2KCJA

Solution structure of fapp1 ph domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
GPLGSPEFMEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKASLTDTRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family A member 3
publication title Structural basis of wedging the Golgi membrane by FAPP pleckstrin homology domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2kcjA00
1Y5OA 5FI0A 4KAXB 1EF1A 4CHJA 5DHFB 3MDBC 1Y19B 2LOXA 1U5DA 2P0FA 1WVHA 1MPHA 5GOWB 1V5MA 2PZ1A 4TYZA 1QQGA 4CYEA 5JHHA 3DXCA 4BBKA 1FGZA 4HHVA 4WVFB 1DROA 5C16A 2D9ZA 5DH9B 2EJ8A 3MPXA 1V89A 5LOPB 2GCLA 2K00A 2DHIA 5C79A 1ZM0A 2GJYA 3ODXA 2DX1A 4A6FA 3AU4A 2LULA 3WA0A 4GXBA 4KHOA 4HDQA 4A5KA 3TVVA 1BTKA 4EKUA 4DBBA 1DBHA 4HB4B 1ZSQA 3SNHA 2VSZA 2W2WA 1FHWA 2P0DA 2V76A 3A98B 3ULCA 4HAUB 1P3RA 4EMOA 3LJUX 4NSWA 1XODA 1N3HA 2D9WA 4HAXB 3TO1A 2IFSA 1UPQA 1I7AA 3FSSA 2ROVA 5DI9B 4ZRKA 5D3WA 3AJ4A 2HTHB 1H4RA 5J3TA 1WJMA 2H7DA 2R0DA 3U8ZA 2H7EA 3D8DA 4HAYB 4L6EA 2J0KA 3VOQA 4P7IA 2D9VA 1V5UA 2UZRA 2YRYA 1IRSA 4MT7A 3GYOA 5C5BA 1RRPB 3N7CA 1X11A 3PP2A 1U5GA 3KY9A 2Y7BA 3DXEA 5DIFB 3X23A 4B6HA 3PVWA 2LKOA 2YT0A 3SV1A 2I5CA 4HAZB 4DX90 1GC6A 1OQNA 1U29A 2EMTA 2MFQA 2I5FA 2YT1A 4DX8A 2Q13A 1PFJA 2GS0A 3ODWA 1DDVA 1WGUA 3FEHA 1I2HA 1LW3A 4GZUA 1ZVRA 1P6SA 5CLQB 1U2BA 4K17A 4KHBB 3F5RA 5J3QA 1K5DB 3PZDA 5EFXA 1BWNA 5J3YA 2ZPYA 1UEFA 1TXDA 2ADZA 1MAIA 1XX0A 3ML4A 3WYFB 2RVBB 4GMVA 3D8EA 2K2JA 3GYPA 3A8PA 2W2XD 1NI2A 1X1GA 3TFMA 4GMXB 1KZGA 1V5PA 2YVCA 3KZ1A 3BINA 1ISNA 2D10A 4KHAA 1XR0B 1GG3A 3KRXA 4MY6A 3NSUA 4YONA 2E2XA 5D3YA 3V5WA 1MKEA 3PSCA 1NU2A 1U5EA 2P0HA 2NMBA 5CLLB 3DXDA 1X05A 2CRFA 3ZDTA 1PMSA 4NY0A 1KZ7A 1QC6A 1FHOA 4HAVB 3O96A 3ODOA 3G9WA 1U5FA 4HB0B 4YL8A 2N23A 3AU5A 2J59M 2RUKB 2DYQA 1W1HA 2K2UA 4ZRIA 2EC1A 2D2QA 1BAKA 1E5WA 2RLOA 2FJLA 1X86A 1WG7A 2DFKA 4GN1A 3HQCA 1SHCA 2ROZB 1P5TA 2ELBA 2DLWA 2W2XC 4XWXA 2J0JA 3U7DA 1FAOA 2UVMA 2DTCA 2EMSA 2DN6A 2M38A 2MKRA 1V61A 3PVLA 5D3VA 2COFA 4ZRJA 1MK9B 1K5GB 2AL6A 5JLJB 1MIZB 3BJIA 1EVHA 3IVFA 1OY2A 4HATB 1FGYA 1J19A 1X1FA 2MWNB 2OTXA 5HE3A 1GC7A 3TCAA 1ZC4B 5D27A 1NTYA 4EJNA 1XKEA 1UPRA 2VRWB 2YS3A 1WI1A 2OQBA 1EAZA 2Y8GA 4A6KA 3RCPA 4DXAB 1PLSA 4MK0A 2D9XA 2VKIA 4Y94A 4HDOA 2UZSA 2LOZA 2X18A 1EGXA 2RNRB 1BTNA 5JP4A 2N0YA 2JP2A 5L81A 2R09A 2DX5A 2KGXB 2L2IA 2COAA 1FB8A 1DYNA 2I1JA 3F0WA 2Z0OA 5HE0A 1Q67A 3A8QA 1DDMA 1XD4A 5KQ1A 3KRWA 2D4QA 2KCJA 1AQCA 3D8FA 2QKLA 4D0NB 3SO6A 1WJ1A 1DDWA 2DHJA 2DHKA 2RGNB 3OANA 1TJ6A 3TW1A 4Z2NA 4Z2MB 2COCA 2J0MA 1U27A 2NZ8B 1ZC3B 4TKNA 5HE1A 2DA0A 3PVUA 2YS5A 5KCVA 2BCJA 4A6HA 2L1CA 3P7ZA 1UNPA 3CIKA 4K2PA 2MDXA 2I1KA 4K2OA 5C5BB 1KI1B 2G35A 1SGHA 2DKQA 2D9YA 3FM8C 5KQ4A 1AWEA 4HB3B 4IFSA 2RSGA 1W1GA 3UZTA 2YS1A 1OMWA 4KVGB 1M7EA 1MK7B 1RJ2A 5C6RA 2QKMA 4F7UP 2HE7A 5HE2A 3KSYA 3QBVB 2P8VA 4PNKA 1J0WA 2ELAA 3SUZA 4CHMA 1M7RA 1W1DA 1FHXA 3ULBA 2XQNM 4WSFA 2IYBA 5LONB 4WJ7A 5JHGA 4PQ0A 2M14A 2YF0A 2AEHA 3PEGA 4H8SA 3PG7A 4IAPA 2D11A 3ZVRA 1V88A 2Z0PA 3SYXA 4C0AA 1LB1A 3HK0A 4GPTB 2YSZA 4F7GA 4A6FB 3QIJA 1Z87A 2CY4A 2Z0QA 4IOYX 2Y8FA 5D3XA 1H10A 2CAYA 4HAWB 3P6AA 2GCJA 1WGQA 3HW2B 2DKPA 1MIXA 3T06A 2LYDA 4F7HA 2DYNA 3CXBB 1NTVA 4K81A 2CY5A 1B55A 2KUPA 3QWMA 1UNQA 3M1IB 1UNRA 4HB2B 1XCGA 5FI1A 3VIAA 5DHAB 2LG1A 1FOEA 1TQZA 2CODA
