A 4O3UA 1GVKB 1C1PA 2O8WA 3ZIAD 2XCNA 2W3IA 3MNBA 1FXYA 4MPUA 1DSUA 5DP6A 4I7YH 4HG6A 1P05A 3RMOH 1NROH 1J14A 4X6MA 2KX4A 5DO4H 2GCTB 2R2WU 4FVBA 1FONA 1XKBC 1JMOH 1BQYA 3UNRA 1GG6B 3SZNA 1E37B 1GI8B 1O5DH 1MABB 4AGJA 2A32A 3QGNB 1UTJA 4Y71A 4B2BA 2BD5A 2ZFPH 1L1JA 1GL1A 3ODDA 3TU7H 8GCHG 2ZO3H 1HAVA 1MBQA 1INCA 4X8VH 5L30H 4MLFB 4Y0YE 2G52A 3ZZ6A 3ZVCA 1TBRH 3E1XB 1LKAA 3KQBA 1FY4A 3M5LA 2BQ7B 1EPTC 3RXGA 2VBCA 2BDHA 3QZRA 3MNXA 1O2QA 2RA3A 1Z6EA 3F2GA 3UWIA 5IK2D 1YPHE 5JBBS 3UWJH 1P10A 3PRDA 1SPJA 1TMBH 4NA9H 1KLIH 1L1GA 2WV9A 4X8SH 2Z9GA 3GICB 4INKA 2F3CE 4IMQA 1HAGE 2J94A 1QRZA 1Z8GA 1O3IA 3SUEA 1PPHE 2EA3A 1O5GH 5FBEA 4QT8C 1W2KH 2H9HA 2KAIB 1GCTC 4HZHA 1G3EA 1V2LT 3TJUA 1M9UA 1RGQA 3KF2A 3RXMA 3O8RA 4K60A 1UVOA 4ISNA 1MZDA 3UR6A 1BDAA 3E6PH 3IITA 2ZDVH 3UREA 1UW7A 4KTSA 1Y3YA 1E79D 1IQMA 1HCGA 3A8DA 3LJJA 1F0SA 1SOZA 4VGCB 2PKSB 4DOQA 1HIAA 4KTUA 3KEEA 3A86A 4ABIA 4ABGA 1AD8H 2VIPA 5FBIA 4INLA 1ETSH 4K8BA 4NG9H 1SLVB 2DE8A 3VXEH 4BTUB 1YPMH 4JK6A 1MZAA 4RN6A 2AYWA 2TBSA 2V3OH 4THNH 5HMAA 2J34A 3U69H 3S9AA 1PPGE 3ZZ9A 5C5OA 1MTWA 1H9HE 9LPRA 3VG8A 1O5EH 5PTPA 1AVGH 2R3YA 5CMXH 1C2EA 1P2IA 1C5VA 1E1RD 2J5UA 1PYTD 3T2NA 2A31A 2QF3A 3LU9B 1S0QA 3QTOH 1GMHF 1UMAH 2CHAB 5DP5A 1O5BB 4D7FA 2FX4A 1C2DA 1QBNA 3ZZ4A 1GI9B 5JBCS 4GCHF 2WPMS 2C8WB 3PTBA 3VB5A 5FPTA 1TPPA 1AUTC 1XVMA 2FM2A 3GY5A 1PYTC 1FN6A 2BDAA 2SGPE 1N1LA 2XXLA 2CGAA 1AE5A 4CRFA 1O3BA 1O2WA 1THRH 3EE0B 4K5ZA 4UFEH 1VCWA 4Y8ZA 2A45B 4H6SB 1S0RA 3G01A 5EQQA 4X6OA 4ISOA 1C9TA 1O34A 6GCHF 1EUFA 1S84A 3LT3A 1J15A 4BANB 5CE1A 2XNDD 1YPLH 4NIYA 2JKHA 2WV4A 1C9PA 1BRBE 1VJ9U 2ZGBH 2ZTYA 1DLEA 4CBOA 1SFIA 1C2KA 3E3TA 4Y10E 1C5PA 2XWAA 3ZVFA 3UPEA 2AMPA 2HLCA 1FAXA 4Z0KA 1H8HD 2GX4A 1NU9A 1GJ7B 2GZ8A 3RDZA 4AGKA 1GJ4H 2WPIS 1KLTA 3S7KB 3UOPA 5A2MH 1QB6A 3MQKC 1DSTA 3AW0A 1C1WH 2AERH 1MD8A 6GCHG 3M36A 2O8MA 4Y11E 1YPHC 1AWFH 4CBNA 2QF0A 1P11E 3K2UA 1A2CH 1C2LA 1UK2A 3R0FA 2FS8A 3FVFB 1BA8B 1UJ1A 2EI7A 1TX8A 4HGCA 3V0XA 1MTSA 2RCEA 1TNJA 2ZQ1A 3AK5A 1SFQB 3OU0A 5ESBA 3F3BA 1BT7A 3CENA 3I29A 2A7CA 2W6JD 2OK5A 2K0QA 2CV3A 3V13A 2TRMA 4ZHAA 4WH8A 3TGIE 1GI5A 2K1QA 4FUEA 1EFRD 1KDQB 1SI5H 2Y6TA 2ALVA 3UNSA 1TGCA 4B6FA 2YMSD 1ARCA 1VITF 2H1UA 3GY6A 4WXVA 2QXGA 1EPTB 4MDSA 2QE7D 3RUOA 2D26C 2Z3DA 4Q4LA 4B2AA 1GPZA 1YM0A 3SOSA 1N8OC 2KCYA 5F8ZA 5C3NA 1MUEB 1EX3A 3E0NB 2GCHG 4WF8A 1O3LA 1T31A 1O3HA 4Y7BA 1DICA 4WXIA 1BHXF 3RC4A 1K1PA 3TNSA 1BB0B 4ABAA 3MU0A 2A4RA 2BB4A 1CGIE 7GCHG 3GOVB 2STBE 1C5UA 3QO6A 4O03A 1GI1A 1W3CA 3DCLA 1A5GH 1MU8B 4ZHLU 3W95A 5GIBA 1UVSH 1HAXB 3GISB 5JB8S 3KGPA 4ZHMU 1NFYA 1GJBB 4BAQB 1BTPA 2GDDA 3TK6A 4ZMAH 1E1QD 1V2NT 2P94A 1CBWC 1K0HA 2RFKC 3ATIA 2P3FH 1DWDH 2BY9X 1O5AB 1ZSKA 3Q77A 4XDEA 2F9OA 1O2SA 2L74A 2VIVA 1EASA 1C5ZB 1GMCG 2BQ6B 1O3DA 1P2OA 4F48B 1V2JT 4WMEA 3SU5A 2NU4E 1FX0B 1C1SA 1MD7A 1OWHA 1VCPA 2YNBA 2QA9E 3H7OA 1EB2A 1K1OA 3Q00A 1DOJA 2XWBI 1HRTH 2BDBA 2XOKD 2G4TA 3OY6U 3O8CA 1ZRBA 2VH6A 2G55A 3M35A 3EAJA 1HB0B 1ZSLA 1C1RA 1YPJH 5DP7A 1K2I1 1P02A 1F92A 5L2ZH 1C1NA 2ZU4A 2VJ1A 4XBBA 3U8RH 4H42U 2FMJA 2BOHB 1BUIA 4DG4A 4JYTA 1TMTH 1GJAB 1FV9A 5JB9S 4LOYH 3A7XA 1BTXA 2ZU1A 1SG8B 3UIRA 1QURH 2A4GA 2SGQE 1FY3A 4YZUA 1W0ZU 1W0KD 2BOKA 4ZKRU 3SO3A 4CH8B 2V0BA 1HJ8A 1C5SA 1F5RA 4CRBA 4AG1A 3LH1A 2EC9H 1KYNA 1SBWA 2KR7A 4NFEA 1K28D 2ZHQH 5FX5A 1O39A 4TPYA 5LH8A 2ZNKH 2LNCA 5E0JA 3NXPA 4JZFH 4AB9A 3U8TH 3SV6A 1O2MA 2VIOA 5C0TA 1XM1A 1SQRA 1KLJH 4D8NA 4SGAE 2AIQA 2WYGA 4XBCA 3SV7A 3UOUA 1XUKA 2PKAB 3L33A 1IOEA 1O36A 5GCHG 3DSPA 4GLYA 1WCZA 3OAAD 4U01A 1QB1A 4XSKU 2IPQX 2QXHA 1ANBA 1Y59T 1K9OE 2BY7X 1O5FH 2BD4A 3UQOA 1CSOE 5AVDA 1V2OT 2I6QA 3DFJA 4OS5A 4UONA 2AMQA 1SGQE 4O9VA 2VIWA 1YF4A 3RMNH 3PO1C 2KM0A 1EZQA 4NIVA 5HYOA 1Y3VA 1IHTH 4RT1A 1TWXB 3M7TA 1H8IH 2NWNA 3S9CA 3SJIA 3UQVA 1TGBA 3K6ZA 2AIPA 4NZLA 3ZZCA 1TNIA 1L0ZA 3LC3A 4JZ1A 3SNEA 1IQGA 2RDLA 2LPRA 1W0YH 1HAHH 1F0UA 3RU4E 1CHOG 1PQ7A 1TBZH 2WUCA 2JH6D 3MU5A 4X1RU 1NZQH 1QRXA 1ID5H 3SQEE 1KIGH 3F9FA 1O3AA 2ZQ2A 1BMMH 2OCVB 1TRMA 3PV5A 1N6XA 4ISHH 3RXQA 5EGMA 2UUYA 2W6ID 3GCHB 4WWYA 1EZUC 1FUJA 3P17H 2GGVB 2W7SA 4FUBA 1HJ9A 1O2GH 2FI3E 5AFZH 1QIXB 1GBLA 2VVUA 2WHXA 1BHXB 1IQNA 3N7DA 3RXOA 1KSNA 1XUIA 1H8DH 3PRBA 3BTME 4AX9H 3BTHE 3M5NA 5DG6A 4I8LA 1GI4A 2Q6FA 5E2OA 1BJVA 2CMYA 3C27B 3GY2A 1KXDA 5JBAS 2DUCA 2BDYA 2EY4C 2P3TB 3KQDA 3HK6B 3BTWE 3GDUA 1O32A 2I6SA 3NPSA 4Y6DA 3ZV8A 1H1BA 3MWIU 1O2NA 3BN9A 3ZZ7A 3URDA 1LVYA 3M3VA 5C1YA 5T3HA 5CHAC 2FYRA 1YP9A 1FIWA 1C5XB 1WTGH 2OQUA 2WUBA 3P8OA 4A6LA 1V3XA 3NCLA 4NZQA 5KGOA 3A7WA 3VEQB 2GV7A 4DT7B 4X1SU 1K21H 2ZDLA 3GY4A 4PROA 2PUXB 3TH3H 2J92A 2JJ2D 1HBTH 2ASUB 4JZIA 4BXWA 4FOUC 5AFYH 2B8OH 1O35A 2Y5FA 2XC4A 2Z7FE 2ZKSA 3ATMA 4LZ1H 4OS2A 2FOGA 1FY1A 1O2KA 1SVPA 3T62A 1O2LA 2FTMA 3MU8A 1YPGH 3F0OA 4UE7H 1LTOA 1NO9H 4YOGA 3A7TA 1QBVH 1HNEE 1KXFA 1CHGA 5I46H 5DPAA 3MTYA 1JOUB 2BM2A 2ZGXH 1RXPA 3LGYA 2FOAA 3P70B 1MAYA 1W7XH 1IAUA 1GVZA 1TFXA 3F1SB 2PKSC 1WDIA 1W10U 2RDEA 2AHME 2FPZA 2RG3A 2KCAA 1EAIA 2BYAX 2VH0A 3NZIA 4F55A 6LPRA 1SGCA 3P8NA 3QX5H 1CA0B 2Z9LA 4DW2U 2J9NA 1ELVA 1DLKB 5EIYA 1VR1H 3SJOA 1A46H 1Y5BT 3H5CB 1F5LA 1KTTB 2F9BH 1YLNA 4Y0ZE 1EZSC 1ZMNA 1UVUH 1L2EA 4ISLA 1ANEA 2GMTB 2F43B 1C1OA 1IQKA 1G2MA 2JETC 4RKJB 1LHFH 1O3FA 1GBJA 4BAOB 1QL9A 3OE7D 3SGAE 3U28C 1B7XB 3UNQA 4R8TB 1OHHD 3LONA 2SFAA 5HM2A 3NWUA 2FYQA 3O8DA 3H09A 1B0FA 4Y8YA 1LVOA 1EZXC 2QYIA 3KHVA 3FAOA 1ZHPA 4ZXXH 3PMBB 5C67A 2ZI2H 2R0LA 4FU7A 2C8XB 4MPXA 4GUXA 3D62A 4AZ2B 6CHAC 1ZMJA 2OXSA 3SHAH 