2KCKA

Nmr solution structure of the northeast structural genomics consortium (nesg) target mrr121a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
MVDQNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDEYNKDVWAAKADALRYIEGKEVEAEIAEARAKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TPR repeat
publication title Solution NMR structure of the Northeast Structural Genomics Target MrR121A
rcsb
source organism Methanococcus maripaludis
molecule tags Structural genomics, unknown function
total genus 28
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kckA00
4N5CA 2FF4A 2KATA 2PQRA 3AS5A 3VTYA 3LKUA 4JHRA 3O48A 1Y8MA 5HI7A 2IF4A 3CKCA 4A1SA 2LNIA 3CEQA 4HOTA 3QDNA 4EQFA 4XIFA 2XGSA 1WM5A 4WNEA 1KLXA 3FWVA 3LCAA 3QOUA 4AIFA 4JA9A 1W3BA 3UPVA 2UWJG 3U3WA 4GA2A 3MKRA 4F3VA 4HOQA 3CVQA 4CDRA 3S7FA 2BUGA 4GZ5A 5C1DA 2XEVA 4JL0A 4CGVA 4I9EA 3GZ2A 4GYOA 3ULQA 2P58C 4CGWA 3Q47B 1P5QA 2KCLA 2E2EA 4IN3B 3E4BA 2VQ2A 2LSVA 3AS8A 3SF4A 4GCOA 3ZHEB 4YVOA 4GZ3A 3KD7A 3R9AB 4HOSA 4JA7A 3NF1A 5LCWJ 3QKYA 4RG9A 3RKVA 1TJCA 4GA1A 3MV3B 3ASGA 4BTAA 5BT1A 2XGOA 4J8EA 2DBAA 4BT8A 3WXXA 1HH8A 3HYMB 5D0OD 3S7JA 4YVQC 4APOA 4N3CA 2PZIA 4WNFA 2V5FA 3CK8A 4W9RA 5KJKA 4N3AA 3CK7A 4I1AA 3RO3A 1NA3A 1ELWA 4AM9A 4AY6A 3ZHEA 4HOUA 1PC2A 5BW8C 1QZ2A 4U07A 4N2SA 1YA0A 2VSNA 3MV2B 3S7DA 3LYAA 2YQ8A 3VTXA 3CV0A 4BT9A 2AVPA 2LSUA 4N2QA 3RIBA 1HZ4A 5G05C 4KXKB 4UI9J 2NC9A 4UI9K 3Q49B 5FT9A 1IYGA 4Y6WA 4U0ZA 2XPIA 5BNWA 4KBQA 3ZN3A 4U0UA 2PQNA 5KJNA 3LY9A 4H7XA 1HXIA 1QQEA 3CVPA 4N39A 4G2VA 2JLBA 5D0QD 2L6JA 2UY1B 4G25A 3LY7A 4G23A 2WQHA 1ZU2A 5FJYA 2R5SA 3IEGA 5KJMA 2HYZA 4BWRA 2FEZA 3CVNA 2QFCA 2KCKA 5G04J 4RG6A 2GW1A 4KYOB 4AY5A 3GYZA 2VSYA 5JJ7A 3KS2A 2MHKA 3TGOA 3SZ7A 5FZSA 4GYWA 3PE4A 3EDTB 3Q4AB 5ARFA 3RO2A 4GYYA 5EX0A 1WAO1 2HO1A 4GPKA 3Q15A 3S7BA 4UI9C 5CCLA 3K9IA 2UY1A 2ONDA 3PDNA 3CK9A 4ME2A 4BTBA 2Y4TA 3ZFWA 3MEKA 2XCBA 4WUYA 5FZRA 3RJVA 3UUXA 1IHGA 3ASDA 4WNGA 4UQYA 2KCVA 5FZQA 1XNFA 4H7YA 1NA0A 4N3BA 4I2WA 3ESKA 4J8FA 4NQ0A 2C0MA 3PE3A 5M72A 3QWVA 2VGXB 3UQ3A 5DBKA 4G26A 1ZBPA 4GCNA 4NRHB 3ZGQA 3QWPA 5LCWC 4U0SA 4J0UA 4WNDA 2VYIA 4G1TA 1E96B 3ASFA 3ZPJA 5G04C 3LPZA 4GZ6A 5KJLA 3CVLA 3U4TA 5JJ6A 5EKQD 5A6CA 2C0LA 5JJTA 3TG5A 5DIZA 2HR2A 4Y6CA 3OXGA 3CKBA 3OXFA 4HORA 3OXLA 5ARGA 3KAEA 3RU0A 4ABNA 4G24A 4UQXA 1A17A 4U04A 1B89A 5G05J 3ASHA 1OUVA 4GA0A 2FO7A 5CHEE 2Q7FA 2VGXA 5HQ8A 2KC7A 3FP3A 2XCCA 2XGMA 3N71A 2VGYA 1KT1A 4LEUA 4I17A 5CCMA 1KT0A 4UQZA 3GZ1A 4YNDA 2IFUA 4I2ZA 3AS4A 2PL2A 3MA5A 5FTPA 1NZNA 2FI7A 2YHCA 4O6FA 3GW4A 4J8DA 5AYWD 2Y4UA 2I6HA 4B94A 5A7DB 3FFLA 3JYSA 2J9QA 3LY8A 5EX3A 3URZA 1ELRA 1FCHA 3TAXA 3QWWA 3Q5MA 4XI0A 2WPVA 3BEEA 2FBNA 2OOEA 2C2LA 3TG4A 4XI9A 4I9CA
chains in the Genus database with same CATH superfamily