chains in the Genus database with same CATH superfamily
1Y5OA 4QJ4B 5FI0A 4KAXB 1EF1A 4CHJA 5DHFB 3MDBC 1Y19B 2LOXA 1U5DA 2P0FA 2ZKMX 3A58A 1WVHA 1MPHA 5GOWB 1V5MA 2PZ1A 4TYZA 1QQGA 4CYEA 5JHHA 3DXCA 4BBKA 1FGZA 4HHVA 4WVFB 1DROA 5C16A 2D9ZA 5DH9B 2EJ8A 4OT1A 3U12A 3MPXA 1V89A 5LOPB 2GCLA 2K00A 2DHIA 5C79A 1ZM0A 2GJYA 3ODXA 2DX1A 4A6FA 3AU4A 2LULA 3WA0A 4GXBA 4KHOA 4HDQA 2K49A 4A5KA 3TVVA 1BTKA 4EKUA 4DBBA 1DBHA 4HB4B 1ZSQA 3SNHA 2VSZA 2W2WA 2GUMA 1FHWA 2P0DA 2V76A 3A98B 3ULCA 4HAUB 1P3RA 3HIEA 4EMOA 4QJ5B 3LJUX 4NSWA 1XODA 1N3HA 2D9WA 4HAXB 3TO1A 2IFSA 1UPQA 1I7AA 3FSSA 2ROVA 5DI9B 4ZRKA 5D3WA 3AJ4A 3NW8A 2HTHB 1H4RA 5J3TA 1WJMA 2H7DA 2RRFA 2R0DA 3U8ZA 2H7EA 3D8DA 4HAYB 4L6EA 2J0KA 3VOQA 4P7IA 2D9VA 1V5UA 2UZRA 3NWDA 2YRYA 1IRSA 4MT7A 3GYOA 5C5BA 1RRPB 3N7CA 1X11A 3PP2A 5I2MA 1U5GA 3KY9A 2Y7BA 3DXEA 5DIFB 3X23A 4B6HA 3PVWA 4GOUA 2LKOA 2YT0A 3SV1A 5M4YB 2I5CA 4HAZB 4DX90 1GC6A 1OQNA 1U29A 2EMTA 4HSIA 2MFQA 2I5FA 2YT1A 4DX8A 2Q13A 1PFJA 2GS0A 5I2SA 4CSQA 2Z59A 4L1RA 3ODWA 1DDVA 1WGUA 3FEHA 1I2HA 1LW3A 4GZUA 1ZVRA 1P6SA 5CLQB 1U2BA 4K17A 4KHBB 3F5RA 4GNKB 5J3QA 1K5DB 3PZDA 5EFXA 1BWNA 5J3YA 2ZPYA 1UEFA 1TXDA 2ADZA 1MAIA 1XX0A 3ML4A 3WYFB 2RVBB 4GMVA 3D8EA 2K2JA 3GYPA 3A8PA 2W2XD 1NI2A 1X1GA 2R2YA 3TFMA 4GMXB 1KZGA 1V5PA 2YVCA 5LG4B 3KZ1A 3BINA 1ISNA 2D10A 2NBVA 4KHAA 1XR0B 1GG3A 3KRXA 4MY6A 3FVCA 3NSUA 4YONA 2E2XA 5D3YA 3V5WA 3OHMB 1MKEA 3PSCA 1NU2A 1U5EA 2P0HA 2NMBA 5CLLB 3DXDA 1X05A 2CRFA 3ZDTA 1PMSA 4NY0A 1KZ7A 1QC6A 1FHOA 4HAVB 3O96A 3ODOA 3G9WA 1U5FA 4HB0B 4YL8A 2N23A 3AU5A 2J59M 2RUKB 4D6WA 2DYQA 1W1HA 2K2UA 4ZRIA 2EC1A 2D2QA 1BAKA 1E5WA 2RLOA 2FJLA 1X86A 1WG7A 2DFKA 4GN1A 3HQCA 1SHCA 2ROZB 1P5TA 2ELBA 2DLWA 2W2XC 4XWXA 2J0JA 4KHBA 3U7DA 1FAOA 2KIEA 2UVMA 2DTCA 1ZYIA 2DN6A 2EMSA 2M38A 2MKRA 1V61A 3PVLA 5D3VA 2COFA 4ZRJA 1MK9B 1K5GB 2AL6A 5JLJB 1MIZB 3BJIA 1EVHA 3IVFA 1OY2A 4HATB 1FGYA 1J19A 1X1FA 4DIXA 2MWNB 2OTXA 5HE3A 1GC7A 3TCAA 1ZC4B 5D27A 1NTYA 4EJNA 1XKEA 1UPRA 2VRWB 2YS3A 1WI1A 2OQBA 1EAZA 2Y8GA 4A6KA 3RCPA 4DXAB 1PLSA 4MK0A 2D9XA 2VKIA 4Y94A 4HDOA 2UZSA 2LOZA 2X18A 1EGXA 2RNRB 1BTNA 5JP4A 2N0YA 2JP2A 5L81A 2R09A 2DX5A 2KGXB 2L2IA 2COAA 1FB8A 1DYNA 2I1JA 3HSAA 4OSNA 3F0WA 2Z0OA 5HE0A 1Q67A 3A8QA 1DDMA 2Z13A 1XD4A 5KQ1A 3KRWA 2D4QA 2KCJA 1AQCA 3D8FA 2QKLA 4D0NB 3SO6A 1WJ1A 1DDWA 2DHJA 1MI1A 2DHKA 2RGNB 3OANA 1TJ6A 1T77A 3TW1A 4Z2NA 3NWAA 2YT2A 4Z2MB 2COCA 2J0MA 1U27A 2NZ8B 1ZC3B 4TKNA 5HE1A 2DA0A 3PVUA 2YS5A 5KCVA 2Z14A 2BCJA 4A6HA 