2KCJA

Solution structure of fapp1 ph domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
b'GPLGSPEFMEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKASLTDTRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family A member 3
publication title Structural basis of wedging the Golgi membrane by FAPP pleckstrin homology domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2kcjA00
1V61A 2DFKA 5J3QA 2D9XA 4TYZA 2OTXA 2RGNB 1MK7B 1FOEA 3A8PA 3ZDTA 2Z0OA 3HK0A 4EJNA 3KRWA 1U5EA 1Y19B 1EF1A 3ODXA 1FHXA 4B6HA 2L1CA 1U5DA 2CODA 1QQGA 5KQ1A 5D3VA 2CAYA 1PMSA 2D9YA 2RUKB 1DBHA 5D27A 5DHAB 1BAKA 1LB1A 5DIFB 1MPHA 1X1GA 1NU2A 1UEFA 4P7IA 5LOPB 4MT7A 4K17A 3SUZA 3FM8C 2K00A 1OY2A 2G35A 3F0WA 2N23A 5C6RA 4HAVB 1IRSA 5GOWB 2LOZA 3ULCA 2DYQA 3KZ1A 3ML4A 3PVLA 5HE2A 1J0WA 3V5WA 1FGYA 1BWNA 1FHOA 2W2XD 3PEGA 4ZRJA 5KQ4A 1ZVRA 5FI1A 2YRYA 3SO6A 2DTCA 1GG3A 1AWEA 2QKLA 2DKPA 2UVMA 4HDQA 2W2XC 2K2JA 1XD4A 2DHKA 2L2IA 2DA0A 4KVGB 2DLWA 2I5FA 3F5RA 1AQCA 4EMOA 2DX1A 3KY9A 3VIAA 5C5BB 1DDVA 4KHAA 1KI1B 3U8ZA 5J3TA 3ULBA 2GS0A 5KCVA 1TQZA 1M7RA 4DX8A 1E5WA 4F7UP 4IFSA 2P8VA 3PG7A 2ROZB 2H7EA 4F7HA 3DXEA 2GCLA 5DH9B 1EAZA 3CXBB 3A8QA 4DXAB 2VRWB 5DHFB 4HB2B 1RJ2A 4KHOA 4K2OA 3M1IB 1WI1A 4GZUA 5EFXA 1UPQA 3N7CA 1MAIA 4F7GA 1ZM0A 2N0YA 1I2HA 1ISNA 3U7DA 1EVHA 2J0MA 1N3HA 3QBVB 1PFJA 3T06A 1MK9B 3DXDA 2LOXA 4TKNA 3PZDA 2ELBA 1Y5OA 3BINA 2QKMA 1U27A 1W1HA 2J0KA 1W1GA 2IYBA 1DDWA 1PLSA 2KGXB 2IFSA 5JHHA 3WA0A 1XCGA 3MDBC 2YVCA 2J59M 2RNRB 1H10A 2EJ8A 3UZTA 3ODWA 4CHJA 2MKRA 1DROA 4DBBA 1DYNA 4ZRKA 2YSZA 1ZSQA 2AL6A 3HW2B 2P0FA 2UZRA 1DDMA 2P0HA 3HQCA 4XWXA 5DI9B 1BTKA 4K2PA 4Z2NA 1MKEA 4K81A 2I1JA 1UNPA 2Z0QA 2LG1A 2CY4A 2JP2A 5HE3A 2M14A 1M7EA 1K5GB 4HAWB 2J0JA 4H8SA 4A6HA 2E2XA 3SV1A 4PNKA 4HAYB 2V76A 4GMXB 1V5PA 2EC1A 2D11A 3FEHA 1QC6A 1XODA 2I5CA 4HB4B 4WJ7A 3TW1A 4HAZB 3G9WA 2YS5A 5CLQB 2YS3A 5LONB 2NMBA 3KSYA 3TO1A 2AEHA 4A6KA 2RSGA 2Y8FA 3BJIA 4HATB 3TFMA 1OQNA 4HDOA 2ELAA 3TCAA 3P7ZA 5HE0A 5HE1A 5JHGA 1P3RA 1FHWA 1FAOA 2H7DA 5D3YA 2D9VA 4WSFA 3ZVRA 3AJ4A 3IVFA 3PVUA 1GC6A 3TVVA 1WVHA 4EKUA 5CLLB 1NTYA 2K2UA 4Z2MB 4HB3B 1XX0A 3ODOA 4IAPA 4D0NB 1X86A 4A6FB 4ZRIA 2RVBB 2COCA 1UPRA 1U29A 4HAXB 2D9ZA 2FJLA 3NSUA 1BTNA 2Q13A 2VKIA 4C0AA 2COFA 1MIXA 3O96A 1V89A 1Q67A 2LULA 3PSCA 4GXBA 2M38A 2D9WA 2DHIA 2P0DA 3LJUX 3D8EA 4MK0A 3MPXA 5D3WA 1H4RA 2YT0A 1V5UA 2MWNB 3VOQA 4GPTB 1GC7A 4HB0B 3WYFB 5C5BA 1U2BA 4GN1A 4HAUB 1SHCA 2Y8GA 2R09A 1TXDA 2CY5A 3D8DA 2GCJA 2UZSA 2MFQA 2DN6A 1P5TA 4Y94A 2CRFA 1WJMA 3AU4A 3D8FA 1Z87A 4PQ0A 2D2QA 2YT1A 4HHVA 2COAA 2DYNA 3QWMA 5C16A 2VSZA 1ZC3B 1J19A 2BCJA 1WGUA 4NSWA 1KZ7A 4CHMA 2Y7BA 4DX90 2RLOA 2ROVA 5JLJB 1V88A 2I1KA 1UNRA 2OQBA 2GJYA 1EGXA 4MY6A 1V5MA 4BBKA 4WVFB 3AU5A 2MDXA 5J3YA 1TJ6A 2YS1A 3SYXA 4A6FA 3GYPA 3OANA 2XQNM 4YONA 1K5DB 2LYDA 1X05A 1W1DA 1FB8A 2EMTA 2LKOA 1XKEA 1SGHA 3CIKA 4NY0A 3FSSA 1NI2A 4L6EA 5FI0A 1NTVA 1X1FA 3DXCA 3P6AA 3RCPA 5C79A 3A98B 1WJ1A 4IOYX 3PVWA 4CYEA 1MIZB 1KZGA 3GYOA 4KHBB 2R0DA 2KUPA 2DX5A 2NZ8B 1ZC4B 3QIJA 1B55A 2ADZA 4A5KA 1FGZA 2HE7A 2EMSA 3SNHA 2KCJA 4KAXB 1LW3A 1OMWA 1U5FA 3KRXA 2ZPYA 1U5GA 1WGQA 2PZ1A 2Z0PA 1UNQA 2DKQA 2W2WA 1I7AA 4GMVA 4YL8A 5JP4A 2X18A 2D4QA 3PP2A 1X11A 2D10A 2HTHB 3X23A 1WG7A 5D3XA 2DHJA 2YF0A 1P6SA 1XR0B 5L81A 1RRPB