2IO2C 4JHRA 3R7QA 4ACKA 1IQRA 4XEIG 4A1SA 3ABLE 5T3RA 2FO1E 4EQFA 2XGSA 1WM5A 1TNYA 3B7BA 2DYRE 4HRNA 1UW4B 3FWVA 4BX8A 4WWOA 4LSZE 4KZCA 4EZLA 4RQIA 5BPPA 3CVWA 2WM9A 4HRLA 3ISMC 1BLXB 4LERA 1LF8A 5B3SE 3CVQA 4CDRA 3S7FA 2DVWA 1UG3A 3FU0A 4GZ5A 5C1DA 4WWPA 2XEVA 1DVPA 3FUEA 1OWLA 4GYOA 3ULQA 2P58C 3I3NA 4NURA 1HS6A 1NL4A 2KM4A 3SQVA 5IY5E 4RVBA 1P5QA 2J8SD 3BQOA 4P29A 4IN3B 3E4BA 2LSVA 2VSXE 4GCOA 5T4YA 3SNXA 2ZXWE 4YVOA 3KD7A 1E8XA 2QC9A 3LVQE 1U3DA 3RKVA 1ZB1A 3APCA 5B1AE 3HXBA 1IQUA 3EIQC 2OVBA 4JHJA 1OWPA 2XGOA 4U96D 3PZ2A 2KZTB 4EZJA 1HH8A 1Z3XA 1FT1A 3ZNGA 2ETBA 2JEKA 5FQ6A 3AU4A 3S7JA 1OCCE 4YVQC 4UWFA 3LJ3A 1XGWA 2WXMA 5KNGA 2BKGA 4TUMA 3QNKA 4W9RA 3IHVA 1FT2A 3QAQA 3S2AA 3KSQA 2WMNA 3FH8A 1H6OA 4GMRA 3EUVA 2XHEA 4AY6A 1N0RA 3ZHEA 4HI9A 4BETA 3SBTB 3S7DA 5FWQA 3OAWA 3JQ0A 2AVPA 2LSUA 5T8IA 2YNQA 4N2QA 2CG3A 2WXFA 3RIBA 4L2YA 5G55A 4UI9J 2XPZA 2NC9A 3FTYA 1HG2A 2LXLA 3Q49B 5FT9A 2XENA 3HRAA 2XPIA 5BNWA 1EPUA 3T8MA 4MLPA 5CEAA 2ILRA 1S63A 1BU9A 4C48B 5KJNA 3SY2A 1OCOE 4IULA 2XZTG 4H7XA 5CBNA 4GMLA 2IU1A 4N39A 3NZSA 2JLBA 4B8AA 1H2TC 5D0QD 4GMJA 4G25A 1JUQA 5AAOA 1ZU2A 2DWZA 2R5SA 3E34A 3LS8A 3IEGA 5CRVA 4GU5A 5KJMA 2X6KA 4OAVB 1QBQA 3UXGA 2QFCA 4WAFA 4EBAA 4AXHA 3PUJA 1WG0A 2KCKA 1FVHA 4I6EA 4KYOB 4PS7A 4JEUA 4R7LA 5EYLA 2VSYA 5JJ7A 3TWRA 3G2UA 3SZ7A 5FZSA 2CHZA 4ZHBA 3Q4AB 2Y1LE 3ZKJA 3RO2A 2XRZA 2HO1A 2DZNA 4GPKA 1DC2A 1E8YA 1PAQA 5A23A 3Q15A 4IYPA 5ENPD 2WXLA 4JHKA 1HFAA 3L08A 3BG1B 4G11A 3CK9A 3CR3A 3DWLG 3FUJA 4EPZA 3MKQA 4UWKA 3DSVA 4HS2A 4A3TA 4MKTA 2Y4TA 3ZFWA 4OAUC 5KBAA 3MEKA 5BXUA 5FZRA 5G2NA 3RJVA 1IHGA 4WNGA 3UKRG 1N4PA 2IOSA 2KCVA 3G2VA 1G3NB 5ANLA 1JPLA 1NA0A 4N3BA 3X2QE 3ESKA 2C0MA 3MJWA 3RSEG 2HM8A 3FH7A 2ETCA 4FHJA 2VGXB 3R9MA 5DBKA 4L7TA 4G26A 3HVEB 5EIBE 4ILHB 4ILGA 3ULYA 4WNDA 3ML9A 3ZPJA 5G04C 5KJLA 3CVLA 2VTBB 4XX5A 3HG0D 3LDZA 5AQ9A 5A6CA 5JJTA 2V5QC 2P9LG 3SD5A 1LTXA 2EILE 4K03A 3FDHA 3B13A 3I4GA 3OXGA 2WXOA 3OXFA 3OXLA 3KAEA 1JCQA 3PVLA 3CSFA 1E8ZA 4Z68A 5BV1A 2L0TB 5G05J 3DEPA 3I5PA 4GA0A 4K5AB 5AQ7A 4LUNU 3IKOB 3FP3A 3UTMA 2WXIA 3TWTA 4LEUA 3HXEA 3DSSA 2B6CA 3CQCB 3CHQA 3AS4A 3L17A 1HF8A 1SZ9A 3E33A 4BY6A 4PH4B 3T8KA 1NZNA 3RRNB 1Z3YA 4TXPA 1KZPA 2YHCA 2EIKE 2L9BA 4O6FA 5C2YA 3DSUA 4PDXA 1BI7B 4XKCA 3ZXSA 4TXRA 2E0IA 1N4SA 5ENTD 3EIJA 3LY8A 4L9PA 3L22A 1ELRA 4JPSA 3CQGB 2CHWA 1V55E 4DI3A 3FTXA 4XI0A 4DK5A 3QC1A 2OOEA 4CYMD 1TN8A 4IRUA 4I9CA 3B7UX 2F8XK 2EQXA 4AP2A 2FF4A 4JXTA 4GTMA 3FUNA 4B8CB 2IF4A 5EYPF 3UI2A 3CEQA 3DPDA 4HOTA 2RFMA 4DUIA 4OVUA 4WNEA 3TWWA 4A3VA 1KLXA 2A5EA 4B93B 5JA4D 3QOUA 3QK0A 1W3BA 2UWJG 3U3WA 2AWIA 3MKRA 3I4RB 3DSWA 2I2OA 1MX6A 3HXCA 2WXNA 1IHBA 5JHBA 3MZLB 3L6AA 2R59A 4DLQA 1MHQA 1BD8A 1SQMA 2A5UA 4CGWA 3UT7A 3NOCD 2ZGGA 2KCLA 1H0AA 2E2EA 