2L1CA 3P7ZA 1UNPA 3CIKA 4K2PA 2MDXA 2I1KA 4K2OA 5C5BB 1KI1B 3B77A 2G35A 1SGHA 2DKQA 5IRSA 2D9YA 3FM8C 5KQ4A 1AWEA 4HB3B 4IFSA 2KIGA 2FJUB 2RSGA 1W1GA 3UZTA 2YS1A 1OMWA 4KVGB 1M7EA 1MK7B 1RJ2A 5C6RA 2QKMA 4F7UP 2HE7A 5HE2A 3KSYA 3QBVB 2P8VA 4PNKA 1J0WA 2ELAA 3SUZA 4CHMA 1M7RA 1W1DA 1FHXA 3ULBA 2XQNM 4WSFA 3DCXA 2IYBA 5LONB 4WJ7A 5JHGA 3NWFA 4PQ0A 2M14A 2YF0A 2AEHA 3PEGA 4H8SA 3PG7A 4IAPA 4QXAB 2D11A 3ZVRA 1V88A 2Z0PA 2Z4DA 2K8EA 3SYXA 4C0AA 1LB1A 3HK0A 4GPTB 2YSZA 4F7GA 4A6FB 3QIJA 1Z87A 2CY4A 2KR0A 2Z0QA 4IOYX 2Y8FA 5D3XA 1H10A 2CAYA 4HAWB 3P6AA 2KUQA 2GCJA 1WGQA 3HW2B 2DKPA 1MIXA 3T06A 2LYDA 4F7HA 2DYNA 3CXBB 1NTVA 4K81A 2CY5A 1B55A 2KUPA 3QWMA 1UNQA 3M1IB 1UNRA 4HB2B 1XCGA 5FI1A 3VIAA 4QJ3B 5DHAB 2LG1A 1FOEA 1TQZA 2CODA
chains in the Genus database with same CATH topology
1Y5OA 5FI0A 4KAXB 1EF1A 4CHJA 5DHFB 3MDBC 1Y19B 2LOXA 1U5DA 2P0FA 1WVHA 1MPHA 5GOWB 1V5MA 2PZ1A 4TYZA 1QQGA 4CYEA 5JHHA 3DXCA 4BBKA 1FGZA 4HHVA 4WVFB 1DROA 5C16A 2D9ZA 5DH9B 2EJ8A 3MPXA 1V89A 5LOPB 2GCLA 2K00A 2DHIA 5C79A 1ZM0A 2GJYA 3ODXA 2DX1A 4A6FA 3AU4A 2LULA 3WA0A 4GXBA 4KHOA 4HDQA 4A5KA 3TVVA 1BTKA 4EKUA 4DBBA 1DBHA 4HB4B 1ZSQA 3SNHA 2VSZA 2W2WA 1FHWA 2P0DA 2V76A 3A98B 3ULCA 4HAUB 1P3RA 4EMOA 3LJUX 4NSWA 1XODA 1N3HA 2D9WA 4HAXB 3TO1A 2IFSA 1UPQA 1I7AA 3FSSA 2ROVA 5DI9B 4ZRKA 5D3WA 3AJ4A 2HTHB 1H4RA 5J3TA 1WJMA 2H7DA 2R0DA 3U8ZA 2H7EA 3D8DA 4HAYB 4L6EA 2J0KA 3VOQA 4P7IA 2D9VA 1V5UA 2UZRA 2YRYA 1IRSA 4MT7A 3GYOA 5C5BA 1RRPB 3N7CA 1X11A 3PP2A 1U5GA 3KY9A 2Y7BA 3DXEA 5DIFB 3X23A 4B6HA 3PVWA 2LKOA 2YT0A 3SV1A 2I5CA 4HAZB 4DX90 1GC6A 1OQNA 1U29A 2EMTA 2MFQA 2I5FA 2YT1A 4DX8A 2Q13A 1PFJA 2GS0A 3ODWA 1DDVA 1WGUA 3FEHA 1I2HA 1LW3A 4GZUA 1ZVRA 1P6SA 5CLQB 1U2BA 4K17A 4KHBB 3F5RA 5J3QA 1K5DB 3PZDA 5EFXA 1BWNA 5J3YA 2ZPYA 1UEFA 1TXDA 2ADZA 1MAIA 1XX0A 3ML4A 3WYFB 2RVBB 4GMVA 3D8EA 2K2JA 3GYPA 3A8PA 2W2XD 1NI2A 1X1GA 3TFMA 4GMXB 1KZGA 1V5PA 2YVCA 3KZ1A 3BINA 1ISNA 2D10A 4KHAA 1XR0B 1GG3A 3KRXA 4MY6A 3NSUA 4YONA 2E2XA 5D3YA 3V5WA 1MKEA 3PSCA 1NU2A 1U5EA 2P0HA 2NMBA 5CLLB 3DXDA 1X05A 2CRFA 3ZDTA 1PMSA 4NY0A 1KZ7A 1QC6A 1FHOA 4HAVB 3O96A 3ODOA 3G9WA 1U5FA 4HB0B 4YL8A 2N23A 3AU5A 2J59M 2RUKB 2DYQA 1W1HA 2K2UA 4ZRIA 2EC1A 2D2QA 1BAKA 1E5WA 2RLOA 2FJLA 1X86A 1WG7A 2DFKA 4GN1A 3HQCA 1SHCA 2ROZB 1P5TA 2ELBA 2DLWA 2W2XC 4XWXA 2J0JA 3U7DA 1FAOA 2UVMA 2DTCA 2EMSA 2DN6A 2M38A 2MKRA 1V61A 3PVLA 5D3VA 2COFA 4ZRJA 1MK9B 1K5GB 2AL6A 5JLJB 1MIZB 3BJIA 1EVHA 3IVFA 1OY2A 4HATB 1FGYA 1J19A 1X1FA 2MWNB 2OTXA 5HE3A 1GC7A 3TCAA 1ZC4B 5D27A 1NTYA 4EJNA 1XKEA 1UPRA 2VRWB 2YS3A 1WI1A 2OQBA 1EAZA 2Y8GA 4A6KA 3RCPA 4DXAB 1PLSA 4MK0A 2D9XA 2VKIA 4Y94A 4HDOA 2UZSA 2LOZA 2X18A 1EGXA 2RNRB 1BTNA 5JP4A 2N0YA 2JP2A 5L81A 2R09A 2DX5A 2KGXB 2L2IA 2COAA 1FB8A 1DYNA 2I1JA 3F0WA 2Z0OA 5HE0A 1Q67A 3A8QA 1DDMA 1XD4A 5KQ1A 3KRWA 2D4QA 2KCJA 1AQCA 3D8FA 2QKLA 4D0NB 3SO6A 1WJ1A 1DDWA 2DHJA 2DHKA 2RGNB 