3FKSD 3MH4A 3B23B 1BOQA 5EPNA 1E36B 4ABDA 3S0NA 4IC5A 3ITIA 2HGTH 2ZCKP 1WQVH 1V2TT 3DD2H 1AUJA 3CP7A 3ZVBA 1FJSA 2GT7A 1VITG 2VGCC 1YYY1 2H5CA 5A0AE 4B76A 5AF9H 1A5HA 1WSSH 2PP6A 3TJOA 2BY5X 3DSGA 1Y3UA 1LPGB 3F0PA 3GDSA 3HGNA 4X2YA 4XD7D 3S69A 2SNWA 4K3JA 1ABJH 3M3TA 2ZFRH 2Z94A 4DIHH 3DFLA 2GCHF 4IN2A 4AOQA 1QQUA 1TBQH 4E05H 1DUAA 1OWDA 2ZHFH 1JRSA 4LZ4B 2FI5E 5DP9A 3QK1A 1ESBA 4ACBA 3A7ZA 1T8LA 5EG4A 5E0GA 4JYUH 3U8OH 1P57B 7LPRA 3OSYA 4JZDH 5C20A 1SGTA 1WUNH 2XRCA 1ZR0A 3RMLH 1QTFA 4X1NU 1OX1A 2JH5D 1SGRE 3ELAH 1GBMA 3KQCA 1TPSA 2GZ9A 3OEED 1S6HA 2CF9H 3M7QA 3RXPA 3EA8A 2A0QB 1E35B 1UHBB 1MMJN 3PLPA 4K1TA 1C5LH 2VIDA 3STIA 1WXRA 4NIXA 3LGUA 3PLKA 1MTNB 3P6ZB 1DT2A 1TA6A 1P04A 2XBXA 1AFQB 5BRRE 2THFB 1P2JA 2Y81A 3F9GA 1CT4E 2TGTA 1BCUH 4H4FA 3EGKH 4ABJA 4CHAB 1FDPA 1HAPH 3E90B 1FPCH 4I33A 2CK3D 1C1QA 1CT2E 1MKXH 1GJ5H 3BEFB 1YC0A 4FUJA 2B9LA 2FWWA 4LK4A 2P95A 2UUKB 1D3PB 1GBEA 8LPRA 1VKYA 1ZLRA 2BDCA 2AMDA 3PLBA 1UTQA 3M5MA 1WOFA 1EKBB 2HLDD 1TA2A 1S82A 1T4VH 3GCTF 5FAHA 3UAIC 1P2NA 1UVPA 1SL3A 2ZWLH 1GGDC 2ZDAH 1LPKB 4JCNA 3RXLA 2ZFQH 1QY6A 3RXFA 4NWKA 1O3OA 1GJ9B 2BVSH 1OPHB 1OS8A 2XBYA 3BG8A 1C2FA 4KP0A 2OC0A 3T5FH 1NRRH 5HIZA 1B0EA 2Y5HA 1GBBA 3TH4H 1W0JD 1FI8A 3SGQE 3ZYEA 3U1JB 3FOAA 3GDVA 2GD4B 1G9IE 4TWWA 3IG6B 2WPDD 3GCTG 4MNXA 3ZZ5A 4A92A 1SGFG 3GCOA 1PPFE 2VIQA 1FQ3A 1GHAG 4GVUA 1P01A 3AW1A 1JXPA 2TPIZ 2OINA 2NU2E 3BTDE 1O3GA 1AZ8A 4A1XA 2SGAA 1NBMD 2B0FA 1P8VC 4YXWD 1P09A 4TT3D 3SNAA 2J38A 3A88A 3TLOA 1CBWB 1GVLA 1YPKH 4AFZA 5F6MA 2YMSC 1RIWB 3QWCH 2HALA 1LCYA 2O8UA 2BHGA 4DCDA 1BTUA 2P59A 5JPMH 1S5SA 1CA8B 3CS7A 2BXTH 2HNTC 1A0JA 5B6LA 5GPIB 1BTHH 5C5NA 2YOLA 3TPIZ 2A7HA 3A82A 1THPB 2BZ6H 1CGJE 3DA9B 1S85A 4B73A 2YNAA 3SHCH 3TH2H 1SHHB 4ZCNA 3JZ1B 5EOKA 1TOCB 2GTBA 1QL7A 2A2QH 1C5YB 4YO9A 5T6DA 1COWD 3A85A 1RTFB 1BMLA 3S9BA 3RXTA 2BLVA 3UB0A 1FN8A 4JMYA 1MQ6A 5TCAA 5DP8A 5LPFA 5CHBA 3LPRA 1GBTA 2Y5GA 5T1VA 2WZQA 4AN7A 1K1MA 4DT4A 2OUAA 2BD8A 1K1NA 3GY3A 1O2IA 1O2XA 1OYQA 3RXIA 1KY9A 3ESTA 2ZG0H 5ETXA 3BEIB 5FHTA 4YTAA 4AG2A 5C2ZA 1V2MT 1QFKH 1S6FA 1RRKA 1WU1A 1NN6A 1KXBA 1PPEE 3MH7A 3SNDA 5EJZA 1V6DA 2F4LA 2NU1E 1TQ7B 1AQ7A 3ZVEA 3QN7A 3DT0H 4BTIB 1ZTKA 1LMWB 5EU8A 2XW9A 1AVXA 1S83A 4BNRA 1O3NA 2F91A 2C8YB 7ESTE 3A84A 4Z1MD 1RTKA 4J1YA 2ZDNA 3E8LA 4BAKB 5CHAB 4X1PU 2ZU5A 1O37A 3K6YA 1JRTA 2OLGA 2J98B 1G32B 1JIMA 3A81A 1KXAA 1HXEH 1J17T 2CHAC 1QL8A 2XCFA 1F7ZA 3SJ8A 4X1QU 4F49A 2PUQH 1FMGA 1O3CA 1W11U 3A83A 1GHWH 2PGQB 2GZ7A 1O33A 1HAOH 2W5EA 3B9FH 5F8XA 5HM9A 5JBTA 2UUJB 1KTSB 1A5IA 1W8BH 2WPKS 4ZKNU 2FTLE 1D3TB 3BG4B 1P2QA 1UTOA 3Q76A 5DGJA 4GHTA 1THSH 1ETTH 1EB1H 1TGNA 3D65E 3V12A 3LKWA 1A4WH 1NRNH 4DVAU 3OX7U 1O2HA 4TY7A 1BMFD 2FLBH 3ZVGA 1CE5A 3FANA 2V6NA 2G81E 1DANH 1V2VT 1H8ED 1WAYB 2AGIX 4MQAA 1G3DA 1SHYA 1N6YA 2G51A 2PSYA 3RM0H 3FFGA 4MPVA 3RM2H 3N7EA 1AI8H 3ZYDA 2VNTA 1F0RA 2Z9IA 3BV9B 2A7JA 2ODPA 3SZEA 4ZXYH 3SU0A 3TNTA 3HGPA 1ABIH 2PW8H 3VXFH 5GCHF 2P16A 4ZROA 4GAWA 3UTUH 1QCPA 1Y5UT 3T28A 1HDTH 1YWUA 2WV5A 1TRYA 1SGIB 2CN0H 1Q2WA 1ETRH 1GHZA 1OSSA 2F9VA 3P95A 2VWNA 1LO6A 2GJGA 2BMGB 2DE9A 2BXUH 3BEUA 3BIUH 1JBUH 1GHVH 1GJDB 1OP2A 1P03A 3ZV9A 1NBME 3SV9A 3A8BA 5IDKA 5T6GA 2BD2A 4KKDA 4DGJA 3SU3A 1A3BH 1SSXA 1SQAA 3PB1E 2XYAA 1TABE 4I32A 3TJVA 2TIOA 3OY5U 9ESTA 1H9IE 5FX6A 1C1UH 1ZZZA 4ASHA 5LPEA 3SV8A 4P00A 2VU8E 4FUIA 2ZECA 3MYWA 4CRGA 5KEDA 1SGDE 4K69A 3D23A 2ZHWH 5GJ4B 1BRUP 1HJAB 1EQ9A 1RTLA 3ENSB 2F9NA 3F9HA 3AAVA 1VJAU 1YPEH 1UK4A 1ELEE 2AS9A 4B1TA 1DXPA 4WMDA 1LHCH 4Q2KA 2BD9A 2F9PA 2D1JA 4U2WA 3FZZA 5L2YH 2UWPA 4U32A 3FP6E 1RIWC 4B71A 2M2AA 2H6MA 4JYVH 3RU4T 1ZPZA 1TNGA 1OOKB 4IMZA 3A87A 4NWLA 1SB1H 4ZKSU 4D76A 3SI4H 3AVZA 3GYMA 1NESE 4AORA 3AAUA 4NGAH 1SGNE 3SNCA 3KIDU 1P2KA 1ELCA 2G00A 4DY7B 5K7RA 2C3SA 2PTCE 1F2SE 4ISIH 1GMHG 3RXJA 1DS2E 1ACBE 1AWHB 2AGGX 3GS9A 4ESTE 3GCHC 1DFPA 3RP2A 3EE7A 3RLYH 1T4UH 1H4WA 2TGAA 3Q3KA 2J2UA 3GY8A 2ESTE 3FP7E 1TMUH 3VFEA 4E7NA 4I8HA 1XUGA 2GCTC 3BTKE 1YLCA 4NFFA 1GI7B 1GCTB 1G37A 1J16A 1D6WA 1ORFA 4M7GA 2QN5T 1NTPA 3ZVAA 8ESTE 3ZZ3A 1FAKH 2JIZD 1C2HA 2OBQA 4CR9A 4MNYA 3D49H 2P8OC 1XXFA 1Z6JH 2ZHEH 4AYYB 1EJMA 1DY9A 2C8ZB 2J4IA 4YLUA 2A2XH 5J4SA 2BD7A 1HJAC 2R0KA 3HKIB 1DVAH 2PHBA 3T29A 3SV2H 3NKKA 1BTYA 3T26A 1DITH 1EJNA 1NFUA 2ANKH 2PLXA 1XXDA 3RXHA 1TOMH 4OGYA 4WVPE 4UD9H 3SJ9A 5F53A 4UEHH 1DDJA 1ZMLA 4YM9A 1YLDA 1MTNC 2UWOA 3SGBE 1AFEH 3ZZAA 1MKWH 1ZJDA 2CF8H 1GHYH 3QLPH 1HAVB 4AC9A 1OXGA 2BDIA 3SBKA 2GP9B 5A8ZA 1O0DH 4KELA 5EJ1A 1GHXH 5E2PA 1C2IA 1UCYE 4JK5A 4WJG2 3RXAA 1IQLA 3KQEA 3DSOA 2QAAA 3GCNA 4YT7H 1PQ8A 1FLEE 3LDXH 3MNSA 4I31A 1T8NA 1VGCC 1MKXK 4Y7AA 1F5KU 1LKBA 1SLWB 5ABWA 2ZCHP 2KFWA 1Y8TA 2GKVE 4Y8XA 2A5IA 2XBVA 2WYJA 3DUXH 1GDNA 1CO7E 2FOEA 2KZ4A 3ODFA 1V2ST 2C90B 2OBOA 1FY5A 3RXBA 5GWZA 2XNIA 4BTTB 1DWBH 5DK1A 2ILNA 1BJUA 3SNBA 2PSXA 5DSFA 4H6TA 3DHKH 3C1KA 1KXEA 2Z3CA 2NU3E 3QGJA 2NU0E 3M3SA 1MH0A 3UFAA 1ZRKA 1OP8A 1UVTH 1ZTJA 3F68H 3P8GA 4D9RA 1JIRA 1D4PB 1T8MA 2V3MA 4GHQA 1QR3E 1O3KA 2VINA 6CHAB 2ODYB 1A0HB 1SC8U 5C94A 1ARBA 1Y3WA 2QF4A 1EOLA 3TVJB 3OFND 5F03A 2OC7A 1Z8JB 1A61H 5DKMA 2GDEH 3LC5A 3SU2A 3L6PA 1AKSA 3EA7A 5DN6D 1S81A 2FOMB 4A5TS 1SGEE 4X2XA 1LVMA 4X8TH 3A89A 5FPSA 3KNXA 1TX7A 3NRLA 5EXNA 2BY6X 3SN8A 1ELTA 5E0HA 3O8BA 3BTTE 4RI0A 5A0CA 3PTNA 4XFQA 3PV4A 1W13U 1ZOMA 1GDQA 1IQFA 1O2RA 1ZTLA 3M61U 3M7UA 4YLQH 3SUGA 3QZQA 4RKOB 1QQ4A 1T8OA 4X0WU 1CT0E 2IJOB 1GHBG 1PPZA 3MU4A 4FUDA 4YT6H 1Z7KA 1BBRH 5GNDA 5C1UA 4FUGA 1P9UA 1O3EA 5DJ7A 1K1IA 1QJ6B 