3UT4A 4BESA 2OV8A 1YCSB 3B7SA 1Z5SC 3SF4A 2BEDA 3ENEA 4F7AA 4E6HA 4JA7A 4A63B 3NF1A 3ZUVB 3V79K 4EZKA 3KEAA 4A1GA 5KCMA 1MZCA 4ANXA 2NYJA 2YHEA 1YYHA 3EHNA 5LFAA 4GA1A 1OT8A 2R05A 3ASGA 2EINE 5BT1A 4J8EA 2DBAA 3FTWA 3HYMB 3E32A 2OCCE 3FU6A 5D0OD 4APOA 3UMVA 4TV3A 4FHKA 3CK8A 3JUEA 1TN7A 2PM6A 3UM3A 4FLBA 4I1AA 3RO3A 1NA3A 1ELWA 4F1PA 3PUKA 5FINA 4DX1A 1K1BA 5AJDA 4HLEA 5CMYA 5HRYA 2L6BA 4U95D 5BW8C 3ZXPA 4URKA 2WXJA 4N2SA 2VSNA 3LYAA 3EU5A 3VTXA 3HDXA 3DXKG 3AG1E 4BT9A 2QYUA 4QQIA 3V2XA 2V4HC 4DX2A 3FHEA 3ASNE 1IYGA 3AAAC 4HFGA 2R02A 2CG2A 4JD2G 4U0ZA 2QYJA 1H6PA 4ANWA 4KBQA 3ZN3A 4FU3A 5ITZF 3R7RA 4KMOA 2PQNA 2Y0BG 3G2SA 5KWDA 3LY9A 3G2WA 4LG6A 1HXIA 3DRAA 1OXJA 3CVPA 5AQAA 2IONA 1FVFA 4DLOA 1D9SA 4E85A 3FTSA 5CECB 4HQDA 1Y6IA 3T5VA 2ZGDA 5BXOA 2P9IG 1TJFA 4K0RA 3IHYA 3Q9NC 3CHMA 3CVNA 5HKPA 2I1KA 1N11A 4G8LA 4HRMB 4AEZC 3UM1A 2VJ8A 1TEZA 2WMOA 1JWFA 5B1BE 4I1MA 1K8KG 5CBOA 4UWGA 4FP7A 5HS0A 2AXUA 4ZFHA 4GZDA 3TGOA 3CLJA 1OCRE 3ML8A 3L9TA 3EDTB 1HO8A 1E7UA 5EX0A 3PNLB 3FEXA 1IKND 3CHPA 4UI9C 5CCLA 1E7VA 2AXZA 3D9HA 2UY1A 3SO8A 2R03A 4UUCA 4BTBA 1KZOA 3QARA 3JQ1A 5D66A 1O1SA 1LD8A 4M7CA 4MRUA 4LNBA 4WUYA 3FU5A 5ENSD 4UQYA 1AP7A 4TRQA 1WDYA 4I2WA 3FULA 4NQ0A 3PE3A 3PZ3A 4CEMA 3IXEA 4NRHB 3ZGQA 4A55A 2EIJE 5LCWC 3SHFA 4J0UA 1AWCB 2XS8A 3PH0C 3IV0A 3U4TA 4MS6A 3RRUA 1MX2A 5JJ6A 2XEHA 4B0ZA 2ZU6B 2B0OE 2C0LA 3ONLA 3TG5A 3G2TA 3ZVVA 2FULA 4FJZA 2HR2A 4HB5A 3CKBA 2X6JA 3RU0A 2AW6A 4GTSA 1S64A 1V54E 2RFAA 4U04A 3FTZA 4V3IA 4KZ0A 4FULA 3ASHA 5CHEE 2Q7FA 3MX3A 1UOHA 5CRUA 2F37A 3CVXA 4LNUD 4I17A 2IJGX 4UQZA 3D9PA 2PL2A 2IEJA 2WXRA 4GTQA 4J8YA 3TWUA 3PREA 1N54A 2FI7A 2V8SE 2IQCA 1EF1C 1DNPA 4J8DA 5AYWD 4O1OA 2I6HA 1TNZA 4FA6A 2F0YA 5BUZA 2QY7A 1MYOA 2J9QA 1N52A 4C9BB 1H2VC 2XEEA 3QWWA 3Q5MA 2DZOA 4ANUA 4XI9A 2LO6A 3C5RA 2KATA 2PQRA 3AS5A 3VTYA 1Y8MA 2WQ7A 4LCTA 3ESLA 3FU3A 1PY1A 3SFXA 4XIFA 1RW2A 3D9JA 3EHQA 3CHOA 2F8YA 2I1JA 4L23A 3LCAA 3W9FA 4AIFA 4JA9A 2OEVA 3FUMA 1YMPA 3D9NA 4HNAD 4JW1A 4F3VA 1DCQA 4DRXE 1ELKA 2RKKA 3VLEA 4JC8A 2BUGA 2IO3C 2R2LA 1NI1A 1TR4A 5BV0A 3PRZA 4NIKA 2L0IA 4M3OA 3JCKC 3RK6A 3D9OA 2KXPC 1EYHA 3Q75A 3SFYA 3AS8A 5ANRA 3SGHA 3ZHEB 3NAWA 1HE8A 4I6GA 4HOSA 4HBDA 1UJJA 1U3CA 3QKYA 5JHAA 3C98A 4JB8P 3ZRHA 3CGHA 4RG9A 3EJNA 1TJCA 3MV3B 4YDOA 4AVXA 4CZ2D 3IBEA 3TXMA 3E30A 3D9LA 4N3CA 1H2UA 2PZIA 2H6HA 4FJYA 3J5PA 3W9GA 1N4RA 4N3AA 5KJKA 4LNGA 3CK7A 1U2VG 4AM9A 1HX8A 2GRQB 1TN6A 1PC2A 3OTNA 1SA4A 4YDEA 4ATZD 2H6FA 1JWGA 4FLHA 1HZ4A 4X8QA 4KXKB 4KVOA 4K5CA 3PEVB 1O5MA 4U8VD 4UI9K 4KT6B 4EECA 2J07A 2KZTA 3ZYLA 3GZSA 1A5EA 2EIME 4U0UA 3NQPA 2P9NG 5CMWA 4RLYA 3Q73A 1QQEA 1HG5A 1RZ4A 2R17C 4G2VA 2WXQA 5FQ7A 2NXPA 3MKQB 4G23A 3C3QA 1OCZE 5FJYA 4F6RD 2GRRB 1TNBA 5ENNA 2XPYA 3KSLA 4RG6A 3EHRA 3RRMB 4AY5A 