3OANA 1TJ6A 3TW1A 4Z2NA 4Z2MB 2COCA 2J0MA 1U27A 2NZ8B 1ZC3B 4TKNA 5HE1A 2DA0A 3PVUA 2YS5A 5KCVA 2BCJA 4A6HA 2L1CA 3P7ZA 1UNPA 3CIKA 4K2PA 2MDXA 2I1KA 4K2OA 5C5BB 1KI1B 2G35A 1SGHA 2DKQA 2D9YA 3FM8C 5KQ4A 1AWEA 4HB3B 4IFSA 2RSGA 1W1GA 3UZTA 2YS1A 1OMWA 4KVGB 1M7EA 1MK7B 1RJ2A 5C6RA 2QKMA 4F7UP 2HE7A 5HE2A 3KSYA 3QBVB 2P8VA 4PNKA 1J0WA 2ELAA 3SUZA 4CHMA 1M7RA 1W1DA 1FHXA 3ULBA 2XQNM 4WSFA 2IYBA 5LONB 4WJ7A 5JHGA 4PQ0A 2M14A 2YF0A 2AEHA 3PEGA 4H8SA 3PG7A 4IAPA 2D11A 3ZVRA 1V88A 2Z0PA 3SYXA 4C0AA 1LB1A 3HK0A 4GPTB 2YSZA 4F7GA 4A6FB 3QIJA 1Z87A 2CY4A 2Z0QA 4IOYX 2Y8FA 5D3XA 1H10A 2CAYA 4HAWB 3P6AA 2GCJA 1WGQA 3HW2B 2DKPA 1MIXA 3T06A 2LYDA 4F7HA 2DYNA 3CXBB 1NTVA 4K81A 2CY5A 1B55A 2KUPA 3QWMA 1UNQA 3M1IB 1UNRA 4HB2B 1XCGA 5FI1A 3VIAA 5DHAB 2LG1A 1FOEA 1TQZA 2CODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y5O A;  5FI0 A;  4KAX B;  1EF1 A;  4CHJ A;  5DHF B;  3MDB C;  1Y19 B;  2LOX A;  1U5D A;  2P0F A;  1WVH A;  1MPH A;  5GOW B;  1V5M A;  2PZ1 A;  4TYZ A;  1QQG A;  4CYE A;  5JHH A;  3DXC A;  4BBK A;  1FGZ A;  4HHV A;  4WVF B;  1DRO A;  5C16 A;  2D9Z A;  5DH9 B;  2EJ8 A;  3MPX A;  1V89 A;  5LOP B;  2GCL A;  2K00 A;  2DHI A;  5C79 A;  1ZM0 A;  2GJY A;  3ODX A;  2DX1 A;  4A6F A;  3AU4 A;  2LUL A;  3WA0 A;  4GXB A;  4KHO A;  4HDQ A;  4A5K A;  3TVV A;  1BTK A;  4EKU A;  4DBB A;  1DBH A;  4HB4 B;  1ZSQ A;  3SNH A;  2VSZ A;  2W2W A;  1FHW A;  2P0D A;  2V76 A;  3A98 B;  3ULC A;  4HAU B;  1P3R A;  4EMO A;  3LJU X;  4NSW A;  1XOD A;  1N3H A;  2D9W A;  4HAX B;  3TO1 A;  2IFS A;  1UPQ A;  1I7A A;  3FSS A;  2ROV A;  5DI9 B;  4ZRK A;  5D3W A;  3AJ4 A;  2HTH B;  1H4R A;  5J3T A;  1WJM A;  2H7D A;  2R0D A;  3U8Z A;  2H7E A;  3D8D A;  4HAY B;  4L6E A;  2J0K A;  3VOQ A;  4P7I A;  2D9V A;  1V5U A;  2UZR A;  2YRY A;  1IRS A;  4MT7 A;  3GYO A;  5C5B A;  1RRP B;  3N7C A;  1X11 A;  3PP2 A;  1U5G A;  3KY9 A;  2Y7B A;  3DXE A;  5DIF B;  3X23 A;  4B6H A;  3PVW A;  2LKO A;  2YT0 A;  3SV1 A;  2I5C A;  4HAZ B;  4DX9 0;  1GC6 A;  1OQN A;  1U29 A;  2EMT A;  2MFQ A;  2I5F A;  2YT1 A;  4DX8 A;  2Q13 A;  1PFJ A;  2GS0 A;  3ODW A;  1DDV A;  1WGU A;  3FEH A;  1I2H A;  1LW3 A;  4GZU A;  1ZVR A;  1P6S A;  5CLQ B;  1U2B A;  4K17 A;  4KHB B;  3F5R A;  5J3Q A;  1K5D B;  3PZD A;  5EFX A;  1BWN A;  5J3Y A;  2ZPY A;  1UEF A;  1TXD A;  2ADZ A;  1MAI A;  1XX0 A;  3ML4 A;  3WYF B;  2RVB B;  4GMV A;  3D8E A;  2K2J A;  3GYP A;  3A8P A;  2W2X D;  1NI2 A;  1X1G A;  3TFM A;  4GMX B;  1KZG A;  1V5P A;  2YVC A;  3KZ1 A;  3BIN A;  1ISN A;  2D10 A;  4KHA A;  1XR0 B;  1GG3 A;  3KRX A;  4MY6 A;  3NSU A;  4YON A;  2E2X A;  5D3Y A;  3V5W A;  1MKE A;  3PSC A;  1NU2 A;  1U5E A;  2P0H A;  2NMB A;  5CLL B;  3DXD A;  1X05 A;  2CRF A;  3ZDT A;  1PMS A;  4NY0 A;  1KZ7 A;  1QC6 A;  1FHO A;  4HAV B;  3O96 A;  3ODO A;  3G9W A;  1U5F A;  4HB0 B;  4YL8 A;  2N23 A;  3AU5 A;  2J59 M;  