1TLDA 1F0TA 1W12U 3VB7A 2FOBA 2QF5A 4D7GA 1NRQH 3PM3A 1C2MA 2UUFB 3SORA 1C4U2 5HXFA 1YBWA 2LELA 3FO8D 1HGTH 1NFWA 4FU9A 1CA0C 1UTKA 1QGFA 1SMFE 2ANMH 2OP9A 2OC8A 4Y76A 5EXMA 1O3MA 4CRCA 3PROA 1GHBF 4OS4A 1GI3A 1RJXB 2QY0B 5FPYA 2FI4E 3MNCA 3KYFA 1GBAA 2F83A 3P8FA 3MO6A 1UTNA 3QUMP 3PMHB 2QXIA 2FO9A 3VB3A 5L6NH 5C17A 4NA8A 1E34B 2QCYA 1DUEA 1ZPBA 1IQEA 4ABFA 2A5AA 5E8EH 1UHBA 3NK8A 5JYIA 2ZU3A 5EJLA 1ESAA 4F4OC 1DXWA 1GMCF 1TNLA 4O97A 1SQTA 4DIIH 4MNWA 2ZF0H 1EAXA 4IW4E 1V2PT 4OS6A 4DJZB 2VWMA 3EDXB 1D9IA 1WYKA 2OTVA 4NA7A 1MBMA 2L6OA 1NS3A 4BOHA 1XVOA 1HAIH 3BTGE 4A7IB 5FCKA 1Y5AT 4A1VA 1AU8A 1NU7B 2J98A 1HAYB 1C2GA 2H2ZA 1A7SA 3N7OA 1YGCH 2PV9B 7KMEH 2XC5A 1QB9A 2YMSB 5EQRA 2WSSD 1P9SA 1BTZA 2H9TH 3RU4D 4K1EA 3KN2A 4ZUHA 5TCCA 2FP7B 4XRNA 1BMAA 1SLXB 4XBDA 2EI6A 4FVDA 1HPGA 1TGTA 2VVCA 3RXVA 1SGPE 1GBHA 1O2JA 3E0PB 5H4IB 3I77A 2R9PA 2SNVA 1GWAA 1EP6A 1AKSB 3KYGA 5LGOA 4CREA 5HKKD 3LGIA 2BDGA 4FUCA 4FUFA 1W14U 3SUFA 4ABEA 1LPZB 4NSYA 1K1LA 2RA0A 3SI3H 2AGEX 1D3QB 4O3TA 2PWXA 1CHOF 2FXRA 4CR5A 3TITA 1BBRK 1PQ5A 5HIYA 2FIRH 2B7DH 3EYDA 4B74A 1NFXA 1TRNA 3MH5A 1K1JA 4Q7XA 1RS0A 2A5KA 4B75A 1MU6B 2C93B 1C1TA 2BX4A 1HAZB 3MU1A 3RC5A 4KTCA 3BIVH 3RXEA 2Y80A 1QNJA 1TGSZ 3KL6A 5EQSA 2ZFFH 1L1NA 1L4DA 4J2YB 3MH6A 4ASUD 2KAIA 1OWJA 1OYTH 5TJXA 5EODA 2HOBA 1CVWH 5BPEA 4NSVA 1NC6A 1TB6H 4Z6AH 1MAXA 1AVWA 1HYLA 3PO1B 5G4BA 1EPTA 2OQ5A 1VGCB 4M9FA 2A4QA 1OKXA 1ELBA 1IQIA 2FS9A 1LQEA 1EJAA 1KXCA 2GT8A 1P0SH 3MOCA 4E06H 5C1XA 3VB6A 1Q31A 4BXSA 1E0FD 2HNTF 4DURA 1TPAE 1CQQA 4K8YA 2ZHDA 3F2FA 2SGEE 4WH6A 4CH2B 4D9QA 1P12E 1QA0A 1NPMA 2G5VA 1O3JA 5EPYA 2IJD1 1ZGIA 2IPHA 1ZHRA 5T6FA 1SQOA 2CXVA 2ZFSA 1YY3A 1Z8IB 4NCYA 4OM9A 4FXGH 2ZGHA 1MQ5A 1PQAA 2XTTB 4AFSA 3BTQE 4BAMB 1BBRE 2CJIA 1GL0E 4I8JA 2QGRA 2VWOA 1C4V2 1VZQH 2ANWA 1C2JA 1DM4B 2V7QD 5GDSH 3RMMH 5LPRA 1WQSA 4MVNA 2OD3B 2IN2A 3ATWA 3RXDA 3BTEE 2LP6A 1IHSH 1T7CA 2HNTE 1G3CA 4IN1A 3JZ2B 3LGTA 1XX9A 4ZAEA 3R3GB 2Y7XA 1MTUA 3PMAB 1HXFH 2BZAA 5GXPA 1XMNB 2H5DA 2Y82A 3BF6H 4FETA 5F8TA 1AFQC 4I8GA 5FXLA 1LVBA 1BITA 1DWCH 1V2WT 4U30A 3SUDA 1C5QA 2G5NA 3MO9A 2A4OA 1EP5A 2SGFE 1PPCE 1QHRB 1YCPK 2ULLA 2STAE 1XUHA 3LIWA 1ZSJA 1ELGA 5C0UA 1ESTA 1UCYK 3TGJE 2BQWB 4ZH8A 2V35A 3VB4A 1SLUB 1AB9C 3M5OA 1VCQA 1G2LA 3SQHE 2PGBB 3EQ0H 2ODQA 1EXFA 4TSFD 2W7UA 2HRVA 1AN1E 4JZEH 1FZZA 1RD3B 3OTJE 1TX6A 2G8TA 3HK3B 3V3MA 4FU8A 1XKAC 8GCHF 2ZGCA 3MFJA 3RXRA 4INHA 4B6EA 2JETB 1EATA 1O30A 1SR5C 4P02A 2P8OB 4Q7YA 1V2KT 4Q63A 2GMTC 4TPIZ 3K65B 2ANYA 3OTPA 5J4QA 2BVRH 1V2RT 1YCPH 1Q3XA 1AO5A 3A8AA 4HTCH 1Z1JA 4TY6A 3RLWH 4I8KA 1O2VA 2KCOA 1MKWK 1XUFA 1HV7A 2ZA5A 4AYVB 3W94A 4IBLH 3RXSA 1UCYH 3FZDA 3I78A 2ZTXA 3UR9A 5JDUB 4WMFA 3FP8E 1HFDA 1O2TA 4A1TA 1N8OB 1GBFA 3MMGA 2F9UA 3IWMA 2TGDA 5FCRA 1FPHH 1HIAB 2FEQH 2EEKA 1QBOA 4AFQA 2BX3A 2ZPRA 1SGFA 1J8AA 3WY8A 1GI2A 5DP4A 2PKAA 1EAUA 1ZYOA 1ZGVA 4HFPB 3TIUA 3VGCB 1K22H 1O2ZA 2BVXH 5A09A 4HI3A 2Z9JA 3LJOA 1GDUA 3TGKE 1V2UT 2Y7ZA 2XC0A 1QZ8A 3TJNA 5A8XA 4WY3A 3EA9A 3LOXA 1LQDB 1QRWA 1GBDA 1X7AC 1DPOA 1TYNA 1OWKA 3MO3A 5EW1H 5KECA 2FOCA 4FUHA 1D3DB 1C5WB 3WW7A 4R0IA 2AEIH 3HPTB 1C1VH 2WPLS 4IC6A 4UDWH 3CS0A 2VWLA 5HGGA 5A0BA 2W3KA 3F9EA 1G36A 4TWYA 1TPOA 4YOIA 2Q1JA 1UTLM 3BTFE 2VGCB 2FOHA 4X2VA 3RXKA 7GCHF 2FOFA 3GYLB 4I86A 4XE4A 4UFFH 4AFUA 3ZVDA 3NUMA 5B6OA 1GBCA 1TQ0B 2WINI 1AIXH 2VB0A 3SU4A 2GVFA 3KQ5A 4TYDA 1ELAA 1KMHB 4IGDA 3UY9A 1OP0A 4ZKOU 4GCHG 1AE8H 3U9AH 2VVVA 4OGXA 4ABHA 1NM6A 2PTNA 3B8JA 2ZU2A 3H7TA 4GSOA 1OWEA 1ELFA 4X2WA 1HUTH 5K0HA 2QIQA 2QV1A 1RFNA 4Q7ZA 3PMJA 1DWEH 1SGYE 1IQJA 1PJPA 2JH0D 1AMHA 4KGAA 1O2PA 2EI8A 1GMDG 2A1DB 1C4Y2 1EOJA 2QXJA 2ALPA 2V3HH 2ZFTA 2G4UA 2HPPH 1TE0A 2FESH 2ZIQH 1LHGH 3STJA 1LDTT 2HPQH 3F2HA 2FX6A 2P3UB 2QC2A 4YESB 2M5TA 1AHTH 5IYTA 3Q3XA 1GBIA 1ELDE 2D2DA 2HVXA 3PWBA 2ZC9H 4OS1A 1GCDA 3QTVH 1TAWA 3S7HB 1WTHD 2Z6BD 1BTWA 1BZXE 3K9XB 4YOJA 3ZZBA 1FY8E 3U98H 1GHAF 1O2OA 1GMDF 1O2YA 1TIOA 1E38B 2ZPSA 3F6UH 4MNVA 1Y3XA 2ZZUH
chains in the Genus database with same CATH topology
1NBME 5EQQA 4NWKA 5H4IB 3SV9A 1W3CA 2VBCA 3DCLA 5IDKA 1SKYE 2XNDD 1S6LA 3SV7A 2OC0A 2JJ2D 2IJOB 4FETA 3SU3A 5HKKD 3LOXA 3DSPA 4B76A 5F53A 1W0JD 3F2GA 3SUFA 5IK2D 3OAAD 4U01A 4I32A 5GNDA 3PRDA 3SUDA 3F0PA 3U1JB 3FOAA 4XD7D 3SV8A 2XCFA 1E1QD 2WPDD 2WV9A 3F0OA 3OYPA 2QF5A 3WW7A 4A92A 3EYDA 4B74A 5GJ4B 1H8HD 1RTLA 1JXPA 2OINA 2KM0A 4B75A 2LELA 3FO8D 4A1XA 3DSOA 5C0UA 1NBMD 3RC5A 3SUEA 1DXPA 4I31A 4YXWD 4KTCA 2O8MA 4TT3D 2OC8A 3SU5A 1FX0B 2KFWA 3M5OA 1DY8A 5EQSA 2YMSC 3WWBA 3KF2A 1RGQA 3O8RA 2AHME 4ASUD 2KCAA 5FPYA 4B71A 2P59A 2M2AA 2KZ4A 2XOKD 4F55A 2OBOA 3P8NA 3O8CA 3LKWA 4TSFD 4NWLA 5CDFE 1E79D 3SU4A 5GPIB 5B6LA 2GVFA 4TYDA 3AK5A 1KMHB 5C17A 2XNIA 2YOLA 3N99A 1A1RA 1BMFD 3FN8A 3SU6A 3KEEA 4B73A 5ESBA 3WWFA 4M9FA 3PV5A 3F3BA 1BT7A 5DSFA 2OK5A 2A4QA 2W6ID 2W6JD 3OEED 2K0QA 3OEHD 4K8BA 4ZCNA 1H8ED 1DXWA 4WH8A 4B6EA 2GGVB 1WXRA 2F43B 2K1QA 1EFRD 3GS9A 5FL7D 4Q63A 1COWD 2QV1A 2KCPA 3SU1A 3U1IB 3N7EA 4B6FA 3F2FA 2WHXA 3OTPA 3RC6A 3OE7D 3N7DA 4WH6A 2OC1A 3UB0A 4JMYA 2YMSD 3ZIAD 2K8IA 3PRBA 2A4GA 2XCNA 2L6OA 1NS3A 2KCOA 3SZEA 2JDID 3SU0A 3VG8A 5CHBA 2QF4A 3W1EA 3E90B 3M5NA 3OFND 4I33A 2CK3D 4R8TB 2IJD1 2QE7D 1OHHD 5EPYA 3SYJA 4A1VA 1E1RD 1W0KD 2WZQA 3LONA 2OC7A 2J5UA 4Q4LA 5T1VA 4DT4A 3O8DA 3F2HA 3H09A 3SU2A 1CU1A 2KCYA 3L6PA 5DN6D 2FOMB 4OM9A 4A1TA 5ETXA 2F9UA 2YMSB 2KR7A 5EQRA 2WSSD 4WF8A 1MABB 2JJ1D 3PV2A 5FPSA 3KNXA 2JIZD 3M5MA 2F9VA 3NRLA 3KN2A 2OBQA 2HLDD 5FPTA 2F4LA 2FM2A 3O8BA 2FP7B 3RC4A 3FKSD 2V7QD 4RI0A 1N1LA 5EPNA 1DY9A 3SV6A 3P8OA 5C0TA 2A4RA 4Z1MD 3SUGA 3M5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZ4 A;  2KCA A; 