3GYZA 3HXDA 3O4ZA 3TWSA 3KS2A 4APFA 3RAUA 3UX4A 4O1PA 3PE4A 1Z6TA 5LP0A 1D8DA 4I43A 4DX6D 5ARFA 4U8YD 4GYYA 1WAO1 3S7BA 2X6IA 4FADA 3K9IA 2XS1A 4J8SA 3C3RA 3PDNA 3HIZA 1UJKA 2CFZA 2ZISA 5AQBA 1MX4A 2I9CA 4GZCA 2XCBA 3L54A 3ASDA 1XNFA 3Q7AA 2WXGA 3FY4A 2Y69E 4J8FA 5FQ4A 1O1RA 5M72A 3QWVA 3CIAA 2GRMA 1L5JA 3BU8A 5AJLA 3L82A 1ZBPA 5H7PA 3QWPA 4Q94A 1E96B 4LRZA 2OVFA 3ASOE 3JXJA 1NP7A 2ETAA 1SVXA 1S0PA 5EKQD 4EBAG 2P9PG 3KEZA 5AN8A 5DIZA 2XRYA 4Y6CA 3DEOA 1UN9A 3B7RL 4Q69A 3PZ1A 2VGEA 1TNOA 1Q2ZA 4EHMA 3ULEG 2GRLA 5ARGA 4HVBA 4ABNA 4UQXA 3TWVA 1H19A 1EDUA 2J4DA 4GTVA 3MGBA 1B89A 3UIPC 3P1UA 1OUVA 4BSXA 2VGXA 5HQ8A 2KC7A 2J49A 2XCCA 2A4ZA 2XGMA 4L2LA 2P9KG 4F1SA 3PZ4A 4C0MA 2KBXA 3FTVA 3HVEA 4TXQA 5CCMA 3TWXA 4BEPA 4I6JA 3Q9UC 4YNDA 3V2OA 3Q7FA 2IFUA 4I2ZA 4BERA 3NB2A 2VTBA 2PNNA 1X5BA 4KVMA 4OVVA 1QYMA 3ABME 3UM0A 2V4LA 2X3MA 3FH5A 3GW4A 3D9KA 4GTTA 3ZIMA 1IXVA 4GTOA 1N0QA 3FUDA 1FPPA 2P2CP 4OYSA 3TJPA 1FCHA 3TAXA 3UM2A 2MYOA 3ZU7B 4DX5D 3BEEA 2X6HA 2C2LA 3TG4A 4CT0A 5AARA 4C0EA 2LAIA 3B7TA 2CFUA 1TYQG 1UN8A 4U63A 4N5CA 4J6IA 3AG2E 3LKUA 3O48A 5HI7A 3CKCA 3D3MA 2LNIA 3DSXA 3FUKA 5EILA 4RSYA 4PS3A 3ONKA 3QDNA 2H6IA 1S70B 2GRPB 1HU3A 3FEYA 4HLLA 3UKUG 1SA5A 3TL5A 3C72A 1SZAA 5AENA 2ZIRA 3UPVA 4GA2A 5E75A 2JABA 4CT4A 3MCXA 4ACLA 4HOQA 4O60A 1N4QA 1JCRA 3LEWA 4YDYA 5EIDA 3C3OA 5KNHD 4HXIA 3T5XA 4YDWA 2MOWA 2WXHA 4GTRA 1TNUA 3CSTA 4JL0A 4CGVA 4I9EA 3GZ2A 1E90A 4XE0A 3HHMA 3Q47B 1N95A 2VQ2A 4GTPA 3EU9A 4UWLA 3NZUA 1N9AA 4GZ3A 3R9AB 3UT8A 3U9WA 5LCWJ 4XZ4A 2DIWA 3J5QB 5LOZA 3EHMA 4JVSA 2X6FA 5JMND 2V0PA 3UIOC 1WY6A 3ZYMA 4BTAA 3MYVA 2RD0A 2XQ0A 4BT8A 3WXXA 5E76A 2WQ6A 2CHXA 3DXMG 3CVVA 3UINC 3FUIA 3DPYA 4FC8A 3TXNA 1OWMA 2BF0X 2NSZA 4WNFA 2V5FA 4L1BA 4NACA 4XKBA 2DYSE 4ILIA 3LXUX 4GAAA 3L13A 1K1AA 3SI5A 2P9UG 2XZDG 4HOUA 3JUIA 2MRIA 1QZ2A 4U07A 4D10C 1YA0A 3PEUB 3MV2B 4BSZB 2YQ8A 4K5BA 1KPSB 3CV0A 4N5QA 3JXIA 4U8HA 5G05C 5ENOD 1BI8B 3U64A 4Y6WA 3CHSA 3FTUA 1GW6A 2HE0A 2M63A 4UWHA 1X81A 5FIOA 1LD7A 5EN5D 3V31A 3VLFA 3SBSA 2RG8A 4DI4A 4I1OB 4Q96A 4AV7A 2L6JA 2UY1B 3LY7A 3PNTB 2QZAA 5ENQD 2DCPA 2WQHA 3APDA 2HYZA 2IY0C 4BWRA 2FEZA 3U66A 3AG4E 4JEHA 1OWNA 3B95A 2WVIA 1QNFA 2J4BA 4U7EB 5G04J 2GW1A 2X38A 4PUCA 3LVRE 2MHKA 5EDSA 4GYWA 4ANVA 4MBGA 1MQSA 3AJIA 2J08A 3AU5A 4CRWA 1E8WA 5D2MC 5CERB 2ONDA 2OEWA 4ME2A 3PZDA 2GROB 1K3ZD 4AOFA 3VLDA 5LX8A 3Q79A 3UUXA 4TUUA 3DBSA 3BUAA 2LUHA 2AXVA 5FZQA 4H7YA 4JZYA 3CVUA 1INZA 1OY3D 2BKKB 3E37A 1OWOA 4WWNA 2GGFA 3UQ3A 3ZW3A 5FQ8A 4GCNA 4GB9A 3PS6A 4U0SA 3ZEFA 2VYIA 4G1TA 2J09A 3ASFA 3LPZA 1BPOA 4GZ6A 3SFZA 3F6QA 4HI8A 2IOLA 3FUFA 4CDMA 5CEDB 2Y3AA 3HXFA 1D8EA 4B89A 4AJWA 1H6KA 3ZYQA 3T9KA 4HORA 4GPMA 1DCEA 3TWQA 1VDYA 4G24A 4J7WA 3QJZA 3Q78A 3NBNB 1A17A 4F53A 1MJ0A 2FO7A 3ABKE 4CCAA 3N71A 2VGYA 2WXPA 3DSTA 1KT1A 2GRNB 3FUHA 2H6GA 3BG0B 4CDNA 1KT0A 2WXKA 3L16A 5AIJA 3GZ1A 4DJAA 4BX9A 3APFA 4DX7D 3MA5A 2P9SG 3CHRA 3QB2A 3AG3E 5FTPA 4PS8A 2BTDA 3WG7E 2VSOE 1N94A 1O1TA 4DPRA 3V30A 2Y4UA 3LJNA 4B94A 4G8KA 2AJAA 3NOGD 4ATGA 5ENRD 5A7DB 3D9IA 3FFLA 3ZYKA 3JYSA 2WB2A 5EX3A 3URZA 2LAHA 4QFVA 5J90A 2PM7A 1JCSA 5J08A 1SW6A 2WPVA 4BFRA 2FBNA 1NFIE 2LXMA 2YINA 3CVYA 3D9MA 3P2BA