2RUK B;  2DYQ A;  1W1H A;  2K2U A;  4ZRI A;  2EC1 A;  2D2Q A;  1BAK A;  1E5W A;  2RLO A;  2FJL A;  1X86 A;  1WG7 A;  2DFK A;  4GN1 A;  3HQC A;  1SHC A;  2ROZ B;  1P5T A;  2ELB A;  2DLW A;  2W2X C;  4XWX A;  2J0J A;  3U7D A;  1FAO A;  2UVM A;  2DTC A;  2EMS A;  2DN6 A;  2M38 A;  2MKR A;  1V61 A;  3PVL A;  5D3V A;  2COF A;  4ZRJ A;  1MK9 B;  1K5G B;  2AL6 A;  5JLJ B;  1MIZ B;  3BJI A;  1EVH A;  3IVF A;  1OY2 A;  4HAT B;  1FGY A;  1J19 A;  1X1F A;  2MWN B;  2OTX A;  5HE3 A;  1GC7 A;  3TCA A;  1ZC4 B;  5D27 A;  1NTY A;  4EJN A;  1XKE A;  1UPR A;  2VRW B;  2YS3 A;  1WI1 A;  2OQB A;  1EAZ A;  2Y8G A;  4A6K A;  3RCP A;  4DXA B;  1PLS A;  4MK0 A;  2D9X A;  2VKI A;  4Y94 A;  4HDO A;  2UZS A;  2LOZ A;  2X18 A;  1EGX A;  2RNR B;  1BTN A;  5JP4 A;  2N0Y A;  2JP2 A;  5L81 A;  2R09 A;  2DX5 A;  2KGX B;  2L2I A;  2COA A;  1FB8 A;  1DYN A;  2I1J A;  3F0W A;  2Z0O A;  5HE0 A;  1Q67 A;  3A8Q A;  1DDM A;  1XD4 A;  5KQ1 A;  3KRW A;  2D4Q A;  2KCJ A;  1AQC A;  3D8F A;  2QKL A;  4D0N B;  3SO6 A;  1WJ1 A;  1DDW A;  2DHJ A;  2DHK A;  2RGN B;  3OAN A;  1TJ6 A;  3TW1 A;  4Z2N A;  4Z2M B;  2COC A;  2J0M A;  1U27 A;  2NZ8 B;  1ZC3 B;  4TKN A;  5HE1 A;  2DA0 A;  3PVU A;  2YS5 A;  5KCV A;  2BCJ A;  4A6H A;  2L1C A;  3P7Z A;  1UNP A;  3CIK A;  4K2P A;  2MDX A;  2I1K A;  4K2O A;  5C5B B;  1KI1 B;  2G35 A;  1SGH A;  2DKQ A;  2D9Y A;  3FM8 C;  5KQ4 A;  1AWE A;  4HB3 B;  4IFS A;  2RSG A;  1W1G A;  3UZT A;  2YS1 A;  1OMW A;  4KVG B;  1M7E A;  1MK7 B;  1RJ2 A;  5C6R A;  2QKM A;  4F7U P;  2HE7 A;  5HE2 A;  3KSY A;  3QBV B;  2P8V A;  4PNK A;  1J0W A;  2ELA A;  3SUZ A;  4CHM A;  1M7R A;  1W1D A;  1FHX A;  3ULB A;  2XQN M;  4WSF A;  2IYB A;  5LON B;  4WJ7 A;  5JHG A;  4PQ0 A;  2M14 A;  2YF0 A;  2AEH A;  3PEG A;  4H8S A;  3PG7 A;  4IAP A;  2D11 A;  3ZVR A;  1V88 A;  2Z0P A;  3SYX A;  4C0A A;  1LB1 A;  3HK0 A;  4GPT B;  2YSZ A;  4F7G A;  4A6F B;  3QIJ A;  1Z87 A;  2CY4 A;  2Z0Q A;  4IOY X;  2Y8F A;  5D3X A;  1H10 A;  2CAY A;  4HAW B;  3P6A A;  2GCJ A;  1WGQ A;  3HW2 B;  2DKP A;  1MIX A;  3T06 A;  2LYD A;  4F7H A;  2DYN A;  3CXB B;  1NTV A;  4K81 A;  2CY5 A;  1B55 A;  2KUP A;  3QWM A;  1UNQ A;  3M1I B;  1UNR A;  4HB2 B;  1XCG A;  5FI1 A;  3VIA A;  5DHA B;  2LG1 A;  1FOE A;  1TQZ A;  2COD A; 
#chains in the Genus database with same CATH topology
 1Y5O A;  4QJ4 B;  5FI0 A;  4KAX B;  1EF1 A;  4CHJ A;  5DHF B;  3MDB C;  1Y19 B;  2LOX A;  1U5D A;  2P0F A;  2ZKM X;  3A58 A;  1WVH A;  1MPH A;  5GOW B;  1V5M A;  2PZ1 A;  4TYZ A;  1QQG A;  4CYE A;  5JHH A;  3DXC A;  4BBK A;  1FGZ A;  4HHV A;  4WVF B;  1DRO A;  5C16 A;  2D9Z A;  5DH9 B;  2EJ8 A;  4OT1 A;  3U12 A;  3MPX A;  1V89 A;  5LOP B;  2GCL A;  2K00 A;  2DHI A;  5C79 A;  1ZM0 A;  2GJY A;  3ODX A;  2DX1 A;  4A6F A;  3AU4 A;  2LUL A;  3WA0 A;  4GXB A;  4KHO A;  4HDQ A;  2K49 A;  4A5K A;  3TVV A;  1BTK A;  4EKU A;  4DBB