#chains in the Genus database with same CATH topology
 3URC A;  1ANC A;  1ZPC A;  2Z9K A;  1S6L A;  4K1S A;  2AH4 X;  1H9L B;  2ZPQ A;  1O38 A;  3M37 A;  1O5C B;  1P06 A;  4OS7 A;  1TNK A;  3Q3Y A;  5SGA E;  1C5M D;  3A7Y A;  1U6Q A;  1TNH A;  3E16 B;  8KME 2;  1ZHM A;  4VGC C;  2Z3E A;  3BG4 C;  2P93 A;  1ZJK A;  2FLR H;  2O9Q A;  5EW2 H;  2ZGJ A;  2GV6 A;  1GJ6 A;  2WPJ S;  2H9E H;  1XUJ A;  1GI0 A;  1AY6 H;  2J97 A;  1GGD B;  1G30 B;  4NIW A;  1GJ8 B;  1NY2 2;  1WBG B;  3KCG H;  5EST E;  2B5T B;  1BRA A;  4X6P A;  2AFQ B;  3E91 A;  3SJK A;  3WWB A;  1DY8 A;  1A0L A;  3QDZ B;  4IS5 A;  4Q80 A;  3P92 A;  1V2Q T;  3ZZ8 A;  1C5N H;  2Q6D A;  2BLW A;  3PWC A;  2R2M B;  3SW2 B;  1SOT A;  4K2Y A;  3RXU A;  4CHA C;  1A1R A;  1Z71 A;  4SGB E;  1VIT H;  3HAT H;  3WWF A;  4LXB H;  3ATK A;  3BSQ A;  1O31 A;  1HLT H;  3L3T A;  1Z8R A;  3GY7 A;  1LHE H;  2ZEB A;  3LH3 A;  2ZDK A;  5FL7 D;  1KDQ A;  3A7V A;  4X6N A;  3LGV A;  5A8Y A;  2KCP A;  2HVY B;  3U1I B;  1AB9 B;  4MG3 A;  3VGC C;  4AB8 A;  1PFX C;  3RC6 A;  2OC1 A;  1UTM A;  4UFG H;  1YCP M;  2K8I A;  1IQH A;  1DX5 M;  1B5G H;  2JDI D;  2BTC E;  2ZP0 H;  5EXL A;  1JWT A;  1UTP A;  1EAW A;  3W1E A;  2O8T A;  2O8L A;  3SYJ A;  1QA7 A;  1QJ1 B;  1CGH A;  2IOT A;  2BLQ A;  1GG6 C;  2ZTZ A;  3T27 A;  1AGJ A;  1CU1 A;  2PR3 A;  2R3U A;  1FIZ A;  1FNI A;  1MTV A;  1T32 A;  1PPB H;  1QJ7 B;  3HKJ B;  1AZZ A;  1GJC B;  1C5R A;  1BMN H;  1NRS H;  6EST A;  1BIO A;  2JJ1 D;  3PV2 A;  4RT0 A;  4XOJ A;  2SGD E;  4Y79 A;  2UWL A;  1UO6 A;  4RSP A;  1WV7 H;  1NRP H;  3UUZ A;  2ZDM A;  3VPK A;  1OWI A;  1BRC E;  3MHW U;  1GBK A;  2TGP Z;  2ZCL P;  1C1M A;  1C5O H;  2BD3 A;  2Q6G A;  1SKY E;  5AHG H;  3PYH A;  4BAH B;  4CRA A;  1DE7 H;  2C4F H;  2FOD A;  1LHD H;  2PFE A;  1AND A;  2BY8 X;  4ACA A;  1P2M A;  4GPG A;  4B2C A;  1YKT A;  3A8C A;  2XBW A;  4X8U H;  1MCV A;  3OYP A;  3AAS A;  3CNR A;  4MPW A;  3TK5 A;  1W7G H;  3V7T A;  2BLO A;  1MCT A;  2FDA A;  5I25 A;  2FZZ A;  3LGW A;  1L4Z A;  1O3P B;  1TAL A;  1P3E A;  4UFD H;  3ZZD A;  3RXC A;  3TK9 A;  4CRD A;  2D8W A;  1G3B A;  5DP3 A;  1D6R A;  2J95 A;  4ABB A;  1J9C H;  1P3C A;  1NT1 A;  3T25 A;  1A3E H;  4E7R G;  1Z1I A;  5CDF E;  2WPH S;  3A80 A;  3N99 A;  1GI6 A;  3FN8 A;  3SU6 A;  3OEH D;  3ATL A;  2EQN A;  3MI4 A;  2W26 A;  1C5T A;  2HWL B;  1UK3 A;  1O2U A;  4MTB A;  1TON A;  3SU1 A;  4O3U A;  1GVK B;  1C1P A;  2O8W A;  3ZIA D;  2XCN A;  2W3I A;  3MNB A;  1FXY A;  4MPU A;  1DSU A;  5DP6 A;  4I7Y H;  4HG6 A;  1P05 A;  3RMO H;  1NRO H;  1J14 A;  4X6M A;  2KX4 A;  5DO4 H;  2GCT B;  2R2W U;  4FVB A;  1FON A;  1XKB C;  1JMO H;  1BQY A;  3UNR A;  1GG6 B;  3SZN A;  1E37 B;  1GI8 B;  1O5D H;  1MAB B;  4AGJ A;  2A32 A;  3QGN B;  1UTJ A;  4Y71 A;  4B2B A;  2BD5 A;  2ZFP H;  1L1J A;  1GL1 A;  3ODD A;  3TU7 H;  8GCH G;  2ZO3 H;  1HAV A;  1MBQ A;  1INC A;  4X8V H;  5L30 H;  4MLF B;  4Y0Y E;  2G52 A;  3ZZ6 A;  3ZVC A;  1TBR H;  3E1X B;  1LKA A;  3KQB A;  1FY4 A;  3M5L A;  2BQ7 B;  1EPT C;  3RXG A;  2VBC A;  2BDH A;  3QZR A;  3MNX A;  1O2Q A;  2RA3 A;  1Z6E A;  3F2G A;  3UWI A;  5IK2 D;  1YPH E;  5JBB S;  3UWJ H;  1P10 A;  3PRD A;  1SPJ A;  1TMB H;  4NA9 H;  1KLI H;  1L1G A;  2WV9 A;  4X8S H;  2Z9G A;  3GIC B;  4INK A;  2F3C E;  4IMQ A;  1HAG E;  2J94 A;  1QRZ A;  1Z8G A;  1O3I A;  3SUE A;  1PPH E;  2EA3 A;  1O5G H;  5FBE A;  4QT8 C;  1W2K H;  2H9H A;  2KAI B;  1GCT C;  4HZH A;  1G3E A;  1V2L T;  3TJU A;  1M9U A;  1RGQ A;  3KF2 A;  3RXM A;  3O8R A;  4K60 A;  1UVO A;  4ISN A;  1MZD A;  3UR6 A;  1BDA A;  3E6P H;  3IIT A;  2ZDV H;  3URE A;  1UW7 A;  4KTS A;  1Y3Y A;  1E79 D;  1IQM A;  1HCG A;  3A8D A;  3LJJ A;  1F0S A;  1SOZ A;  4VGC B;  2PKS B;  4DOQ A;  1HIA A;  4KTU A;  3KEE A;  3A86 A;  4ABI A;  4ABG A;  1AD8 H;  2VIP A;  5FBI A;  4INL A;  1ETS H;  4K8B A;  4NG9 H;  1SLV B;  2DE8 A;  3VXE H;  4BTU B;  1YPM H;  4JK6 A;  1MZA A;  4RN6 A;  2AYW A;  2TBS A;  2V3O H;  4THN H;  5HMA A;  2J34 A;  3U69 H;  3S9A A;  1PPG E;  3ZZ9 A;  5C5O A;  1MTW A;  1H9H E;  9LPR A;  3VG8 A;  1O5E H;  5PTP A;  1AVG H;  2R3Y A;  5CMX H;  1C2E A;  1P2I A;  1C5V A;  1E1R D;  2J5U A;  1PYT D;  3T2N A;  2A31 A;  2QF3 A;  3LU9 B;  1S0Q A;  3QTO H;  1GMH F;  1UMA H;  2CHA B;  5DP5 A;  1O5B B;  4D7F A;  2FX4 A;  1C2D A;  1QBN A;  3ZZ4 A;  1GI9 B;  5JBC S;  4GCH F;  2WPM S;  2C8W B;  3PTB A;  3VB5 A;  5FPT A;  1TPP A;  1AUT C;  1XVM A;  2FM2 A;  3GY5 A;  1PYT C;  1FN6 A;  2BDA A;  2SGP E;  1N1L A;  2XXL A;  2CGA A;  1AE5 A;  4CRF A;  1O3B A;  1O2W A;  1THR H;  3EE0 B;  4K5Z A;  4UFE H;  1VCW A;  4Y8Z A;  2A45 B;  4H6S B;  1S0R A;  3G01 A;  5EQQ A;  4X6O A;  4ISO A;  1C9T A;  1O34 A;  6GCH F;  1EUF A;  1S84 A;  3LT3 A;  1J15 A;  4BAN B;  5CE1 A;  2XND D;  1YPL H;  4NIY A;  2JKH A;  2WV4 A;  1C9P A;  1BRB E;  1VJ9 U;  2ZGB H;  2ZTY A;  1DLE A;  4CBO A;  1SFI A;  1C2K A;  3E3T A;  4Y10 E;  1C5P A;  2XWA A;  3ZVF A;  3UPE A;  2AMP A;  2HLC A;  1FAX A;  4Z0K A;  1H8H D;  2GX4 A;  1NU9 A;  1GJ7 B;  2GZ8 A;  3RDZ A;  4AGK A;  1GJ4 H;  2WPI S;  1KLT A;  3S7K B;  3UOP A;  5A2M H;  1QB6 A;  3MQK C;  1DST A;  3AW0 A;  1C1W H;  2AER H;  1MD8 A;  6GCH G;  3M36 A;  2O8M A;  4Y11 E;  1YPH C;  1AWF H;  4CBN A;  2QF0 A;  1P11 E;  3K2U A;  1A2C H;  1C2L A;  1UK2 A;  