chains in the Genus database with same CATH topology
2LO6A 4N5CA 4J6IA 4AP2A 2FF4A 2KATA 2PQRA 3AS5A 4JXTA 3VTYA 3LKUA 4JHRA 3FUNA 1Y8MA 3O48A 3R7QA 4ACKA 5HI7A 1IQRA 4B8CB 2IF4A 3CKCA 3D3MA 4A1SA 2LNIA 3FUKA 2WQ7A 4LCTA 4RSYA 4PS3A 3CEQA 3DPDA 3ESLA 3FU3A 4HOTA 5T3RA 1PY1A 3ONKA 3QDNA 4EQFA 4XIFA 3D9JA 2XGSA 1WM5A 4OVUA 3CHOA 4WNEA 2I1JA 4L23A 4A3VA 1KLXA 1UW4B 3FWVA 3LCAA 4BX8A 1HU3A 3FEYA 3QOUA 3QK0A 4WWOA 4AIFA 4JA9A 4KZCA 4EZLA 3CVWA 5BPPA 3TL5A 1W3BA 3FUMA 1SZAA 5AENA 2WM9A 3UPVA 3D9NA 2UWJG 4JW1A 3U3WA 2AWIA 4GA2A 3MKRA 5E75A 4LERA 4F3VA 3I4RB 4CT4A 3MCXA 4ACLA 1ELKA 1LF8A 4HOQA 2I2OA 3CVQA 4CDRA 3LEWA 3S7FA 3VLEA 1UG3A 4JC8A 2BUGA 3FU0A 2WXNA 4GZ5A 4HXIA 4WWPA 2XEVA 3T5XA 2MOWA 5C1DA 1DVPA 2WXHA 5JHBA 3MZLB 3CSTA 3L6AA 4JL0A 5BV0A 2R59A 3PRZA 1MHQA 3FUEA 4DLQA 2L0IA 4CGVA 4I9EA 4M3OA 3GZ2A 1OWLA 3JCKC 4GYOA 3ULQA 1E90A 2P58C 3I3NA 4NURA 1SQMA 2A5UA 3HHMA 4XE0A 1HS6A 3Q47B 3RK6A 3UT7A 4CGWA 2KM4A 4RVBA 3D9OA 1P5QA 2KCLA 1H0AA 2E2EA 4P29A 3UT4A 1EYHA 4IN3B 3E4BA 2VQ2A 2OV8A 2LSVA 4UWLA 3AS8A 3B7SA 3NZUA 5ANRA 2VSXE 3SF4A 3SGHA 4GCOA 5T4YA 3SNXA 3ZHEB 3ENEA 4YVOA 4GZ3A 1HE8A 3KD7A 4I6GA 4F7AA 3R9AB 3UT8A 4E6HA 4HOSA 4JA7A 3U9WA 3NF1A 5LCWJ 4XZ4A 1UJJA 1U3CA 2DIWA 3QKYA 4EZKA 5JHAA 3C98A 1E8XA 5LOZA 3ZRHA 3EHMA 3CGHA 2X6FA 3LVQE 2V0PA 1U3DA 4JVSA 4RG9A 5KCMA 4A1GA 4ANXA 1WY6A 3RKVA 2YHEA 3EJNA 1TJCA 3APCA 3EHNA 5LFAA 4GA1A 3ZYMA 1IQUA 3MV3B 3ASGA 4BTAA 3EIQC 2OVBA 3MYVA 2RD0A 5BT1A 2XQ0A 1OWPA 4JHJA 2XGOA 4J8EA 4AVXA 2DBAA 2KZTB 4BT8A 3FTWA 3WXXA 1HH8A 4EZJA 5E76A 2WQ6A 3HYMB 2CHXA 1Z3XA 3IBEA 3CVVA 3TXMA 3FU6A 2JEKA 5FQ6A 5D0OD 3AU4A 3FUIA 4YVQC 3S7JA 4UWFA 4APOA 4FC8A 3LJ3A 3D9LA 1XGWA 4N3CA 1H2UA 2PZIA 2WXMA 3UMVA 3TXNA 4TV3A 1OWMA 2BF0X 3QNKA 2NSZA 4WNFA 4FJYA 4FHKA 2V5FA 3CK8A 4L1BA 4W9RA 3IHVA 5KJKA 2PM6A 4N3AA 4NACA 4FLBA 3CK7A 4XKBA 4I1AA 3RO3A 1NA3A 3QAQA 3S2AA 4ILIA 1ELWA 3LXUX 4AM9A 2WMNA 3PUKA 1HX8A 3FH8A 4GAAA 3L13A 2XHEA 4AY6A 5AJDA 4HLEA 5CMYA 3SI5A 3ZHEA 4HOUA 1PC2A 3JUIA 5BW8C 2MRIA 4URKA 1QZ2A 4U07A 2WXJA 3OTNA 4D10C 4N2SA 1YA0A 2VSNA 3MV2B 3PEUB 3S7DA 5FWQA 3SBTB 3LYAA 2YQ8A 3VTXA 3HDXA 3OAWA 3JQ0A 3CV0A 4BT9A 2AVPA 2LSUA 5T8IA 1JWGA 2YNQA 4N2QA 2CG3A 2WXFA 4FLHA 1HZ4A 4L2YA 3RIBA 5G05C 4KXKB 4U8HA 4UI9J 5G55A 4KVOA 3PEVB 2XPZA 2NC9A 4UI9K 3FTYA 1HG2A 4KT6B 4EECA 2J07A 2KZTA 3Q49B 3FHEA 5FT9A 3GZSA 3U64A 4HFGA 