A;  1DBH A;  4HB4 B;  1ZSQ A;  3SNH A;  2VSZ A;  2W2W A;  2GUM A;  1FHW A;  2P0D A;  2V76 A;  3A98 B;  3ULC A;  4HAU B;  1P3R A;  3HIE A;  4EMO A;  4QJ5 B;  3LJU X;  4NSW A;  1XOD A;  1N3H A;  2D9W A;  4HAX B;  3TO1 A;  2IFS A;  1UPQ A;  1I7A A;  3FSS A;  2ROV A;  5DI9 B;  4ZRK A;  5D3W A;  3AJ4 A;  3NW8 A;  2HTH B;  1H4R A;  5J3T A;  1WJM A;  2H7D A;  2RRF A;  2R0D A;  3U8Z A;  2H7E A;  3D8D A;  4HAY B;  4L6E A;  2J0K A;  3VOQ A;  4P7I A;  2D9V A;  1V5U A;  2UZR A;  3NWD A;  2YRY A;  1IRS A;  4MT7 A;  3GYO A;  5C5B A;  1RRP B;  3N7C A;  1X11 A;  3PP2 A;  5I2M A;  1U5G A;  3KY9 A;  2Y7B A;  3DXE A;  5DIF B;  3X23 A;  4B6H A;  3PVW A;  4GOU A;  2LKO A;  2YT0 A;  3SV1 A;  5M4Y B;  2I5C A;  4HAZ B;  4DX9 0;  1GC6 A;  1OQN A;  1U29 A;  2EMT A;  4HSI A;  2MFQ A;  2I5F A;  2YT1 A;  4DX8 A;  2Q13 A;  1PFJ A;  2GS0 A;  5I2S A;  4CSQ A;  2Z59 A;  4L1R A;  3ODW A;  1DDV A;  1WGU A;  3FEH A;  1I2H A;  1LW3 A;  4GZU A;  1ZVR A;  1P6S A;  5CLQ B;  1U2B A;  4K17 A;  4KHB B;  3F5R A;  4GNK B;  5J3Q A;  1K5D B;  3PZD A;  5EFX A;  1BWN A;  5J3Y A;  2ZPY A;  1UEF A;  1TXD A;  2ADZ A;  1MAI A;  1XX0 A;  3ML4 A;  3WYF B;  2RVB B;  4GMV A;  3D8E A;  2K2J A;  3GYP A;  3A8P A;  2W2X D;  1NI2 A;  1X1G A;  2R2Y A;  3TFM A;  4GMX B;  1KZG A;  1V5P A;  2YVC A;  5LG4 B;  3KZ1 A;  3BIN A;  1ISN A;  2D10 A;  2NBV A;  4KHA A;  1XR0 B;  1GG3 A;  3KRX A;  4MY6 A;  3FVC A;  3NSU A;  4YON A;  2E2X A;  5D3Y A;  3V5W A;  3OHM B;  1MKE A;  3PSC A;  1NU2 A;  1U5E A;  2P0H A;  2NMB A;  5CLL B;  3DXD A;  1X05 A;  2CRF A;  3ZDT A;  1PMS A;  4NY0 A;  1KZ7 A;  1QC6 A;  1FHO A;  4HAV B;  3O96 A;  3ODO A;  3G9W A;  1U5F A;  4HB0 B;  4YL8 A;  2N23 A;  3AU5 A;  2J59 M;  2RUK B;  4D6W A;  2DYQ A;  1W1H A;  2K2U A;  4ZRI A;  2EC1 A;  2D2Q A;  1BAK A;  1E5W A;  2RLO A;  2FJL A;  1X86 A;  1WG7 A;  2DFK A;  4GN1 A;  3HQC A;  1SHC A;  2ROZ B;  1P5T A;  2ELB A;  2DLW A;  2W2X C;  4XWX A;  2J0J A;  4KHB A;  3U7D A;  1FAO A;  2KIE A;  2UVM A;  2DTC A;  1ZYI A;  2DN6 A;  2EMS A;  2M38 A;  2MKR A;  1V61 A;  3PVL A;  5D3V A;  2COF A;  4ZRJ A;  1MK9 B;  1K5G B;  2AL6 A;  5JLJ B;  1MIZ B;  3BJI A;  1EVH A;  3IVF A;  1OY2 A;  4HAT B;  1FGY A;  1J19 A;  1X1F A;  4DIX A;  2MWN B;  2OTX A;  5HE3 A;  1GC7 A;  3TCA A;  1ZC4 B;  5D27 A;  1NTY A;  4EJN A;  1XKE A;  1UPR A;  2VRW B;  2YS3 A;  1WI1 A;  2OQB A;  1EAZ A;  2Y8G A;  4A6K A;  3RCP A;  4DXA B;  1PLS A;  4MK0 A;  2D9X A;  2VKI A;  4Y94 A;  4HDO A;  2UZS A;  2LOZ A;  2X18 A;  1EGX A;  2RNR B;  1BTN A;  5JP4 A;  2N0Y A;  2JP2 A;  5L81 A;  2R09 A;  2DX5 A;  2KGX B;  2L2I A;  2COA A;  1FB8 A;  1DYN A;  2I1J A;  3HSA A;  4OSN A;  3F0W A;  2Z0O A;  5HE0 A;  1Q67 A;  3A8Q A;  1DDM A;  2Z13 A;  1XD4 A;  5KQ1 A;  3KRW A;  2D4Q A;  2KCJ A;  1AQC A;  3D8F A;  2QKL A;  4D0N B;  3SO6 A;  1WJ1 A;  1DDW A;  2DHJ A;  1MI1 A;  2DHK A;  2RGN B;  