3R0F A;  2FS8 A;  3FVF B;  1BA8 B;  1UJ1 A;  2EI7 A;  1TX8 A;  4HGC A;  3V0X A;  1MTS A;  2RCE A;  1TNJ A;  2ZQ1 A;  3AK5 A;  1SFQ B;  3OU0 A;  5ESB A;  3F3B A;  1BT7 A;  3CEN A;  3I29 A;  2A7C A;  2W6J D;  2OK5 A;  2K0Q A;  2CV3 A;  3V13 A;  2TRM A;  4ZHA A;  4WH8 A;  3TGI E;  1GI5 A;  2K1Q A;  4FUE A;  1EFR D;  1KDQ B;  1SI5 H;  2Y6T A;  2ALV A;  3UNS A;  1TGC A;  4B6F A;  2YMS D;  1ARC A;  1VIT F;  2H1U A;  3GY6 A;  4WXV A;  2QXG A;  1EPT B;  4MDS A;  2QE7 D;  3RUO A;  2D26 C;  2Z3D A;  4Q4L A;  4B2A A;  1GPZ A;  1YM0 A;  3SOS A;  1N8O C;  2KCY A;  5F8Z A;  5C3N A;  1MUE B;  1EX3 A;  3E0N B;  2GCH G;  4WF8 A;  1O3L A;  1T31 A;  1O3H A;  4Y7B A;  1DIC A;  4WXI A;  1BHX F;  3RC4 A;  1K1P A;  3TNS A;  1BB0 B;  4ABA A;  3MU0 A;  2A4R A;  2BB4 A;  1CGI E;  7GCH G;  3GOV B;  2STB E;  1C5U A;  3QO6 A;  4O03 A;  1GI1 A;  1W3C A;  3DCL A;  1A5G H;  1MU8 B;  4ZHL U;  3W95 A;  5GIB A;  1UVS H;  1HAX B;  3GIS B;  5JB8 S;  3KGP A;  4ZHM U;  1NFY A;  1GJB B;  4BAQ B;  1BTP A;  2GDD A;  3TK6 A;  4ZMA H;  1E1Q D;  1V2N T;  2P94 A;  1CBW C;  1K0H A;  2RFK C;  3ATI A;  2P3F H;  1DWD H;  2BY9 X;  1O5A B;  1ZSK A;  3Q77 A;  4XDE A;  2F9O A;  1O2S A;  2L74 A;  2VIV A;  1EAS A;  1C5Z B;  1GMC G;  2BQ6 B;  1O3D A;  1P2O A;  4F48 B;  1V2J T;  4WME A;  3SU5 A;  2NU4 E;  1FX0 B;  1C1S A;  1MD7 A;  1OWH A;  1VCP A;  2YNB A;  2QA9 E;  3H7O A;  1EB2 A;  1K1O A;  3Q00 A;  1DOJ A;  2XWB I;  1HRT H;  2BDB A;  2XOK D;  2G4T A;  3OY6 U;  3O8C A;  1ZRB A;  2VH6 A;  2G55 A;  3M35 A;  3EAJ A;  1HB0 B;  1ZSL A;  1C1R A;  1YPJ H;  5DP7 A;  1K2I 1;  1P02 A;  1F92 A;  5L2Z H;  1C1N A;  2ZU4 A;  2VJ1 A;  4XBB A;  3U8R H;  4H42 U;  2FMJ A;  2BOH B;  1BUI A;  4DG4 A;  4JYT A;  1TMT H;  1GJA B;  1FV9 A;  5JB9 S;  4LOY H;  3A7X A;  1BTX A;  2ZU1 A;  1SG8 B;  3UIR A;  1QUR H;  2A4G A;  2SGQ E;  1FY3 A;  4YZU A;  1W0Z U;  1W0K D;  2BOK A;  4ZKR U;  3SO3 A;  4CH8 B;  2V0B A;  1HJ8 A;  1C5S A;  1F5R A;  4CRB A;  4AG1 A;  3LH1 A;  2EC9 H;  1KYN A;  1SBW A;  2KR7 A;  4NFE A;  1K28 D;  2ZHQ H;  5FX5 A;  1O39 A;  4TPY A;  5LH8 A;  2ZNK H;  2LNC A;  5E0J A;  3NXP A;  4JZF H;  4AB9 A;  3U8T H;  3SV6 A;  1O2M A;  2VIO A;  5C0T A;  1XM1 A;  1SQR A;  1KLJ H;  4D8N A;  4SGA E;  2AIQ A;  2WYG A;  4XBC A;  3SV7 A;  3UOU A;  1XUK A;  2PKA B;  3L33 A;  1IOE A;  1O36 A;  5GCH G;  3DSP A;  4GLY A;  1WCZ A;  3OAA D;  4U01 A;  1QB1 A;  4XSK U;  2IPQ X;  2QXH A;  1ANB A;  1Y59 T;  1K9O E;  2BY7 X;  1O5F H;  2BD4 A;  3UQO A;  1CSO E;  5AVD A;  1V2O T;  2I6Q A;  3DFJ A;  4OS5 A;  4UON A;  2AMQ A;  1SGQ E;  4O9V A;  2VIW A;  1YF4 A;  3RMN H;  3PO1 C;  2KM0 A;  1EZQ A;  4NIV A;  5HYO A;  1Y3V A;  1IHT H;  4RT1 A;  1TWX B;  3M7T A;  1H8I H;  2NWN A;  3S9C A;  3SJI A;  3UQV A;  1TGB A;  3K6Z A;  2AIP A;  4NZL A;  3ZZC A;  1TNI A;  1L0Z A;  3LC3 A;  4JZ1 A;  3SNE A;  1IQG A;  2RDL A;  2LPR A;  1W0Y H;  1HAH H;  1F0U A;  3RU4 E;  1CHO G;  1PQ7 A;  1TBZ H;  2WUC A;  2JH6 D;  3MU5 A;  4X1R U;  1NZQ H;  1QRX A;  1ID5 H;  3SQE E;  1KIG H;  3F9F A;  1O3A A;  2ZQ2 A;  1BMM H;  2OCV B;  1TRM A;  3PV5 A;  1N6X A;  4ISH H;  3RXQ A;  5EGM A;  2UUY A;  2W6I D;  3GCH B;  4WWY A;  1EZU C;  1FUJ A;  3P17 H;  2GGV B;  2W7S A;  4FUB A;  1HJ9 A;  1O2G H;  2FI3 E;  5AFZ H;  1QIX B;  1GBL A;  2VVU A;  2WHX A;  1BHX B;  1IQN A;  3N7D A;  3RXO A;  1KSN A;  1XUI A;  1H8D H;  3PRB A;  3BTM E;  4AX9 H;  3BTH E;  3M5N A;  5DG6 A;  4I8L A;  1GI4 A;  2Q6F A;  5E2O A;  1BJV A;  2CMY A;  3C27 B;  3GY2 A;  1KXD A;  5JBA S;  2DUC A;  2BDY A;  2EY4 C;  2P3T B;  3KQD A;  3HK6 B;  3BTW E;  3GDU A;  1O32 A;  2I6S A;  3NPS A;  4Y6D A;  3ZV8 A;  1H1B A;  3MWI U;  1O2N A;  3BN9 A;  3ZZ7 A;  3URD A;  1LVY A;  3M3V A;  5C1Y A;  5T3H A;  5CHA C;  2FYR A;  1YP9 A;  1FIW A;  1C5X B;  1WTG H;  2OQU A;  2WUB A;  3P8O A;  4A6L A;  1V3X A;  3NCL A;  4NZQ A;  5KGO A;  3A7W A;  3VEQ B;  2GV7 A;  4DT7 B;  4X1S U;  1K21 H;  2ZDL A;  3GY4 A;  4PRO A;  2PUX B;  3TH3 H;  2J92 A;  2JJ2 D;  1HBT H;  2ASU B;  4JZI A;  4BXW A;  4FOU C;  5AFY H;  2B8O H;  1O35 A;  2Y5F A;  2XC4 A;  2Z7F E;  2ZKS A;  3ATM A;  4LZ1 H;  4OS2 A;  2FOG A;  1FY1 A;  1O2K A;  1SVP A;  3T62 A;  1O2L A;  2FTM A;  3MU8 A;  1YPG H;  3F0O A;  4UE7 H;  1LTO A;  1NO9 H;  4YOG A;  3A7T A;  1QBV H;  1HNE E;  1KXF A;  1CHG A;  5I46 H;  5DPA A;  3MTY A;  1JOU B;  2BM2 A;  2ZGX H;  1RXP A;  3LGY A;  2FOA A;  3P70 B;  1MAY A;  1W7X H;  1IAU A;  1GVZ A;  1TFX A;  3F1S B;  2PKS C;  1WDI A;  1W10 U;  2RDE A;  2AHM E;  2FPZ A;  2RG3 A;  2KCA A;  1EAI A;  2BYA X;  2VH0 A;  3NZI A;  4F55 A;  6LPR A;  1SGC A;  3P8N A;  3QX5 H;  1CA0 B;  2Z9L A;  4DW2 U;  2J9N A;  1ELV A;  1DLK B;  5EIY A;  1VR1 H;  3SJO A;  1A46 H;  1Y5B T;  3H5C B;  1F5L A;  1KTT B;  2F9B H;  1YLN A;  4Y0Z E;  1EZS C;  1ZMN A;  1UVU H;  1L2E A;  4ISL A;  1ANE A;  2GMT B;  2F43 B;  1C1O A;  1IQK A;  1G2M A;  2JET C;  4RKJ B;  1LHF H;  1O3F A;  1GBJ A;  4BAO B;  1QL9 A;  3OE7 D;  3SGA E;  3U28 C;  1B7X B;  3UNQ A;  4R8T B;  1OHH D;  3LON A;  2SFA A;  5HM2 A;  3NWU A;  2FYQ A;  3O8D A;  3H09 A;  1B0F A;  4Y8Y A;  1LVO A;  1EZX C;  2QYI A;  3KHV A;  3FAO A;  1ZHP A;  4ZXX H;  3PMB B;  5C67 A;  2ZI2 H;  2R0L A;  4FU7 A;  2C8X B;  4MPX A;  4GUX A;  3D62 A;  4AZ2 B;  6CHA C;  1ZMJ A;  2OXS A;  3SHA H;  3FKS D;  3MH4 A;  3B23 B;  1BOQ A;  5EPN A;  1E36 B;  4ABD A;  3S0N A;  4IC5 A;  3ITI A;  2HGT H;  2ZCK P;  1WQV H;  1V2T T;  3DD2 H;  1AUJ A;  3CP7 A;  3ZVB