chains in the Genus database with same CATH superfamily
1V61A 2DFKA 4L1RA 5J3QA 2D9XA 4TYZA 2OTXA 2RGNB 1MK7B 1FOEA 2RRFA 3A8PA 2Z0OA 3HK0A 3ZDTA 4EJNA 3KRWA 1U5EA 1Y19B 1EF1A 3ODXA 4DIXA 4QJ3B 1FHXA 4B6HA 2L1CA 1U5DA 2CODA 1QQGA 5KQ1A 5D3VA 2CAYA 1PMSA 2D9YA 2FJUB 1DBHA 2RUKB 5D27A 5DHAB 1BAKA 2K49A 1LB1A 5DIFB 1ZYIA 1MPHA 1X1GA 1NU2A 1UEFA 4P7IA 5LOPB 5I2SA 4MT7A 4K17A 3SUZA 3FM8C 2K00A 1OY2A 3A58A 2G35A 3F0WA 2N23A 5C6RA 3FVCA 4HAVB 1IRSA 5GOWB 2LOZA 3ULCA 2DYQA 3KZ1A 3ML4A 3PVLA 5HE2A 2NBVA 1J0WA 3V5WA 1FGYA 1BWNA 1FHOA 2W2XD 3PEGA 4ZRJA 5KQ4A 1ZVRA 5FI1A 2YRYA 3SO6A 3B77A 2DTCA 1GG3A 1AWEA 2QKLA 2DKPA 2UVMA 4HDQA 2W2XC 2K2JA 1XD4A 2DHKA 2L2IA 2DA0A 4KVGB 2DLWA 2I5FA 3F5RA 1AQCA 4EMOA 2DX1A 3KY9A 3VIAA 5C5BB 1DDVA 4KHAA 1KI1B 3U8ZA 5J3TA 3ULBA 2GS0A 5KCVA 1TQZA 1M7RA 4DX8A 1E5WA 4F7UP 4IFSA 2P8VA 3PG7A 2ROZB 2H7EA 4F7HA 3DXEA 2GCLA 5DH9B 1EAZA 3CXBB 3A8QA 4DXAB 2VRWB 3DCXA 5DHFB 4HB2B 1RJ2A 4KHOA 4K2OA 3M1IB 1WI1A 4GZUA 5EFXA 1UPQA 3N7CA 1MAIA 4F7GA 1ZM0A 2N0YA 1I2HA 1ISNA 3U7DA 1EVHA 2J0MA 1N3HA 3QBVB 1PFJA 3T06A 1MK9B 3DXDA 2LOXA 4TKNA 3PZDA 2ELBA 1Y5OA 3BINA 2QKMA 1U27A 1W1HA 2KR0A 2Z4DA 2KUQA 2J0KA 1W1GA 2Z14A 2IYBA 1DDWA 1PLSA 2KGXB 2IFSA 5JHHA 3WA0A 1XCGA 3MDBC 2YVCA 2J59M 4KHBA 2RNRB 1H10A 2EJ8A 3UZTA 3ODWA 4CHJA 2MKRA 1DROA 4DBBA 1DYNA 4ZRKA 1T77A 2YSZA 1ZSQA 2AL6A 3HW2B 2P0FA 2Z59A 2UZRA 1DDMA 2P0HA 3HQCA 4XWXA 5DI9B 1BTKA 4K2PA 4Z2NA 1MKEA 4K81A 2I1JA 1UNPA 2Z0QA 2LG1A 2CY4A 2JP2A 5HE3A 2M14A 1M7EA 1K5GB 4HAWB 2J0JA 4H8SA 4A6HA 2E2XA 3SV1A 4PNKA 4HAYB 2V76A 4GMXB 1MI1A 3HSAA 1V5PA 2EC1A 2D11A 3FEHA 1QC6A 1XODA 2I5CA 4HB4B 4WJ7A 3TW1A 4HAZB 3G9WA 2YS5A 5CLQB 2YS3A 2KIGA 5LONB 2NMBA 3KSYA 3TO1A 2AEHA 4A6KA 2RSGA 2Y8FA 3BJIA 4HATB 3TFMA 5M4YB 1OQNA 4HDOA 2ELAA 3TCAA 3P7ZA 5HE0A 5HE1A 5JHGA 1P3RA 1FHWA 1FAOA 2H7DA 5D3YA 2D9VA 4WSFA 3ZVRA 3AJ4A 3IVFA 3PVUA 4D6WA 1GC6A 3TVVA 1WVHA 4EKUA 5CLLB 1NTYA 2K2UA 4Z2MB 4HB3B 1XX0A 3ODOA 4IAPA 4D0NB 4QJ4B 1X86A 4A6FB 4OT1A 2RVBB 2COCA 4ZRIA 1UPRA 1U29A 4HAXB 2D9ZA 2FJLA 3NSUA 1BTNA 2Q13A 2VKIA 4C0AA 2COFA 1MIXA 3O96A 1V89A 2GUMA 1Q67A 2LULA 3PSCA 4GXBA 2M38A 2D9WA 5IRSA 2DHIA 2P0DA 3LJUX 3D8EA 4MK0A 3MPXA 5D3WA 1H4RA 2YT0A 3U12A 1V5UA 2MWNB 3VOQA 4GPTB 1GC7A 4HB0B 4QJ5B 3WYFB 5C5BA 1U2BA 4GN1A 4HAUB 1SHCA 2Y8GA 2R09A 1TXDA 2CY5A 3D8DA 2GCJA 2UZSA 4OSNA 2MFQA 2DN6A 2K8EA 1P5TA 4Y94A 2CRFA 1WJMA 3NWDA 3AU4A 3D8FA 1Z87A 4PQ0A 2D2QA 2YT1A 4HHVA 2COAA 2DYNA 3QWMA 5C16A 2VSZA 1ZC3B 1J19A 2BCJA 1WGUA 