3ZYLA 1IYGA 4Y6WA 3CHSA 2CG2A 1GW6A 2XPIA 3FTUA 2M63A 4U0ZA 5BNWA 4ANWA 4KBQA 1EPUA 3ZN3A 4UWHA 3T8MA 4FU3A 4MLPA 4U0UA 3NQPA 3R7RA 4KMOA 2ILRA 2PQNA 3G2SA 5KJNA 3LY9A 3G2WA 3VLFA 5CMWA 4IULA 3SBSA 2RG8A 4H7XA 1HXIA 1QQEA 4GMLA 2IU1A 3CVPA 4DI4A 1HG5A 2IONA 4I1OB 2R17C 3NZSA 2JLBA 1FVFA 4G2VA 4N39A 4Q96A 1H2TC 5D0QD 4B8AA 2L6JA 4AV7A 2WXQA 2UY1B 4GMJA 4G25A 3LY7A 1JUQA 3PNTB 5FQ7A 2NXPA 2DCPA 3MKQB 4G23A 4DLOA 2WQHA 1ZU2A 5FJYA 4E85A 3FTSA 2R5SA 3APDA 3LS8A 3IEGA 1Y6IA 4GU5A 3T5VA 5KJMA 2X6KA 1TJFA 4K0RA 2HYZA 3IHYA 3CHMA 4BWRA 2FEZA 3CVNA 2QFCA 2I1KA 4WAFA 3U66A 4JEHA 1OWNA 4EBAA 2WVIA 4AXHA 5ENNA 3PUJA 4AEZC 2XPYA 1QNFA 2KCKA 2J4BA 2VJ8A 1TEZA 2WMOA 1JWFA 5G04J 4I1MA 1FVHA 4RG6A 4UWGA 4FP7A 2GW1A 4I6EA 2AXUA 3RRMB 4KYOB 4PS7A 4JEUA 2X38A 4R7LA 3GYZA 4AY5A 3O4ZA 4PUCA 2VSYA 5JJ7A 3LVRE 3KS2A 4GZDA 2MHKA 3TGOA 4APFA 3G2UA 3SZ7A 5FZSA 4GYWA 5EDSA 2CHZA 3UX4A 3CLJA 3ML8A 3PE4A 1Z6TA 5LP0A 3EDTB 4I43A 4ANVA 1HO8A 3Q4AB 5ARFA 3RO2A 2XRZA 1E7UA 4GYYA 5EX0A 1MQSA 3PNLB 3FEXA 1WAO1 2HO1A 2J08A 4GPKA 3AU5A 1E8YA 1PAQA 5A23A 3Q15A 4IYPA 3S7BA 4CRWA 2WXLA 1E8WA 3CHPA 4UI9C 5CCLA 2X6IA 4FADA 1E7VA 3K9IA 1HFAA 4JHKA 2AXZA 3BG1B 3L08A 4J8SA 2UY1A 4G11A 2ONDA 3PDNA 3CK9A 3HIZA 3CR3A 1UJKA 2CFZA 4ME2A 3FUJA 3PZDA 3MKQA 4EPZA 4UWKA 4HS2A 4BTBA 4A3TA 4MKTA 3QARA 3JQ1A 2Y4TA 2I9CA 3ZFWA 3VLDA 4AOFA 4GZCA 5LX8A 3MEKA 2XCBA 4MRUA 4WUYA 5FZRA 5G2NA 3FU5A 3L54A 3RJVA 1IHGA 3ASDA 4TUUA 4WNGA 3UUXA 4UQYA 3DBSA 2IOSA 3G2VA 2KCVA 5ANLA 2AXVA 4TRQA 5FZQA 1XNFA 4H7YA 2WXGA 1JPLA 1NA0A 4JZYA 3FY4A 4N3BA 3CVUA 4I2WA 3ESKA 3FULA 4J8FA 4NQ0A 2C0MA 3PE3A 5FQ4A 1INZA 3MJWA 5M72A 1OWOA 2HM8A 3QWVA 3FH7A 4WWNA 3CIAA 4FHJA 2GRMA 4CEMA 2GGFA 2VGXB 3UQ3A 5DBKA 4L7TA 1L5JA 4G26A 5AJLA 1ZBPA 5FQ8A 3ZW3A 4GCNA 3HVEB 4NRHB 3ZGQA 4C9BB 3QWPA 4GB9A 4A55A 5LCWC 4Q94A 3PS6A 4ILHB 4ILGA 4J0UA 4U0SA 3SHFA 3ZEFA 4WNDA 2VYIA 3ML9A 4G1TA 1E96B 2J09A 3ASFA 4LRZA 3ZPJA 5G04C 2OVFA 3LPZA 1BPOA 3PH0C 4GZ6A 3CVLA 3SFZA 5KJLA 2VTBB 3IV0A 3U4TA 4MS6A 1NP7A 3RRUA 2IOLA 4XX5A 3FUFA 4CDMA 5JJ6A 4B0ZA 2ZU6B 2Y3AA 5EKQD 1S0PA 3LDZA 4EBAG 4B89A 5A6CA 2C0LA 3ONLA 4AJWA 5JJTA 3TG5A 3KEZA 3G2TA 3ZVVA 3SD5A 1H6KA 3ZYQA 2FULA 5DIZA 4FJZA 2HR2A 2XRYA 4Y6CA 4K03A 3FDHA 1UN9A 3B7RL 4Q69A 3B13A 3I4GA 3OXGA 2WXOA 3CKBA 3OXFA 4HORA 2GRLA 3OXLA 5ARGA 1VDYA 4HVBA 2X6JA 3KAEA 3RU0A 4ABNA 4G24A 3PVLA 2AW6A 3QJZA 3CSFA 4UQXA 1H19A 1EDUA 2J4DA 1E8ZA 1A17A 4U04A 3FTZA 3MGBA 5BV1A 1B89A 4V3IA 4KZ0A 4FULA 4F53A 3P1UA 2L0TB 5G05J 3ASHA 1OUVA 3I5PA 4GA0A 2FO7A 5CHEE 4BSXA 2Q7FA 2VGXA 3IKOB 4LUNU 5HQ8A 2KC7A 2J49A 3FP3A 4CCAA 2XCCA 2A4ZA 2WXIA 2XGMA 2VGYA 2WXPA 3N71A 4L2LA 1KT1A 3MX3A 3FUHA 4LEUA 4F1SA 4C0MA 3CVXA 3BG0B 3FTVA 3HVEA 4I17A 4CDNA 5CCMA 1KT0A 2WXKA 2IJGX 3L16A 4UQZA 3D9PA 5AIJA 