A;  1FJS A;  2GT7 A;  1VIT G;  2VGC C;  1YYY 1;  2H5C A;  5A0A E;  4B76 A;  5AF9 H;  1A5H A;  1WSS H;  2PP6 A;  3TJO A;  2BY5 X;  3DSG A;  1Y3U A;  1LPG B;  3F0P A;  3GDS A;  3HGN A;  4X2Y A;  4XD7 D;  3S69 A;  2SNW A;  4K3J A;  1ABJ H;  3M3T A;  2ZFR H;  2Z94 A;  4DIH H;  3DFL A;  2GCH F;  4IN2 A;  4AOQ A;  1QQU A;  1TBQ H;  4E05 H;  1DUA A;  1OWD A;  2ZHF H;  1JRS A;  4LZ4 B;  2FI5 E;  5DP9 A;  3QK1 A;  1ESB A;  4ACB A;  3A7Z A;  1T8L A;  5EG4 A;  5E0G A;  4JYU H;  3U8O H;  1P57 B;  7LPR A;  3OSY A;  4JZD H;  5C20 A;  1SGT A;  1WUN H;  2XRC A;  1ZR0 A;  3RML H;  1QTF A;  4X1N U;  1OX1 A;  2JH5 D;  1SGR E;  3ELA H;  1GBM A;  3KQC A;  1TPS A;  2GZ9 A;  3OEE D;  1S6H A;  2CF9 H;  3M7Q A;  3RXP A;  3EA8 A;  2A0Q B;  1E35 B;  1UHB B;  1MMJ N;  3PLP A;  4K1T A;  1C5L H;  2VID A;  3STI A;  1WXR A;  4NIX A;  3LGU A;  3PLK A;  1MTN B;  3P6Z B;  1DT2 A;  1TA6 A;  1P04 A;  2XBX A;  1AFQ B;  5BRR E;  2THF B;  1P2J A;  2Y81 A;  3F9G A;  1CT4 E;  2TGT A;  1BCU H;  4H4F A;  3EGK H;  4ABJ A;  4CHA B;  1FDP A;  1HAP H;  3E90 B;  1FPC H;  4I33 A;  2CK3 D;  1C1Q A;  1CT2 E;  1MKX H;  1GJ5 H;  3BEF B;  1YC0 A;  4FUJ A;  2B9L A;  2FWW A;  4LK4 A;  2P95 A;  2UUK B;  1D3P B;  1GBE A;  8LPR A;  1VKY A;  1ZLR A;  2BDC A;  2AMD A;  3PLB A;  1UTQ A;  3M5M A;  1WOF A;  1EKB B;  2HLD D;  1TA2 A;  1S82 A;  1T4V H;  3GCT F;  5FAH A;  3UAI C;  1P2N A;  1UVP A;  1SL3 A;  2ZWL H;  1GGD C;  2ZDA H;  1LPK B;  4JCN A;  3RXL A;  2ZFQ H;  1QY6 A;  3RXF A;  4NWK A;  1O3O A;  1GJ9 B;  2BVS H;  1OPH B;  1OS8 A;  2XBY A;  3BG8 A;  1C2F A;  4KP0 A;  2OC0 A;  3T5F H;  1NRR H;  5HIZ A;  1B0E A;  2Y5H A;  1GBB A;  3TH4 H;  1W0J D;  1FI8 A;  3SGQ E;  3ZYE A;  3U1J B;  3FOA A;  3GDV A;  2GD4 B;  1G9I E;  4TWW A;  3IG6 B;  2WPD D;  3GCT G;  4MNX A;  3ZZ5 A;  4A92 A;  1SGF G;  3GCO A;  1PPF E;  2VIQ A;  1FQ3 A;  1GHA G;  4GVU A;  1P01 A;  3AW1 A;  1JXP A;  2TPI Z;  2OIN A;  2NU2 E;  3BTD E;  1O3G A;  1AZ8 A;  4A1X A;  2SGA A;  1NBM D;  2B0F A;  1P8V C;  4YXW D;  1P09 A;  4TT3 D;  3SNA A;  2J38 A;  3A88 A;  3TLO A;  1CBW B;  1GVL A;  1YPK H;  4AFZ A;  5F6M A;  2YMS C;  1RIW B;  3QWC H;  2HAL A;  1LCY A;  2O8U A;  2BHG A;  4DCD A;  1BTU A;  2P59 A;  5JPM H;  1S5S A;  1CA8 B;  3CS7 A;  2BXT H;  2HNT C;  1A0J A;  5B6L A;  5GPI B;  1BTH H;  5C5N A;  2YOL A;  3TPI Z;  2A7H A;  3A82 A;  1THP B;  2BZ6 H;  1CGJ E;  3DA9 B;  1S85 A;  4B73 A;  2YNA A;  3SHC H;  3TH2 H;  1SHH B;  4ZCN A;  3JZ1 B;  5EOK A;  1TOC B;  2GTB A;  1QL7 A;  2A2Q H;  1C5Y B;  4YO9 A;  5T6D A;  1COW D;  3A85 A;  1RTF B;  1BML A;  3S9B A;  3RXT A;  2BLV A;  3UB0 A;  1FN8 A;  4JMY A;  1MQ6 A;  5TCA A;  5DP8 A;  5LPF A;  5CHB A;  3LPR A;  1GBT A;  2Y5G A;  5T1V A;  2WZQ A;  4AN7 A;  1K1M A;  4DT4 A;  2OUA A;  2BD8 A;  1K1N A;  3GY3 A;  1O2I A;  1O2X A;  1OYQ A;  3RXI A;  1KY9 A;  3EST A;  2ZG0 H;  5ETX A;  3BEI B;  5FHT A;  4YTA A;  4AG2 A;  5C2Z A;  1V2M T;  1QFK H;  1S6F A;  1RRK A;  1WU1 A;  1NN6 A;  1KXB A;  1PPE E;  3MH7 A;  3SND A;  5EJZ A;  1V6D A;  2F4L A;  2NU1 E;  1TQ7 B;  1AQ7 A;  3ZVE A;  3QN7 A;  3DT0 H;  4BTI B;  1ZTK A;  1LMW B;  5EU8 A;  2XW9 A;  1AVX A;  1S83 A;  4BNR A;  1O3N A;  2F91 A;  2C8Y B;  7EST E;  3A84 A;  4Z1M D;  1RTK A;  4J1Y A;  2ZDN A;  3E8L A;  4BAK B;  5CHA B;  4X1P U;  2ZU5 A;  1O37 A;  3K6Y A;  1JRT A;  2OLG A;  2J98 B;  1G32 B;  1JIM A;  3A81 A;  1KXA A;  1HXE H;  1J17 T;  2CHA C;  1QL8 A;  2XCF A;  1F7Z A;  3SJ8 A;  4X1Q U;  4F49 A;  2PUQ H;  1FMG A;  1O3C A;  1W11 U;  3A83 A;  1GHW H;  2PGQ B;  2GZ7 A;  1O33 A;  1HAO H;  2W5E A;  3B9F H;  5F8X A;  5HM9 A;  5JBT A;  2UUJ B;  1KTS B;  1A5I A;  1W8B H;  2WPK S;  4ZKN U;  2FTL E;  1D3T B;  3BG4 B;  1P2Q A;  1UTO A;  3Q76 A;  5DGJ A;  4GHT A;  1THS H;  1ETT H;  1EB1 H;  1TGN A;  3D65 E;  3V12 A;  3LKW A;  1A4W H;  1NRN H;  4DVA U;  3OX7 U;  1O2H A;  4TY7 A;  1BMF D;  2FLB H;  3ZVG A;  1CE5 A;  3FAN A;  2V6N A;  2G81 E;  1DAN H;  1V2V T;  1H8E D;  1WAY B;  2AGI X;  4MQA A;  1G3D A;  1SHY A;  1N6Y A;  2G51 A;  2PSY A;  3RM0 H;  3FFG A;  4MPV A;  3RM2 H;  3N7E A;  1AI8 H;  3ZYD A;  2VNT A;  1F0R A;  2Z9I A;  3BV9 B;  2A7J A;  2ODP A;  3SZE A;  4ZXY H;  3SU0 A;  3TNT A;  3HGP A;  1ABI H;  2PW8 H;  3VXF H;  5GCH F;  2P16 A;  4ZRO A;  4GAW A;  3UTU H;  1QCP A;  1Y5U T;  3T28 A;  1HDT H;  1YWU A;  2WV5 A;  1TRY A;  1SGI B;  2CN0 H;  1Q2W A;  1ETR H;  1GHZ A;  1OSS A;  2F9V A;  3P95 A;  2VWN A;  1LO6 A;  2GJG A;  2BMG B;  2DE9 A;  2BXU H;  3BEU A;  3BIU H;  1JBU H;  1GHV H;  1GJD B;  1OP2 A;  1P03 A;  3ZV9 A;  1NBM E;  3SV9 A;  3A8B A;  5IDK A;  5T6G A;  2BD2 A;  4KKD A;  4DGJ A;  3SU3 A;  1A3B H;  1SSX A;  1SQA A;  3PB1 E;  2XYA A;  1TAB E;  4I32 A;  3TJV A;  2TIO A;  3OY5 U;  9EST A;  1H9I E;  5FX6 A;  1C1U H;  1ZZZ A;  4ASH A;  5LPE A;  3SV8 A;  4P00 A;  2VU8 E;  4FUI A;  2ZEC A;  3MYW A;  4CRG A;  5KED A;  1SGD E;  4K69 A;  3D23 A;  2ZHW H;  5GJ4 B;  1BRU P;  1HJA B;  1EQ9 A;  1RTL A;  3ENS B;  2F9N A;  3F9H A;  3AAV A;  1VJA U;  1YPE H;  1UK4 A;  1ELE E;  2AS9 A;  4B1T A;  1DXP A;  4WMD A;  1LHC H;  4Q2K A;  2BD9 A;  2F9P A;  2D1J A;  4U2W A;  3FZZ A;  5L2Y H;  2UWP A;  4U32 A;  3FP6 E;  1RIW C;  4B71 A;  2M2A A;  2H6M A;  4JYV H;  3RU4 T;  1ZPZ A;  1TNG A;  1OOK B;  4IMZ A;  3A87 A;  4NWL A;  1SB1 H;  4ZKS U;  4D76 A;  3SI4 H;  3AVZ A;  3GYM A;  1NES E;  4AOR A;  3AAU A;  4NGA H;  1SGN E;  3SNC A;  3KID U;  1P2K A;  1ELC A;  2G00 A;  4DY7 B;  5K7R A;  