3HIEA 4NSWA 1KZ7A 4CHMA 2Y7BA 2YT2A 4DX90 2RLOA 2ROVA 5JLJB 1V88A 2I1KA 1UNRA 2OQBA 2GJYA 1EGXA 4MY6A 1V5MA 4BBKA 4WVFB 3AU5A 2MDXA 5J3YA 1TJ6A 2YS1A 3SYXA 4A6FA 3GYPA 3OANA 2R2YA 2XQNM 2ZKMX 4YONA 1K5DB 2LYDA 1X05A 5I2MA 1W1DA 1FB8A 2EMTA 4HSIA 2LKOA 1XKEA 1SGHA 3CIKA 4NY0A 3NW8A 4CSQA 3FSSA 1NI2A 4L6EA 5FI0A 1NTVA 1X1FA 3DXCA 3P6AA 3RCPA 5C79A 3A98B 1WJ1A 4IOYX 3PVWA 4CYEA 1MIZB 1KZGA 3GYOA 4KHBB 2R0DA 2KUPA 5LG4B 2DX5A 2NZ8B 1ZC4B 3QIJA 1B55A 2ADZA 4A5KA 1FGZA 2HE7A 2EMSA 3SNHA 2KCJA 4KAXB 1LW3A 4GOUA 1OMWA 4QXAB 1U5FA 3KRXA 3OHMB 2ZPYA 1U5GA 1WGQA 2PZ1A 2Z0PA 2Z13A 1UNQA 2DKQA 2W2WA 1I7AA 4GMVA 4YL8A 5JP4A 2X18A 2D4QA 3PP2A 1X11A 2D10A 2HTHB 3X23A 2KIEA 1WG7A 3NWFA 5D3XA 4GNKB 2DHJA 3NWAA 2YF0A 1P6SA 1XR0B 5L81A 1RRPB
chains in the Genus database with same CATH topology
1V61A 2DFKA 5J3QA 2D9XA 4TYZA 2OTXA 2RGNB 1MK7B 1FOEA 3A8PA 3ZDTA 2Z0OA 3HK0A 4EJNA 3KRWA 1U5EA 1Y19B 1EF1A 3ODXA 1FHXA 4B6HA 2L1CA 1U5DA 2CODA 1QQGA 5KQ1A 5D3VA 2CAYA 1PMSA 2D9YA 2RUKB 1DBHA 5D27A 5DHAB 1BAKA 1LB1A 5DIFB 1MPHA 1X1GA 1NU2A 1UEFA 4P7IA 5LOPB 4MT7A 4K17A 3SUZA 3FM8C 2K00A 1OY2A 2G35A 3F0WA 2N23A 5C6RA 4HAVB 1IRSA 5GOWB 2LOZA 3ULCA 2DYQA 3KZ1A 3ML4A 3PVLA 5HE2A 1J0WA 3V5WA 1FGYA 1BWNA 1FHOA 2W2XD 3PEGA 4ZRJA 5KQ4A 1ZVRA 5FI1A 2YRYA 3SO6A 2DTCA 1GG3A 1AWEA 2QKLA 2DKPA 2UVMA 4HDQA 2W2XC 2K2JA 1XD4A 2DHKA 2L2IA 2DA0A 4KVGB 2DLWA 2I5FA 3F5RA 1AQCA 4EMOA 2DX1A 3KY9A 3VIAA 5C5BB 1DDVA 4KHAA 1KI1B 3U8ZA 5J3TA 3ULBA 2GS0A 5KCVA 1TQZA 1M7RA 4DX8A 1E5WA 4F7UP 4IFSA 2P8VA 3PG7A 2ROZB 2H7EA 4F7HA 3DXEA 2GCLA 5DH9B 1EAZA 3CXBB 3A8QA 4DXAB 2VRWB 5DHFB 4HB2B 1RJ2A 4KHOA 4K2OA 3M1IB 1WI1A 4GZUA 5EFXA 1UPQA 3N7CA 1MAIA 4F7GA 1ZM0A 2N0YA 1I2HA 1ISNA 3U7DA 1EVHA 2J0MA 1N3HA 3QBVB 1PFJA 3T06A 1MK9B 3DXDA 2LOXA 4TKNA 3PZDA 2ELBA 1Y5OA 3BINA 2QKMA 1U27A 1W1HA 2J0KA 1W1GA 2IYBA 1DDWA 1PLSA 2KGXB 2IFSA 5JHHA 3WA0A 1XCGA 3MDBC 2YVCA 2J59M 2RNRB 1H10A 2EJ8A 3UZTA 3ODWA 4CHJA 2MKRA 1DROA 4DBBA 1DYNA 4ZRKA 2YSZA 1ZSQA 2AL6A 3HW2B 2P0FA 2UZRA 1DDMA 2P0HA 3HQCA 4XWXA 5DI9B 1BTKA 4K2PA 4Z2NA 1MKEA 4K81A 2I1JA 1UNPA 2Z0QA 2LG1A 2CY4A 2JP2A 5HE3A 2M14A 1M7EA 1K5GB 4HAWB 2J0JA 4H8SA 4A6HA 2E2XA 3SV1A 4PNKA 4HAYB 2V76A 4GMXB 1V5PA 2EC1A 2D11A 3FEHA 1QC6A 1XODA 2I5CA 4HB4B 4WJ7A 3TW1A 4HAZB 3G9WA 2YS5A 5CLQB 2YS3A 5LONB 2NMBA 3KSYA 3TO1A 2AEHA 4A6KA 2RSGA 2Y8FA 3BJIA 4HATB 3TFMA 1OQNA 4HDOA 2ELAA 3TCAA 3P7ZA 5HE0A 5HE1A 5JHGA 1P3RA 1FHWA 1FAOA 2H7DA 5D3YA 2D9VA 4WSFA 3ZVRA 3AJ4A 3IVFA 3PVUA 1GC6A 3TVVA 1WVHA 4EKUA 5CLLB 1NTYA 2K2UA 4Z2MB 4HB3B 1XX0A 3ODOA 4IAPA 4D0NB 1X86A 4A6FB 4ZRIA 2RVBB 2COCA 1UPRA 1U29A 4HAXB 2D9ZA 2FJLA 3NSUA 1BTNA 2Q13A 2VKIA 4C0AA 2COFA 1MIXA 3O96A 1V89A 1Q67A 2LULA 3PSCA 4GXBA 2M38A 2D9WA 2DHIA 2P0DA 3LJUX 3D8EA 4MK0A 3MPXA 5D3WA 1H4RA 2YT0A 1V5UA 2MWNB 3VOQA 4GPTB 1GC7A 4HB0B 3WYFB 5C5BA 1U2BA 4GN1A 4HAUB 1SHCA 2Y8GA 2R09A 1TXDA 2CY5A 3D8DA 