3GZ1A 4I6JA 3CQCB 4DJAA 4BX9A 3APFA 4YNDA 3CHQA 2IFUA 4I2ZA 3AS4A 2PL2A 3L17A 1HF8A 3MA5A 2VTBA 3CHRA 1SZ9A 3QB2A 2WXRA 5FTPA 4BY6A 4PH4B 4PS8A 2BTDA 3PREA 1NZNA 1N54A 1X5BA 1Z3YA 2FI7A 3RRNB 2YHCA 4KVMA 2L9BA 2V8SE 4OVVA 4O6FA 2IQCA 5C2YA 2V4LA 2X3MA 3FH5A 1EF1C 3GW4A 2VSOE 3D9KA 4PDXA 3ZIMA 1DNPA 4J8DA 4DPRA 5AYWD 2Y4UA 4XKCA 2I6HA 3ZXSA 4B94A 2E0IA 4FA6A 4ATGA 3FUDA 5A7DB 5BUZA 3D9IA 2QY7A 3EIJA 3FFLA 3ZYKA 3JYSA 2WB2A 2J9QA 3LY8A 3L22A 5EX3A 4OYSA 3URZA 2LAHA 1N52A 1ELRA 4JPSA 3CQGB 1H2VC 2CHWA 1FCHA 2PM7A 4QFVA 3TJPA 3TAXA 5J90A 4DI3A 5J08A 3QWWA 3FTXA 3Q5MA 4XI0A 2WPVA 4DK5A 3QC1A 4ANUA 3BEEA 4BFRA 2FBNA 2X6HA 2OOEA 2C2LA 3TG4A 4IRUA 2YINA 4CT0A 4XI9A 4C0EA 2LAIA 3CVYA 4I9CA 3B7UX 3B7TA 3D9MA 2EQXA 3P2BA 2CFUA 1UN8A 4U63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N5C A;  2FF4 A;  2KAT A;  2PQR A;  3AS5 A;  3VTY A;  3LKU A;  4JHR A;  3O48 A;  1Y8M A;  5HI7 A;  2IF4 A;  3CKC A;  4A1S A;  2LNI A;  3CEQ A;  4HOT A;  3QDN A;  4EQF A;  4XIF A;  2XGS A;  1WM5 A;  4WNE A;  1KLX A;  3FWV A;  3LCA A;  3QOU A;  4AIF A;  4JA9 A;  1W3B A;  3UPV A;  2UWJ G;  3U3W A;  4GA2 A;  3MKR A;  4F3V A;  4HOQ A;  3CVQ A;  4CDR A;  3S7F A;  2BUG A;  4GZ5 A;  5C1D A;  2XEV A;  4JL0 A;  4CGV A;  4I9E A;  3GZ2 A;  4GYO A;  3ULQ A;  2P58 C;  4CGW A;  3Q47 B;  1P5Q A;  2KCL A;  2E2E A;  4IN3 B;  3E4B A;  2VQ2 A;  2LSV A;  3AS8 A;  3SF4 A;  4GCO A;  3ZHE B;  4YVO A;  4GZ3 A;  3KD7 A;  3R9A B;  4HOS A;  4JA7 A;  3NF1 A;  5LCW J;  3QKY A;  4RG9 A;  3RKV A;  1TJC A;  4GA1 A;  3MV3 B;  3ASG A;  4BTA A;  5BT1 A;  2XGO A;  4J8E A;  2DBA A;  4BT8 A;  3WXX A;  1HH8 A;  3HYM B;  5D0O D;  3S7J A;  4YVQ C;  4APO A;  4N3C A;  2PZI A;  4WNF A;  2V5F A;  3CK8 A;  4W9R A;  5KJK A;  4N3A A;  3CK7 A;  4I1A A;  3RO3 A;  1NA3 A;  1ELW A;  4AM9 A;  4AY6 A;  3ZHE A;  4HOU A;  1PC2 A;  5BW8 C;  1QZ2 A;  4U07 A;  4N2S A;  1YA0 A;  2VSN A;  3MV2 B;  3S7D A;  3LYA A;  2YQ8 A;  3VTX A;  3CV0 A;  4BT9 A;  2AVP A;  2LSU A;  4N2Q A;  3RIB A;  1HZ4 A;  5G05 C;  4KXK B;  4UI9 J;  2NC9 A;  4UI9 K;  3Q49 B;  5FT9 A;  1IYG A;  4Y6W A;  4U0Z A;  2XPI A;  5BNW A;  4KBQ A;  3ZN3 A;  4U0U A;  2PQN A;  5KJN A;  3LY9 A;  4H7X A;  1HXI A;  1QQE A;  3CVP A;  4N39 A;  4G2V A;  2JLB A;  5D0Q D;  2L6J A;  2UY1 B;  4G25 A;  3LY7 A;  4G23 A;  2WQH A;  1ZU2 A;  5FJY A;  2R5S A;  3IEG A;  5KJM A;  2HYZ A;  4BWR A;  2FEZ A;  3CVN A;  2QFC A;  2KCK A;  5G04 J;  4RG6 A;  2GW1 A;  4KYO B;  4AY5 A;  3GYZ A;  2VSY A;  5JJ7 A;  3KS2 A;  2MHK A;  3TGO A;  3SZ7 A;  5FZS A;  4GYW A;  3PE4 A;  3EDT B;  3Q4A B;  5ARF A;  3RO2 A;  4GYY A;  5EX0 A;  1WAO 1;  2HO1 A;  4GPK A;  3Q15 A;  3S7B A;  4UI9 C;  5CCL A;  3K9I A;  2UY1 A;  2OND A;  3PDN A;  3CK9 A;  4ME2 A;  4BTB A;  2Y4T A;  3ZFW