3OAN A;  1TJ6 A;  1T77 A;  3TW1 A;  4Z2N A;  3NWA A;  2YT2 A;  4Z2M B;  2COC A;  2J0M A;  1U27 A;  2NZ8 B;  1ZC3 B;  4TKN A;  5HE1 A;  2DA0 A;  3PVU A;  2YS5 A;  5KCV A;  2Z14 A;  2BCJ A;  4A6H A;  2L1C A;  3P7Z A;  1UNP A;  3CIK A;  4K2P A;  2MDX A;  2I1K A;  4K2O A;  5C5B B;  1KI1 B;  3B77 A;  2G35 A;  1SGH A;  2DKQ A;  5IRS A;  2D9Y A;  3FM8 C;  5KQ4 A;  1AWE A;  4HB3 B;  4IFS A;  2KIG A;  2FJU B;  2RSG A;  1W1G A;  3UZT A;  2YS1 A;  1OMW A;  4KVG B;  1M7E A;  1MK7 B;  1RJ2 A;  5C6R A;  2QKM A;  4F7U P;  2HE7 A;  5HE2 A;  3KSY A;  3QBV B;  2P8V A;  4PNK A;  1J0W A;  2ELA A;  3SUZ A;  4CHM A;  1M7R A;  1W1D A;  1FHX A;  3ULB A;  2XQN M;  4WSF A;  3DCX A;  2IYB A;  5LON B;  4WJ7 A;  5JHG A;  3NWF A;  4PQ0 A;  2M14 A;  2YF0 A;  2AEH A;  3PEG A;  4H8S A;  3PG7 A;  4IAP A;  4QXA B;  2D11 A;  3ZVR A;  1V88 A;  2Z0P A;  2Z4D A;  2K8E A;  3SYX A;  4C0A A;  1LB1 A;  3HK0 A;  4GPT B;  2YSZ A;  4F7G A;  4A6F B;  3QIJ A;  1Z87 A;  2CY4 A;  2KR0 A;  2Z0Q A;  4IOY X;  2Y8F A;  5D3X A;  1H10 A;  2CAY A;  4HAW B;  3P6A A;  2KUQ A;  2GCJ A;  1WGQ A;  3HW2 B;  2DKP A;  1MIX A;  3T06 A;  2LYD A;  4F7H A;  2DYN A;  3CXB B;  1NTV A;  4K81 A;  2CY5 A;  1B55 A;  2KUP A;  3QWM A;  1UNQ A;  3M1I B;  1UNR A;  4HB2 B;  1XCG A;  5FI1 A;  3VIA A;  4QJ3 B;  5DHA B;  2LG1 A;  1FOE A;  1TQZ A;  2COD A; 
#chains in the Genus database with same CATH homology
 1Y5O A;  5FI0 A;  4KAX B;  1EF1 A;  4CHJ A;  5DHF B;  3MDB C;  1Y19 B;  2LOX A;  1U5D A;  2P0F A;  1WVH A;  1MPH A;  5GOW B;  1V5M A;  2PZ1 A;  4TYZ A;  1QQG A;  4CYE A;  5JHH A;  3DXC A;  4BBK A;  1FGZ A;  4HHV A;  4WVF B;  1DRO A;  5C16 A;  2D9Z A;  5DH9 B;  2EJ8 A;  3MPX A;  1V89 A;  5LOP B;  2GCL A;  2K00 A;  2DHI A;  5C79 A;  1ZM0 A;  2GJY A;  3ODX A;  2DX1 A;  4A6F A;  3AU4 A;  2LUL A;  3WA0 A;  4GXB A;  4KHO A;  4HDQ A;  4A5K A;  3TVV A;  1BTK A;  4EKU A;  4DBB A;  1DBH A;  4HB4 B;  1ZSQ A;  3SNH A;  2VSZ A;  2W2W A;  1FHW A;  2P0D A;  2V76 A;  3A98 B;  3ULC A;  4HAU B;  1P3R A;  4EMO A;  3LJU X;  4NSW A;  1XOD A;  1N3H A;  2D9W A;  4HAX B;  3TO1 A;  2IFS A;  1UPQ A;  1I7A A;  3FSS A;  2ROV A;  5DI9 B;  4ZRK A;  5D3W A;  3AJ4 A;  2HTH B;  1H4R A;  5J3T A;  1WJM A;  2H7D A;  2R0D A;  3U8Z A;  2H7E A;  3D8D A;  4HAY B;  4L6E A;  2J0K A;  3VOQ A;  4P7I A;  2D9V A;  1V5U A;  2UZR A;  2YRY A;  1IRS A;  4MT7 A;  3GYO A;  5C5B A;  1RRP B;  3N7C A;  1X11 A;  3PP2 A;  1U5G A;  3KY9 A;  2Y7B A;  3DXE A;  5DIF B;  3X23 A;  4B6H A;  3PVW A;  2LKO A;  2YT0 A;  3SV1 A;  2I5C A;  4HAZ B;  4DX9 0;  1GC6 A;  1OQN A;  1U29 A;  2EMT A;  2MFQ A;  2I5F A;  2YT1 A;  4DX8 A;  2Q13 A;  1PFJ A;  2GS0 A;  3ODW A;  1DDV A;  1WGU A;  3FEH A;  1I2H A;  1LW3 A;  4GZU A;  1ZVR A;  1P6S A;  5CLQ B;  1U2B A;  4K17 A;  4KHB B;  3F5R A;  5J3Q A;  1K5D B;  3PZD A;  5EFX A;  1BWN A;  5J3Y A;  2ZPY A;  1UEF A;  1TXD A;  