2GCJA 2UZSA 2MFQA 2DN6A 1P5TA 4Y94A 2CRFA 1WJMA 3AU4A 3D8FA 1Z87A 4PQ0A 2D2QA 2YT1A 4HHVA 2COAA 2DYNA 3QWMA 5C16A 2VSZA 1ZC3B 1J19A 2BCJA 1WGUA 4NSWA 1KZ7A 4CHMA 2Y7BA 4DX90 2RLOA 2ROVA 5JLJB 1V88A 2I1KA 1UNRA 2OQBA 2GJYA 1EGXA 4MY6A 1V5MA 4BBKA 4WVFB 3AU5A 2MDXA 5J3YA 1TJ6A 2YS1A 3SYXA 4A6FA 3GYPA 3OANA 2XQNM 4YONA 1K5DB 2LYDA 1X05A 1W1DA 1FB8A 2EMTA 2LKOA 1XKEA 1SGHA 3CIKA 4NY0A 3FSSA 1NI2A 4L6EA 5FI0A 1NTVA 1X1FA 3DXCA 3P6AA 3RCPA 5C79A 3A98B 1WJ1A 4IOYX 3PVWA 4CYEA 1MIZB 1KZGA 3GYOA 4KHBB 2R0DA 2KUPA 2DX5A 2NZ8B 1ZC4B 3QIJA 1B55A 2ADZA 4A5KA 1FGZA 2HE7A 2EMSA 3SNHA 2KCJA 4KAXB 1LW3A 1OMWA 1U5FA 3KRXA 2ZPYA 1U5GA 1WGQA 2PZ1A 2Z0PA 1UNQA 2DKQA 2W2WA 1I7AA 4GMVA 4YL8A 5JP4A 2X18A 2D4QA 3PP2A 1X11A 2D10A 2HTHB 3X23A 1WG7A 5D3XA 2DHJA 2YF0A 1P6SA 1XR0B 5L81A 1RRPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V61 A;  2DFK A;  5J3Q A;  2D9X A;  4TYZ A;  2OTX A;  2RGN B;  1MK7 B;  1FOE A;  3A8P A;  3ZDT A;  2Z0O A;  3HK0 A;  4EJN A;  3KRW A;  1U5E A;  1Y19 B;  1EF1 A;  3ODX A;  1FHX A;  4B6H A;  2L1C A;  1U5D A;  2COD A;  1QQG A;  5KQ1 A;  5D3V A;  2CAY A;  1PMS A;  2D9Y A;  2RUK B;  1DBH A;  5D27 A;  5DHA B;  1BAK A;  1LB1 A;  5DIF B;  1MPH A;  1X1G A;  1NU2 A;  1UEF A;  4P7I A;  5LOP B;  4MT7 A;  4K17 A;  3SUZ A;  3FM8 C;  2K00 A;  1OY2 A;  2G35 A;  3F0W A;  2N23 A;  5C6R A;  4HAV B;  1IRS A;  5GOW B;  2LOZ A;  3ULC A;  2DYQ A;  3KZ1 A;  3ML4 A;  3PVL A;  5HE2 A;  1J0W A;  3V5W A;  1FGY A;  1BWN A;  1FHO A;  2W2X D;  3PEG A;  4ZRJ A;  5KQ4 A;  1ZVR A;  5FI1 A;  2YRY A;  3SO6 A;  2DTC A;  1GG3 A;  1AWE A;  2QKL A;  2DKP A;  2UVM A;  4HDQ A;  2W2X C;  2K2J A;  1XD4 A;  2DHK A;  2L2I A;  2DA0 A;  4KVG B;  2DLW A;  2I5F A;  3F5R A;  1AQC A;  4EMO A;  2DX1 A;  3KY9 A;  3VIA A;  5C5B B;  1DDV A;  4KHA A;  1KI1 B;  3U8Z A;  5J3T A;  3ULB A;  2GS0 A;  5KCV A;  1TQZ A;  1M7R A;  4DX8 A;  1E5W A;  4F7U P;  4IFS A;  2P8V A;  3PG7 A;  2ROZ B;  2H7E A;  4F7H A;  3DXE A;  2GCL A;  5DH9 B;  1EAZ A;  3CXB B;  3A8Q A;  4DXA B;  2VRW B;  5DHF B;  4HB2 B;  1RJ2 A;  4KHO A;  4K2O A;  3M1I B;  1WI1 A;  4GZU A;  5EFX A;  1UPQ A;  3N7C A;  1MAI A;  4F7G A;  1ZM0 A;  2N0Y A;  1I2H A;  1ISN A;  3U7D A;  1EVH A;  2J0M A;  1N3H A;  3QBV B;  1PFJ A;  3T06 A;  1MK9 B;  3DXD A;  2LOX A;  4TKN A;  3PZD A;  2ELB A;  1Y5O A;  3BIN A;  2QKM A;  1U27 A;  1W1H A;  2J0K A;  1W1G A;  2IYB A;  1DDW A;  1PLS A;  2KGX B;  2IFS A;  5JHH A;  3WA0 A;  1XCG A;  3MDB C;  2YVC A;  2J59 M;  2RNR B;  1H10 A;  2EJ8 A;  3UZT A;  3ODW A;  4CHJ A;  2MKR A;  1DRO A;  4DBB A;  1DYN A;  4ZRK A;  2YSZ A;  1ZSQ A;  2AL6 A;  3HW2 B;  2P0F A;  2UZR A;  1DDM A;  2P0H A;  3HQC A;  4XWX A;  5DI9 B;  1BTK A;  4K2P A;  4Z2N A;  1MKE A;  4K81 A;  2I1J A;  1UNP A;  2Z0Q A;  2LG1 A;  2CY4 A;  2JP2 A;  5HE3 A;  2M14 A;  1M7E A;  1K5G B;  4HAW B;  2J0J A;  4H8S A;  4A6H A;  2E2X A;  