2C3S A;  2PTC E;  1F2S E;  4ISI H;  1GMH G;  3RXJ A;  1DS2 E;  1ACB E;  1AWH B;  2AGG X;  3GS9 A;  4EST E;  3GCH C;  1DFP A;  3RP2 A;  3EE7 A;  3RLY H;  1T4U H;  1H4W A;  2TGA A;  3Q3K A;  2J2U A;  3GY8 A;  2EST E;  3FP7 E;  1TMU H;  3VFE A;  4E7N A;  4I8H A;  1XUG A;  2GCT C;  3BTK E;  1YLC A;  4NFF A;  1GI7 B;  1GCT B;  1G37 A;  1J16 A;  1D6W A;  1ORF A;  4M7G A;  2QN5 T;  1NTP A;  3ZVA A;  8EST E;  3ZZ3 A;  1FAK H;  2JIZ D;  1C2H A;  2OBQ A;  4CR9 A;  4MNY A;  3D49 H;  2P8O C;  1XXF A;  1Z6J H;  2ZHE H;  4AYY B;  1EJM A;  1DY9 A;  2C8Z B;  2J4I A;  4YLU A;  2A2X H;  5J4S A;  2BD7 A;  1HJA C;  2R0K A;  3HKI B;  1DVA H;  2PHB A;  3T29 A;  3SV2 H;  3NKK A;  1BTY A;  3T26 A;  1DIT H;  1EJN A;  1NFU A;  2ANK H;  2PLX A;  1XXD A;  3RXH A;  1TOM H;  4OGY A;  4WVP E;  4UD9 H;  3SJ9 A;  5F53 A;  4UEH H;  1DDJ A;  1ZML A;  4YM9 A;  1YLD A;  1MTN C;  2UWO A;  3SGB E;  1AFE H;  3ZZA A;  1MKW H;  1ZJD A;  2CF8 H;  1GHY H;  3QLP H;  1HAV B;  4AC9 A;  1OXG A;  2BDI A;  3SBK A;  2GP9 B;  5A8Z A;  1O0D H;  4KEL A;  5EJ1 A;  1GHX H;  5E2P A;  1C2I A;  1UCY E;  4JK5 A;  4WJG 2;  3RXA A;  1IQL A;  3KQE A;  3DSO A;  2QAA A;  3GCN A;  4YT7 H;  1PQ8 A;  1FLE E;  3LDX H;  3MNS A;  4I31 A;  1T8N A;  1VGC C;  1MKX K;  4Y7A A;  1F5K U;  1LKB A;  1SLW B;  5ABW A;  2ZCH P;  2KFW A;  1Y8T A;  2GKV E;  4Y8X A;  2A5I A;  2XBV A;  2WYJ A;  3DUX H;  1GDN A;  1CO7 E;  2FOE A;  2KZ4 A;  3ODF A;  1V2S T;  2C90 B;  2OBO A;  1FY5 A;  3RXB A;  5GWZ A;  2XNI A;  4BTT B;  1DWB H;  5DK1 A;  2ILN A;  1BJU A;  3SNB A;  2PSX A;  5DSF A;  4H6T A;  3DHK H;  3C1K A;  1KXE A;  2Z3C A;  2NU3 E;  3QGJ A;  2NU0 E;  3M3S A;  1MH0 A;  3UFA A;  1ZRK A;  1OP8 A;  1UVT H;  1ZTJ A;  3F68 H;  3P8G A;  4D9R A;  1JIR A;  1D4P B;  1T8M A;  2V3M A;  4GHQ A;  1QR3 E;  1O3K A;  2VIN A;  6CHA B;  2ODY B;  1A0H B;  1SC8 U;  5C94 A;  1ARB A;  1Y3W A;  2QF4 A;  1EOL A;  3TVJ B;  3OFN D;  5F03 A;  2OC7 A;  1Z8J B;  1A61 H;  5DKM A;  2GDE H;  3LC5 A;  3SU2 A;  3L6P A;  1AKS A;  3EA7 A;  5DN6 D;  1S81 A;  2FOM B;  4A5T S;  1SGE E;  4X2X A;  1LVM A;  4X8T H;  3A89 A;  5FPS A;  3KNX A;  1TX7 A;  3NRL A;  5EXN A;  2BY6 X;  3SN8 A;  1ELT A;  5E0H A;  3O8B A;  3BTT E;  4RI0 A;  5A0C A;  3PTN A;  4XFQ A;  3PV4 A;  1W13 U;  1ZOM A;  1GDQ A;  1IQF A;  1O2R A;  1ZTL A;  3M61 U;  3M7U A;  4YLQ H;  3SUG A;  3QZQ A;  4RKO B;  1QQ4 A;  1T8O A;  4X0W U;  1CT0 E;  2IJO B;  1GHB G;  1PPZ A;  3MU4 A;  4FUD A;  4YT6 H;  1Z7K A;  1BBR H;  5GND A;  5C1U A;  4FUG A;  1P9U A;  1O3E A;  5DJ7 A;  1K1I A;  1QJ6 B;  1TLD A;  1F0T A;  1W12 U;  3VB7 A;  2FOB A;  2QF5 A;  4D7G A;  1NRQ H;  3PM3 A;  1C2M A;  2UUF B;  3SOR A;  1C4U 2;  5HXF A;  1YBW A;  2LEL A;  3FO8 D;  1HGT H;  1NFW A;  4FU9 A;  1CA0 C;  1UTK A;  1QGF A;  1SMF E;  2ANM H;  2OP9 A;  2OC8 A;  4Y76 A;  5EXM A;  1O3M A;  4CRC A;  3PRO A;  1GHB F;  4OS4 A;  1GI3 A;  1RJX B;  2QY0 B;  5FPY A;  2FI4 E;  3MNC A;  3KYF A;  1GBA A;  2F83 A;  3P8F A;  3MO6 A;  1UTN A;  3QUM P;  3PMH B;  2QXI A;  2FO9 A;  3VB3 A;  5L6N H;  5C17 A;  4NA8 A;  1E34 B;  2QCY A;  1DUE A;  1ZPB A;  1IQE A;  4ABF A;  2A5A A;  5E8E H;  1UHB A;  3NK8 A;  5JYI A;  2ZU3 A;  5EJL A;  1ESA A;  4F4O C;  1DXW A;  1GMC F;  1TNL A;  4O97 A;  1SQT A;  4DII H;  4MNW A;  2ZF0 H;  1EAX A;  4IW4 E;  1V2P T;  4OS6 A;  4DJZ B;  2VWM A;  3EDX B;  1D9I A;  1WYK A;  2OTV A;  4NA7 A;  1MBM A;  2L6O A;  1NS3 A;  4BOH A;  1XVO A;  1HAI H;  3BTG E;  4A7I B;  5FCK A;  1Y5A T;  4A1V A;  1AU8 A;  1NU7 B;  2J98 A;  1HAY B;  1C2G A;  2H2Z A;  1A7S A;  3N7O A;  1YGC H;  2PV9 B;  7KME H;  2XC5 A;  1QB9 A;  2YMS B;  5EQR A;  2WSS D;  1P9S A;  1BTZ A;  2H9T H;  3RU4 D;  4K1E A;  3KN2 A;  4ZUH A;  5TCC A;  2FP7 B;  4XRN A;  1BMA A;  1SLX B;  4XBD A;  2EI6 A;  4FVD A;  1HPG A;  1TGT A;  2VVC A;  3RXV A;  1SGP E;  1GBH A;  1O2J A;  3E0P B;  5H4I B;  3I77 A;  2R9P A;  2SNV A;  1GWA A;  1EP6 A;  1AKS B;  3KYG A;  5LGO A;  4CRE A;  5HKK D;  3LGI A;  2BDG A;  4FUC A;  4FUF A;  1W14 U;  3SUF A;  4ABE A;  1LPZ B;  4NSY A;  1K1L A;  2RA0 A;  3SI3 H;  2AGE X;  1D3Q B;  4O3T A;  2PWX A;  1CHO F;  2FXR A;  4CR5 A;  3TIT A;  1BBR K;  1PQ5 A;  5HIY A;  2FIR H;  2B7D H;  3EYD A;  4B74 A;  1NFX A;  1TRN A;  3MH5 A;  1K1J A;  4Q7X A;  1RS0 A;  2A5K A;  4B75 A;  1MU6 B;  2C93 B;  1C1T A;  2BX4 A;  1HAZ B;  3MU1 A;  3RC5 A;  4KTC A;  3BIV H;  3RXE A;  2Y80 A;  1QNJ A;  1TGS Z;  3KL6 A;  5EQS A;  2ZFF H;  1L1N A;  1L4D A;  4J2Y B;  3MH6 A;  4ASU D;  2KAI A;  1OWJ A;  1OYT H;  5TJX A;  5EOD A;  2HOB A;  1CVW H;  5BPE A;  4NSV A;  1NC6 A;  1TB6 H;  4Z6A H;  1MAX A;  1AVW A;  1HYL A;  3PO1 B;  5G4B A;  1EPT A;  2OQ5 A;  1VGC B;  4M9F A;  2A4Q A;  1OKX A;  1ELB A;  1IQI A;  2FS9 A;  1LQE A;  1EJA A;  1KXC A;  2GT8 A;  1P0S H;  3MOC A;  4E06 H;  5C1X A;  3VB6 A;  1Q31 A;  4BXS A;  1E0F D;  2HNT F;  4DUR A;  1TPA E;  1CQQ A;  4K8Y A;  2ZHD A;  3F2F A;  2SGE E;  4WH6 A;  4CH2 B;  4D9Q A;  1P12 E;  1QA0 A;  1NPM A;  2G5V A;  1O3J A;  5EPY A;  2IJD 1;  1ZGI A;  2IPH A;  1ZHR A;  5T6F A;  1SQO A;  2CXV A;  2ZFS A;  1YY3 A;  1Z8I B;  4NCY A;  4OM9 A;  4FXG H;  2ZGH A;  1MQ5 A;  1PQA A;  2XTT B;  4AFS A;  3BTQ E;  4BAM B;  1BBR E;  2CJI A;  1GL0 E;  4I8J A;  2QGR A;  2VWO A;  1C4V 2;  1VZQ H;  2ANW A;  1C2J A;  1DM4 B;  2V7Q D;  5GDS H;  3RMM H;  5LPR A;  1WQS A;  4MVN A;  2OD3 B;  2IN2 A;  3ATW A;  3RXD A;  3BTE E;  2LP6 A;  1IHS H;  1T7C A;  2HNT E;  1G3C A;  4IN1 A;  3JZ2 