2ADZ A;  1MAI A;  1XX0 A;  3ML4 A;  3WYF B;  2RVB B;  4GMV A;  3D8E A;  2K2J A;  3GYP A;  3A8P A;  2W2X D;  1NI2 A;  1X1G A;  3TFM A;  4GMX B;  1KZG A;  1V5P A;  2YVC A;  3KZ1 A;  3BIN A;  1ISN A;  2D10 A;  4KHA A;  1XR0 B;  1GG3 A;  3KRX A;  4MY6 A;  3NSU A;  4YON A;  2E2X A;  5D3Y A;  3V5W A;  1MKE A;  3PSC A;  1NU2 A;  1U5E A;  2P0H A;  2NMB A;  5CLL B;  3DXD A;  1X05 A;  2CRF A;  3ZDT A;  1PMS A;  4NY0 A;  1KZ7 A;  1QC6 A;  1FHO A;  4HAV B;  3O96 A;  3ODO A;  3G9W A;  1U5F A;  4HB0 B;  4YL8 A;  2N23 A;  3AU5 A;  2J59 M;  2RUK B;  2DYQ A;  1W1H A;  2K2U A;  4ZRI A;  2EC1 A;  2D2Q A;  1BAK A;  1E5W A;  2RLO A;  2FJL A;  1X86 A;  1WG7 A;  2DFK A;  4GN1 A;  3HQC A;  1SHC A;  2ROZ B;  1P5T A;  2ELB A;  2DLW A;  2W2X C;  4XWX A;  2J0J A;  3U7D A;  1FAO A;  2UVM A;  2DTC A;  2EMS A;  2DN6 A;  2M38 A;  2MKR A;  1V61 A;  3PVL A;  5D3V A;  2COF A;  4ZRJ A;  1MK9 B;  1K5G B;  2AL6 A;  5JLJ B;  1MIZ B;  3BJI A;  1EVH A;  3IVF A;  1OY2 A;  4HAT B;  1FGY A;  1J19 A;  1X1F A;  2MWN B;  2OTX A;  5HE3 A;  1GC7 A;  3TCA A;  1ZC4 B;  5D27 A;  1NTY A;  4EJN A;  1XKE A;  1UPR A;  2VRW B;  2YS3 A;  1WI1 A;  2OQB A;  1EAZ A;  2Y8G A;  4A6K A;  3RCP A;  4DXA B;  1PLS A;  4MK0 A;  2D9X A;  2VKI A;  4Y94 A;  4HDO A;  2UZS A;  2LOZ A;  2X18 A;  1EGX A;  2RNR B;  1BTN A;  5JP4 A;  2N0Y A;  2JP2 A;  5L81 A;  2R09 A;  2DX5 A;  2KGX B;  2L2I A;  2COA A;  1FB8 A;  1DYN A;  2I1J A;  3F0W A;  2Z0O A;  5HE0 A;  1Q67 A;  3A8Q A;  1DDM A;  1XD4 A;  5KQ1 A;  3KRW A;  2D4Q A;  2KCJ A;  1AQC A;  3D8F A;  2QKL A;  4D0N B;  3SO6 A;  1WJ1 A;  1DDW A;  2DHJ A;  2DHK A;  2RGN B;  3OAN A;  1TJ6 A;  3TW1 A;  4Z2N A;  4Z2M B;  2COC A;  2J0M A;  1U27 A;  2NZ8 B;  1ZC3 B;  4TKN A;  5HE1 A;  2DA0 A;  3PVU A;  2YS5 A;  5KCV A;  2BCJ A;  4A6H A;  2L1C A;  3P7Z A;  1UNP A;  3CIK A;  4K2P A;  2MDX A;  2I1K A;  4K2O A;  5C5B B;  1KI1 B;  2G35 A;  1SGH A;  2DKQ A;  2D9Y A;  3FM8 C;  5KQ4 A;  1AWE A;  4HB3 B;  4IFS A;  2RSG A;  1W1G A;  3UZT A;  2YS1 A;  1OMW A;  4KVG B;  1M7E A;  1MK7 B;  1RJ2 A;  5C6R A;  2QKM A;  4F7U P;  2HE7 A;  5HE2 A;  3KSY A;  3QBV B;  2P8V A;  4PNK A;  1J0W A;  2ELA A;  3SUZ A;  4CHM A;  1M7R A;  1W1D A;  1FHX A;  3ULB A;  2XQN M;  4WSF A;  2IYB A;  5LON B;  4WJ7 A;  5JHG A;  4PQ0 A;  2M14 A;  2YF0 A;  2AEH A;  3PEG A;  4H8S A;  3PG7 A;  4IAP A;  2D11 A;  3ZVR A;  1V88 A;  2Z0P A;  3SYX A;  4C0A A;  1LB1 A;  3HK0 A;  4GPT B;  2YSZ A;  4F7G A;  4A6F B;  3QIJ A;  1Z87 A;  2CY4 A;  2Z0Q A;  4IOY X;  2Y8F A;  5D3X A;  1H10 A;  2CAY A;  4HAW B;  3P6A A;  2GCJ A;  1WGQ A;  3HW2 B;  2DKP A;  1MIX A;  3T06 A;  2LYD A;  4F7H A;  2DYN A;  3CXB B;  1NTV A;  4K81 A;  2CY5 A;  1B55 A;  2KUP A;  3QWM A;  1UNQ A;  3M1I B;  1UNR A;  4HB2 B;  1XCG A;  5FI1 A;  3VIA A;  5DHA B;  2LG1 A;  1FOE A;  1TQZ A;  2COD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...