3SV1 A;  4PNK A;  4HAY B;  2V76 A;  4GMX B;  1V5P A;  2EC1 A;  2D11 A;  3FEH A;  1QC6 A;  1XOD A;  2I5C A;  4HB4 B;  4WJ7 A;  3TW1 A;  4HAZ B;  3G9W A;  2YS5 A;  5CLQ B;  2YS3 A;  5LON B;  2NMB A;  3KSY A;  3TO1 A;  2AEH A;  4A6K A;  2RSG A;  2Y8F A;  3BJI A;  4HAT B;  3TFM A;  1OQN A;  4HDO A;  2ELA A;  3TCA A;  3P7Z A;  5HE0 A;  5HE1 A;  5JHG A;  1P3R A;  1FHW A;  1FAO A;  2H7D A;  5D3Y A;  2D9V A;  4WSF A;  3ZVR A;  3AJ4 A;  3IVF A;  3PVU A;  1GC6 A;  3TVV A;  1WVH A;  4EKU A;  5CLL B;  1NTY A;  2K2U A;  4Z2M B;  4HB3 B;  1XX0 A;  3ODO A;  4IAP A;  4D0N B;  1X86 A;  4A6F B;  4ZRI A;  2RVB B;  2COC A;  1UPR A;  1U29 A;  4HAX B;  2D9Z A;  2FJL A;  3NSU A;  1BTN A;  2Q13 A;  2VKI A;  4C0A A;  2COF A;  1MIX A;  3O96 A;  1V89 A;  1Q67 A;  2LUL A;  3PSC A;  4GXB A;  2M38 A;  2D9W A;  2DHI A;  2P0D A;  3LJU X;  3D8E A;  4MK0 A;  3MPX A;  5D3W A;  1H4R A;  2YT0 A;  1V5U A;  2MWN B;  3VOQ A;  4GPT B;  1GC7 A;  4HB0 B;  3WYF B;  5C5B A;  1U2B A;  4GN1 A;  4HAU B;  1SHC A;  2Y8G A;  2R09 A;  1TXD A;  2CY5 A;  3D8D A;  2GCJ A;  2UZS A;  2MFQ A;  2DN6 A;  1P5T A;  4Y94 A;  2CRF A;  1WJM A;  3AU4 A;  3D8F A;  1Z87 A;  4PQ0 A;  2D2Q A;  2YT1 A;  4HHV A;  2COA A;  2DYN A;  3QWM A;  5C16 A;  2VSZ A;  1ZC3 B;  1J19 A;  2BCJ A;  1WGU A;  4NSW A;  1KZ7 A;  4CHM A;  2Y7B A;  4DX9 0;  2RLO A;  2ROV A;  5JLJ B;  1V88 A;  2I1K A;  1UNR A;  2OQB A;  2GJY A;  1EGX A;  4MY6 A;  1V5M A;  4BBK A;  4WVF B;  3AU5 A;  2MDX A;  5J3Y A;  1TJ6 A;  2YS1 A;  3SYX A;  4A6F A;  3GYP A;  3OAN A;  2XQN M;  4YON A;  1K5D B;  2LYD A;  1X05 A;  1W1D A;  1FB8 A;  2EMT A;  2LKO A;  1XKE A;  1SGH A;  3CIK A;  4NY0 A;  3FSS A;  1NI2 A;  4L6E A;  5FI0 A;  1NTV A;  1X1F A;  3DXC A;  3P6A A;  3RCP A;  5C79 A;  3A98 B;  1WJ1 A;  4IOY X;  3PVW A;  4CYE A;  1MIZ B;  1KZG A;  3GYO A;  4KHB B;  2R0D A;  2KUP A;  2DX5 A;  2NZ8 B;  1ZC4 B;  3QIJ A;  1B55 A;  2ADZ A;  4A5K A;  1FGZ A;  2HE7 A;  2EMS A;  3SNH A;  2KCJ A;  4KAX B;  1LW3 A;  1OMW A;  1U5F A;  3KRX A;  2ZPY A;  1U5G A;  1WGQ A;  2PZ1 A;  2Z0P A;  1UNQ A;  2DKQ A;  2W2W A;  1I7A A;  4GMV A;  4YL8 A;  5JP4 A;  2X18 A;  2D4Q A;  3PP2 A;  1X11 A;  2D10 A;  2HTH B;  3X23 A;  1WG7 A;  5D3X A;  2DHJ A;  2YF0 A;  1P6S A;  1XR0 B;  5L81 A;  1RRP B; 
#chains in the Genus database with same CATH topology
 1V61 A;  2DFK A;  4L1R A;  5J3Q A;  2D9X A;  4TYZ A;  2OTX A;  2RGN B;  1MK7 B;  1FOE A;  2RRF A;  3A8P A;  2Z0O A;  3HK0 A;  3ZDT A;  4EJN A;  3KRW A;  1U5E A;  1Y19 B;  1EF1 A;  3ODX A;  4DIX A;  4QJ3 B;  1FHX A;  4B6H A;  2L1C A;  1U5D A;  2COD A;  1QQG A;  5KQ1 A;  5D3V A;  2CAY A;  1PMS A;  2D9Y A;  2FJU B;  1DBH A;  2RUK B;  5D27 A;  5DHA B;  1BAK A;  2K49 A;  1LB1 A;  5DIF B;  1ZYI A;  1MPH A;  1X1G A;  1NU2 A;  1UEF A;  4P7I A;  5LOP B;  5I2S A;  4MT7 A;  4K17 A;  3SUZ A;  3FM8 C;  2K00 A;  1OY2 A;  3A58 A;  2G35 