B;  3LGT A;  1XX9 A;  4ZAE A;  3R3G B;  2Y7X A;  1MTU A;  3PMA B;  1HXF H;  2BZA A;  5GXP A;  1XMN B;  2H5D A;  2Y82 A;  3BF6 H;  4FET A;  5F8T A;  1AFQ C;  4I8G A;  5FXL A;  1LVB A;  1BIT A;  1DWC H;  1V2W T;  4U30 A;  3SUD A;  1C5Q A;  2G5N A;  3MO9 A;  2A4O A;  1EP5 A;  2SGF E;  1PPC E;  1QHR B;  1YCP K;  2ULL A;  2STA E;  1XUH A;  3LIW A;  1ZSJ A;  1ELG A;  5C0U A;  1EST A;  1UCY K;  3TGJ E;  2BQW B;  4ZH8 A;  2V35 A;  3VB4 A;  1SLU B;  1AB9 C;  3M5O A;  1VCQ A;  1G2L A;  3SQH E;  2PGB B;  3EQ0 H;  2ODQ A;  1EXF A;  4TSF D;  2W7U A;  2HRV A;  1AN1 E;  4JZE H;  1FZZ A;  1RD3 B;  3OTJ E;  1TX6 A;  2G8T A;  3HK3 B;  3V3M A;  4FU8 A;  1XKA C;  8GCH F;  2ZGC A;  3MFJ A;  3RXR A;  4INH A;  4B6E A;  2JET B;  1EAT A;  1O30 A;  1SR5 C;  4P02 A;  2P8O B;  4Q7Y A;  1V2K T;  4Q63 A;  2GMT C;  4TPI Z;  3K65 B;  2ANY A;  3OTP A;  5J4Q A;  2BVR H;  1V2R T;  1YCP H;  1Q3X A;  1AO5 A;  3A8A A;  4HTC H;  1Z1J A;  4TY6 A;  3RLW H;  4I8K A;  1O2V A;  2KCO A;  1MKW K;  1XUF A;  1HV7 A;  2ZA5 A;  4AYV B;  3W94 A;  4IBL H;  3RXS A;  1UCY H;  3FZD A;  3I78 A;  2ZTX A;  3UR9 A;  5JDU B;  4WMF A;  3FP8 E;  1HFD A;  1O2T A;  4A1T A;  1N8O B;  1GBF A;  3MMG A;  2F9U A;  3IWM A;  2TGD A;  5FCR A;  1FPH H;  1HIA B;  2FEQ H;  2EEK A;  1QBO A;  4AFQ A;  2BX3 A;  2ZPR A;  1SGF A;  1J8A A;  3WY8 A;  1GI2 A;  5DP4 A;  2PKA A;  1EAU A;  1ZYO A;  1ZGV A;  4HFP B;  3TIU A;  3VGC B;  1K22 H;  1O2Z A;  2BVX H;  5A09 A;  4HI3 A;  2Z9J A;  3LJO A;  1GDU A;  3TGK E;  1V2U T;  2Y7Z A;  2XC0 A;  1QZ8 A;  3TJN A;  5A8X A;  4WY3 A;  3EA9 A;  3LOX A;  1LQD B;  1QRW A;  1GBD A;  1X7A C;  1DPO A;  1TYN A;  1OWK A;  3MO3 A;  5EW1 H;  5KEC A;  2FOC A;  4FUH A;  1D3D B;  1C5W B;  3WW7 A;  4R0I A;  2AEI H;  3HPT B;  1C1V H;  2WPL S;  4IC6 A;  4UDW H;  3CS0 A;  2VWL A;  5HGG A;  5A0B A;  2W3K A;  3F9E A;  1G36 A;  4TWY A;  1TPO A;  4YOI A;  2Q1J A;  1UTL M;  3BTF E;  2VGC B;  2FOH A;  4X2V A;  3RXK A;  7GCH F;  2FOF A;  3GYL B;  4I86 A;  4XE4 A;  4UFF H;  4AFU A;  3ZVD A;  3NUM A;  5B6O A;  1GBC A;  1TQ0 B;  2WIN I;  1AIX H;  2VB0 A;  3SU4 A;  2GVF A;  3KQ5 A;  4TYD A;  1ELA A;  1KMH B;  4IGD A;  3UY9 A;  1OP0 A;  4ZKO U;  4GCH G;  1AE8 H;  3U9A H;  2VVV A;  4OGX A;  4ABH A;  1NM6 A;  2PTN A;  3B8J A;  2ZU2 A;  3H7T A;  4GSO A;  1OWE A;  1ELF A;  4X2W A;  1HUT H;  5K0H A;  2QIQ A;  2QV1 A;  1RFN A;  4Q7Z A;  3PMJ A;  1DWE H;  1SGY E;  1IQJ A;  1PJP A;  2JH0 D;  1AMH A;  4KGA A;  1O2P A;  2EI8 A;  1GMD G;  2A1D B;  1C4Y 2;  1EOJ A;  2QXJ A;  2ALP A;  2V3H H;  2ZFT A;  2G4U A;  2HPP H;  1TE0 A;  2FES H;  2ZIQ H;  1LHG H;  3STJ A;  1LDT T;  2HPQ H;  3F2H A;  2FX6 A;  2P3U B;  2QC2 A;  4YES B;  2M5T A;  1AHT H;  5IYT A;  3Q3X A;  1GBI A;  1ELD E;  2D2D A;  2HVX A;  3PWB A;  2ZC9 H;  4OS1 A;  1GCD A;  3QTV H;  1TAW A;  3S7H B;  1WTH D;  2Z6B D;  1BTW A;  1BZX E;  3K9X B;  4YOJ A;  3ZZB A;  1FY8 E;  3U98 H;  1GHA F;  1O2O A;  1GMD F;  1O2Y A;  1TIO A;  1E38 B;  2ZPS A;  3F6U H;  4MNV A;  1Y3X A;  2ZZU H; 
#chains in the Genus database with same CATH homology
 1NBM E;  5EQQ A;  4NWK A;  5H4I B;  3SV9 A;  1W3C A;  2VBC A;  3DCL A;  5IDK A;  1SKY E;  2XND D;  1S6L A;  3SV7 A;  2OC0 A;  2JJ2 D;  2IJO B;  4FET A;  3SU3 A;  5HKK D;  3LOX A;  3DSP A;  4B76 A;  5F53 A;  1W0J D;  3F2G A;  3SUF A;  5IK2 D;  3OAA D;  4U01 A;  4I32 A;  5GND A;  3PRD A;  3SUD A;  3F0P A;  3U1J B;  3FOA A;  4XD7 D;  3SV8 A;  2XCF A;  1E1Q D;  2WPD D;  2WV9 A;  3F0O A;  3OYP A;  2QF5 A;  3WW7 A;  4A92 A;  3EYD A;  4B74 A;  5GJ4 B;  1H8H D;  1RTL A;  1JXP A;  2OIN A;  2KM0 A;  4B75 A;  2LEL A;  3FO8 D;  4A1X A;  3DSO A;  5C0U A;  1NBM D;  3RC5 A;  3SUE A;  1DXP A;  4I31 A;  4YXW D;  4KTC A;  2O8M A;  4TT3 D;  2OC8 A;  3SU5 A;  1FX0 B;  2KFW A;  3M5O A;  1DY8 A;  5EQS A;  2YMS C;  3WWB A;  3KF2 A;  1RGQ A;  3O8R A;  2AHM E;  4ASU D;  2KCA A;  5FPY A;  4B71 A;  2P59 A;  2M2A A;  2KZ4 A;  2XOK D;  4F55 A;  2OBO A;  3P8N A;  3O8C A;  3LKW A;  4TSF D;  4NWL A;  5CDF E;  1E79 D;  3SU4 A;  5GPI B;  5B6L A;  2GVF A;  4TYD A;  3AK5 A;  1KMH B;  5C17 A;  2XNI A;  2YOL A;  3N99 A;  1A1R A;  1BMF D;  3FN8 A;  3SU6 A;  3KEE A;  4B73 A;  5ESB A;  3WWF A;  4M9F A;  3PV5 A;  3F3B A;  1BT7 A;  5DSF A;  2OK5 A;  2A4Q A;  2W6I D;  2W6J D;  3OEE D;  2K0Q A;  3OEH D;  4K8B A;  4ZCN A;  1H8E D;  1DXW A;  4WH8 A;  4B6E A;  2GGV B;  1WXR A;  2F43 B;  2K1Q A;  1EFR D;  3GS9 A;  5FL7 D;  4Q63 A;  1COW D;  2QV1 A;  2KCP A;  3SU1 A;  3U1I B;  3N7E A;  4B6F A;  3F2F A;  2WHX A;  3OTP A;  3RC6 A;  3OE7 D;  3N7D A;  4WH6 A;  2OC1 A;  3UB0 A;  4JMY A;  2YMS D;  3ZIA D;  2K8I A;  3PRB A;  2A4G A;  2XCN A;  2L6O A;  1NS3 A;  2KCO A;  3SZE A;  2JDI D;  3SU0 A;  3VG8 A;  5CHB A;  2QF4 A;  3W1E A;  3E90 B;  3M5N A;  3OFN D;  4I33 A;  2CK3 D;  4R8T B;  2IJD 1;  2QE7 D;  1OHH D;  5EPY A;  3SYJ A;  4A1V A;  1E1R D;  1W0K D;  2WZQ A;  3LON A;  2OC7 A;  2J5U A;  4Q4L A;  5T1V A;  4DT4 A;  3O8D A;  3F2H A;  3H09 A;  3SU2 A;  1CU1 A;  2KCY A;  3L6P A;  5DN6 D;  2FOM B;  4OM9 A;  4A1T A;  5ETX A;  2F9U A;  2YMS B;  2KR7 A;  5EQR A;  2WSS D;  4WF8 A;  1MAB B;  2JJ1 D;  3PV2 A;  5FPS A;  3KNX A;  2JIZ D;  3M5M A;  2F9V A;  3NRL A;  3KN2 A;  2OBQ A;  2HLD D;  5FPT A;  2F4L A;  2FM2 A;  3O8B A;  2FP7 B;  3RC4 A;  3FKS D;  2V7Q D;  4RI0 A;  1N1L A;  5EPN A;  1DY9 A;  3SV6 A;  3P8O A;  5C0T A;  2A4R A;  4Z1M D;  3SUG A;  3M5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...