A;  3F0W A;  2N23 A;  5C6R A;  3FVC A;  4HAV B;  1IRS A;  5GOW B;  2LOZ A;  3ULC A;  2DYQ A;  3KZ1 A;  3ML4 A;  3PVL A;  5HE2 A;  2NBV A;  1J0W A;  3V5W A;  1FGY A;  1BWN A;  1FHO A;  2W2X D;  3PEG A;  4ZRJ A;  5KQ4 A;  1ZVR A;  5FI1 A;  2YRY A;  3SO6 A;  3B77 A;  2DTC A;  1GG3 A;  1AWE A;  2QKL A;  2DKP A;  2UVM A;  4HDQ A;  2W2X C;  2K2J A;  1XD4 A;  2DHK A;  2L2I A;  2DA0 A;  4KVG B;  2DLW A;  2I5F A;  3F5R A;  1AQC A;  4EMO A;  2DX1 A;  3KY9 A;  3VIA A;  5C5B B;  1DDV A;  4KHA A;  1KI1 B;  3U8Z A;  5J3T A;  3ULB A;  2GS0 A;  5KCV A;  1TQZ A;  1M7R A;  4DX8 A;  1E5W A;  4F7U P;  4IFS A;  2P8V A;  3PG7 A;  2ROZ B;  2H7E A;  4F7H A;  3DXE A;  2GCL A;  5DH9 B;  1EAZ A;  3CXB B;  3A8Q A;  4DXA B;  2VRW B;  3DCX A;  5DHF B;  4HB2 B;  1RJ2 A;  4KHO A;  4K2O A;  3M1I B;  1WI1 A;  4GZU A;  5EFX A;  1UPQ A;  3N7C A;  1MAI A;  4F7G A;  1ZM0 A;  2N0Y A;  1I2H A;  1ISN A;  3U7D A;  1EVH A;  2J0M A;  1N3H A;  3QBV B;  1PFJ A;  3T06 A;  1MK9 B;  3DXD A;  2LOX A;  4TKN A;  3PZD A;  2ELB A;  1Y5O A;  3BIN A;  2QKM A;  1U27 A;  1W1H A;  2KR0 A;  2Z4D A;  2KUQ A;  2J0K A;  1W1G A;  2Z14 A;  2IYB A;  1DDW A;  1PLS A;  2KGX B;  2IFS A;  5JHH A;  3WA0 A;  1XCG A;  3MDB C;  2YVC A;  2J59 M;  4KHB A;  2RNR B;  1H10 A;  2EJ8 A;  3UZT A;  3ODW A;  4CHJ A;  2MKR A;  1DRO A;  4DBB A;  1DYN A;  4ZRK A;  1T77 A;  2YSZ A;  1ZSQ A;  2AL6 A;  3HW2 B;  2P0F A;  2Z59 A;  2UZR A;  1DDM A;  2P0H A;  3HQC A;  4XWX A;  5DI9 B;  1BTK A;  4K2P A;  4Z2N A;  1MKE A;  4K81 A;  2I1J A;  1UNP A;  2Z0Q A;  2LG1 A;  2CY4 A;  2JP2 A;  5HE3 A;  2M14 A;  1M7E A;  1K5G B;  4HAW B;  2J0J A;  4H8S A;  4A6H A;  2E2X A;  3SV1 A;  4PNK A;  4HAY B;  2V76 A;  4GMX B;  1MI1 A;  3HSA A;  1V5P A;  2EC1 A;  2D11 A;  3FEH A;  1QC6 A;  1XOD A;  2I5C A;  4HB4 B;  4WJ7 A;  3TW1 A;  4HAZ B;  3G9W A;  2YS5 A;  5CLQ B;  2YS3 A;  2KIG A;  5LON B;  2NMB A;  3KSY A;  3TO1 A;  2AEH A;  4A6K A;  2RSG A;  2Y8F A;  3BJI A;  4HAT B;  3TFM A;  5M4Y B;  1OQN A;  4HDO A;  2ELA A;  3TCA A;  3P7Z A;  5HE0 A;  5HE1 A;  5JHG A;  1P3R A;  1FHW A;  1FAO A;  2H7D A;  5D3Y A;  2D9V A;  4WSF A;  3ZVR A;  3AJ4 A;  3IVF A;  3PVU A;  4D6W A;  1GC6 A;  3TVV A;  1WVH A;  4EKU A;  5CLL B;  1NTY A;  2K2U A;  4Z2M B;  4HB3 B;  1XX0 A;  3ODO A;  4IAP A;  4D0N B;  4QJ4 B;  1X86 A;  4A6F B;  4OT1 A;  2RVB B;  2COC A;  4ZRI A;  1UPR A;  1U29 A;  4HAX B;  2D9Z A;  2FJL A;  3NSU A;  1BTN A;  2Q13 A;  2VKI A;  4C0A A;  2COF A;  1MIX A;  3O96 A;  1V89 A;  2GUM A;  1Q67 A;  2LUL A;  3PSC A;  4GXB A;  2M38 A;  2D9W A;  5IRS A;  2DHI A;  2P0D A;  3LJU X;  3D8E A;  4MK0 A;  3MPX A;  5D3W A;  1H4R A;  2YT0 A;  3U12 A;  1V5U A;  2MWN B;  3VOQ A;  4GPT B;  1GC7 A;  4HB0 B;  4QJ5 B;  3WYF B;  5C5B A;  1U2B A;  4GN1 A;  4HAU B;  1SHC A;  2Y8G A;  2R09 A;  1TXD A;  2CY5 A;  3D8D A;  2GCJ A;  2UZS A;  4OSN A;  2MFQ A;  2DN6 A;  2K8E A;  1P5T A;  4Y94 A;  2CRF A;  1WJM A;  3NWD A;  3AU4 A;  3D8F A;  1Z87 A;  4PQ0 A;  2D2Q A;  2YT1 A;  4HHV A;  2COA A;  2DYN A;  3QWM A;  5C16 A;  2VSZ A;  1ZC3 B;  1J19 A;  2BCJ A;  1WGU A;  3HIE A;  4NSW A;  1KZ7 A;  4CHM A;  2Y7B A;  2YT2 A;  4DX9 0;  2RLO A;  2ROV A;  5JLJ B;  1V88 A;  2I1K A;  1UNR A;  2OQB A;  2GJY A;  1EGX A;  4MY6 A;  1V5M A;  4BBK A;  4WVF B;  3AU5 A;  2MDX A;  5J3Y A;  1TJ6 A;  2YS1 A;  3SYX A;  4A6F A;  3GYP A;  3OAN A;  2R2Y A;  2XQN M;  2ZKM X;  4YON A;  1K5D B;  2LYD A;  1X05 A;  5I2M A;  1W1D A;  1FB8 A;  2EMT A;  4HSI A;  2LKO A;  1XKE A;  1SGH A;  3CIK A;  4NY0 A;  3NW8 A;  4CSQ A;  3FSS A;  1NI2 A;  4L6E A;  5FI0 A;  1NTV A;  1X1F A;  3DXC A;  3P6A A;  3RCP A;  5C79 A;  3A98 B;  1WJ1 A;  4IOY X;  3PVW A;  4CYE A;  1MIZ B;  1KZG A;  3GYO A;  4KHB B;  2R0D A;  2KUP A;  5LG4 B;  2DX5 A;  2NZ8 B;  1ZC4 B;  3QIJ A;  1B55 A;  2ADZ A;  4A5K A;  1FGZ A;  2HE7 A;  2EMS A;  3SNH A;  2KCJ A;  4KAX B;  1LW3 A;  4GOU A;  1OMW A;  4QXA B;  1U5F A;  3KRX A;  3OHM B;  2ZPY A;  1U5G A;  1WGQ A;  2PZ1 A;  2Z0P A;  2Z13 A;  1UNQ A;  2DKQ A;  2W2W A;  1I7A A;  4GMV A;  4YL8 A;  5JP4 A;  2X18 A;  2D4Q A;  3PP2 A;  1X11 A;  2D10 A;  2HTH B;  3X23 A;  2KIE A;  1WG7 A;  3NWF A;  5D3X A;  4GNK B;  2DHJ A;  3NWA A;  2YF0 A;  1P6S A;  1XR0 B;  5L81 A;  1RRP B; 
#chains in the Genus database with same CATH homology
 1V61 A;  2DFK A;  5J3Q A;  2D9X A;  4TYZ A;  2OTX A;  2RGN B;  1MK7 B;  1FOE A;  3A8P A;  3ZDT A;  2Z0O A;  3HK0 A;  4EJN A;  3KRW A;  1U5E A;  1Y19 B;  1EF1 A;  3ODX A;  1FHX A;  4B6H A;  2L1C A;  1U5D A;  2COD A;  1QQG A;  5KQ1 A;  5D3V A;  2CAY A;  1PMS A;  2D9Y A;  2RUK B;  1DBH A;  5D27 A;  5DHA B;  1BAK A;  1LB1 A;  5DIF B;  1MPH A;  1X1G A;  1NU2 A;  1UEF A;  4P7I A;  5LOP B;  4MT7 A;  4K17 A;  3SUZ A;  3FM8 C;  2K00 A;  1OY2 A;  2G35 A;  3F0W A;  2N23 A;  5C6R A;  4HAV B;  1IRS A;  5GOW B;  2LOZ A;  3ULC A;  2DYQ A;  3KZ1 A;  3ML4 A;  3PVL A;  5HE2 A;  1J0W A;  3V5W A;  1FGY A;  1BWN A;  1FHO A;  2W2X D;  3PEG A;  4ZRJ A;  5KQ4 A;  1ZVR A;  5FI1 A;  2YRY A;  3SO6 A;  2DTC A;  1GG3 A;  1AWE A;  2QKL A;  2DKP A;  2UVM A;  4HDQ A;  2W2X C;  2K2J A;  1XD4 A;  2DHK A;  2L2I A;  2DA0 A;  4KVG B;  2DLW A;  2I5F A;  3F5R A;  1AQC A;  4EMO A;  2DX1 A;  3KY9 A;  3VIA A;  5C5B B;  1DDV A;  4KHA A;  1KI1 B;  3U8Z A;  5J3T A;  3ULB A;  2GS0 A;  5KCV A;  1TQZ A;  1M7R A;  4DX8 A;  1E5W A;  4F7U P;  4IFS A;  2P8V A;  3PG7 A;  2ROZ B;  2H7E A;  4F7H A;  3DXE A;  2GCL A;  5DH9 B;  1EAZ A;  3CXB B;  3A8Q A;  4DXA B;  2VRW B;  5DHF B;  4HB2 B;  1RJ2 A;  4KHO A;  4K2O A;  3M1I B;  1WI1 A;  4GZU A;  5EFX A;  1UPQ A;  3N7C A;  1MAI A;  4F7G A;  1ZM0 A;  2N0Y A;  1I2H A;  1ISN A;  3U7D A;  1EVH A;  2J0M A;  1N3H A;  3QBV B;  1PFJ A;  3T06 A;  1MK9 B;  3DXD A;  2LOX A;  4TKN A;  3PZD A;  2ELB A;  1Y5O A;  3BIN A;  2QKM A;  1U27 A;  1W1H A;  2J0K A;  1W1G A;  2IYB A;  1DDW A;  1PLS A;  2KGX B;  2IFS A;  5JHH A;  3WA0 A;  1XCG A;  3MDB C;  2YVC A;  2J59 M;  2RNR B;  1H10 A;  2EJ8 A;  3UZT A;  3ODW A;  4CHJ A;  2MKR A;  1DRO A;  4DBB A;  1DYN A;  4ZRK A;  2YSZ A;  1ZSQ A;  2AL6 A;  3HW2 B;  2P0F A;  2UZR A;  1DDM A;  2P0H A;  3HQC A;  4XWX A;  5DI9 B;  1BTK A;  4K2P A;  4Z2N A;  1MKE A;  4K81 A;  2I1J A;  1UNP A;  2Z0Q A;  2LG1 A;  2CY4 A;  2JP2 A;  5HE3 A;  2M14 A;  1M7E A;  1K5G B;  4HAW B;  2J0J A;  4H8S A;  4A6H A;  2E2X A;  3SV1 A;  4PNK A;  4HAY B;  2V76 A;  4GMX B;  1V5P A;  2EC1 A;  2D11 A;  3FEH A;  1QC6 A;  1XOD A;  2I5C A;  4HB4 B;  4WJ7 A;  3TW1 A;  4HAZ B;  3G9W A;  2YS5 A;  5CLQ B;  2YS3 A;  5LON B;  2NMB A;  3KSY A;  3TO1 A;  2AEH A;  4A6K A;  2RSG A;  2Y8F A;  3BJI A;  4HAT B;  3TFM A;  1OQN A;  4HDO A;  2ELA A;  3TCA A;  3P7Z A;  5HE0 A;  5HE1 A;  5JHG A;  1P3R A;  1FHW A;  1FAO A;  2H7D A;  5D3Y A;  2D9V A;  4WSF A;  3ZVR A;  3AJ4 A;  3IVF A;  3PVU A;  1GC6 A;  3TVV A;  1WVH A;  4EKU A;  5CLL B;  1NTY A;  2K2U A;  4Z2M B;  4HB3 B;  1XX0 A;  3ODO A;  4IAP A;  4D0N B;  1X86 A;  4A6F B;  4ZRI A;  2RVB B;  2COC A;  1UPR A;  1U29 A;  4HAX B;  2D9Z A;  2FJL A;  3NSU A;  1BTN A;  2Q13 A;  2VKI A;  4C0A A;  2COF A;  1MIX A;  3O96 A;  1V89 A;  1Q67 A;  2LUL A;  3PSC A;  4GXB A;  2M38 A;  2D9W A;  2DHI A;  2P0D A;  3LJU X;  3D8E A;  4MK0 A;  3MPX A;  5D3W A;  1H4R A;  2YT0 A;  1V5U A;  2MWN B;  3VOQ A;  4GPT B;  1GC7 A;  4HB0 B;  3WYF B;  5C5B A;  1U2B A;  4GN1 A;  4HAU B;  1SHC A;  2Y8G A;  2R09 A;  1TXD A;  2CY5 A;  3D8D A;  2GCJ A;  2UZS A;  2MFQ A;  2DN6 A;  1P5T A;  4Y94 A;  2CRF A;  1WJM A;  3AU4 A;  3D8F A;  1Z87 A;  4PQ0 A;  2D2Q A;  2YT1 A;  4HHV A;  2COA A;  2DYN A;  3QWM A;  5C16 A;  2VSZ A;  1ZC3 B;  1J19 A;  2BCJ A;  1WGU A;  4NSW A;  1KZ7 A;  4CHM A;  2Y7B A;  4DX9 0;  2RLO A;  2ROV A;  5JLJ B;  1V88 A;  2I1K A;  1UNR A;  2OQB A;  2GJY A;  1EGX A;  4MY6 A;  1V5M A;  4BBK A;  4WVF B;  3AU5 A;  2MDX A;  5J3Y A;  1TJ6 A;  2YS1 A;  3SYX A;  4A6F A;  3GYP A;  3OAN A;  2XQN M;  4YON A;  1K5D B;  2LYD A;  1X05 A;  1W1D A;  1FB8 A;  2EMT A;  2LKO A;  1XKE A;  1SGH A;  3CIK A;  4NY0 A;  3FSS A;  1NI2 A;  4L6E A;  5FI0 A;  1NTV A;  1X1F A;  3DXC A;  3P6A A;  3RCP A;  5C79 A;  3A98 B;  1WJ1 A;  4IOY X;  3PVW A;  4CYE A;  1MIZ B;  1KZG A;  3GYO A;  4KHB B;  2R0D A;  2KUP A;  2DX5 A;  2NZ8 B;  1ZC4 B;  3QIJ A;  1B55 A;  2ADZ A;  4A5K A;  1FGZ A;  2HE7 A;  2EMS A;  3SNH A;  2KCJ A;  4KAX B;  1LW3 A;  1OMW A;  1U5F A;  3KRX A;  2ZPY A;  1U5G A;  1WGQ A;  2PZ1 A;  2Z0P A;  1UNQ A;  2DKQ A;  2W2W A;  1I7A A;  4GMV A;  4YL8 A;  5JP4 A;  2X18 A;  2D4Q A;  3PP2 A;  1X11 A;  2D10 A;  2HTH B;  3X23 A;  1WG7 A;  5D3X A;  2DHJ A;  2YF0 A;  1P6S A;  1XR0 B;  5L81 A;  1RRP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...