A;  3MEK A;  2XCB A;  4WUY A;  5FZR A;  3RJV A;  3UUX A;  1IHG A;  3ASD A;  4WNG A;  4UQY A;  2KCV A;  5FZQ A;  1XNF A;  4H7Y A;  1NA0 A;  4N3B A;  4I2W A;  3ESK A;  4J8F A;  4NQ0 A;  2C0M A;  3PE3 A;  5M72 A;  3QWV A;  2VGX B;  3UQ3 A;  5DBK A;  4G26 A;  1ZBP A;  4GCN A;  4NRH B;  3ZGQ A;  3QWP A;  5LCW C;  4U0S A;  4J0U A;  4WND A;  2VYI A;  4G1T A;  1E96 B;  3ASF A;  3ZPJ A;  5G04 C;  3LPZ A;  4GZ6 A;  5KJL A;  3CVL A;  3U4T A;  5JJ6 A;  5EKQ D;  5A6C A;  2C0L A;  5JJT A;  3TG5 A;  5DIZ A;  2HR2 A;  4Y6C A;  3OXG A;  3CKB A;  3OXF A;  4HOR A;  3OXL A;  5ARG A;  3KAE A;  3RU0 A;  4ABN A;  4G24 A;  4UQX A;  1A17 A;  4U04 A;  1B89 A;  5G05 J;  3ASH A;  1OUV A;  4GA0 A;  2FO7 A;  5CHE E;  2Q7F A;  2VGX A;  5HQ8 A;  2KC7 A;  3FP3 A;  2XCC A;  2XGM A;  3N71 A;  2VGY A;  1KT1 A;  4LEU A;  4I17 A;  5CCM A;  1KT0 A;  4UQZ A;  3GZ1 A;  4YND A;  2IFU A;  4I2Z A;  3AS4 A;  2PL2 A;  3MA5 A;  5FTP A;  1NZN A;  2FI7 A;  2YHC A;  4O6F A;  3GW4 A;  4J8D A;  5AYW D;  2Y4U A;  2I6H A;  4B94 A;  5A7D B;  3FFL A;  3JYS A;  2J9Q A;  3LY8 A;  5EX3 A;  3URZ A;  1ELR A;  1FCH A;  3TAX A;  3QWW A;  3Q5M A;  4XI0 A;  2WPV A;  3BEE A;  2FBN A;  2OOE A;  2C2L A;  3TG4 A;  4XI9 A;  4I9C A; 
#chains in the Genus database with same CATH topology
 2IO2 C;  4JHR A;  3R7Q A;  4ACK A;  1IQR A;  4XEI G;  4A1S A;  3ABL E;  5T3R A;  2FO1 E;  4EQF A;  2XGS A;  1WM5 A;  1TNY A;  3B7B A;  2DYR E;  4HRN A;  1UW4 B;  3FWV A;  4BX8 A;  4WWO A;  4LSZ E;  4KZC A;  4EZL A;  4RQI A;  5BPP A;  3CVW A;  2WM9 A;  4HRL A;  3ISM C;  1BLX B;  4LER A;  1LF8 A;  5B3S E;  3CVQ A;  4CDR A;  3S7F A;  2DVW A;  1UG3 A;  3FU0 A;  4GZ5 A;  5C1D A;  4WWP A;  2XEV A;  1DVP A;  3FUE A;  1OWL A;  4GYO A;  3ULQ A;  2P58 C;  3I3N A;  4NUR A;  1HS6 A;  1NL4 A;  2KM4 A;  3SQV A;  5IY5 E;  4RVB A;  1P5Q A;  2J8S D;  3BQO A;  4P29 A;  4IN3 B;  3E4B A;  2LSV A;  2VSX E;  4GCO A;  5T4Y A;  3SNX A;  2ZXW E;  4YVO A;  3KD7 A;  1E8X A;  2QC9 A;  3LVQ E;  1U3D A;  3RKV A;  1ZB1 A;  3APC A;  5B1A E;  3HXB A;  1IQU A;  3EIQ C;  2OVB A;  4JHJ A;  1OWP A;  2XGO A;  4U96 D;  3PZ2 A;  2KZT B;  4EZJ A;  1HH8 A;  1Z3X A;  1FT1 A;  3ZNG A;  2ETB A;  2JEK A;  5FQ6 A;  3AU4 A;  3S7J A;  1OCC E;  4YVQ C;  4UWF A;  3LJ3 A;  1XGW A;  2WXM A;  5KNG A;  2BKG A;  4TUM A;  3QNK A;  4W9R A;  3IHV A;  1FT2 A;  3QAQ A;  3S2A A;  3KSQ A;  2WMN A;  3FH8 A;  1H6O A;  4GMR A;  3EUV A;  2XHE A;  4AY6 A;  1N0R A;  3ZHE A;  4HI9 A;  4BET A;  3SBT B;  3S7D A;  5FWQ A;  3OAW A;  3JQ0 A;  2AVP A;  2LSU A;  5T8I A;  2YNQ A;  4N2Q A;  2CG3 A;  2WXF A;  3RIB A;  4L2Y A;  5G55 A;  4UI9 J;  2XPZ A;  2NC9 A;  3FTY A;  1HG2 A;  2LXL A;  3Q49 B;  5FT9 A;  2XEN A;  3HRA A;  2XPI A;  5BNW A;  1EPU A;  3T8M A;  4MLP A;  5CEA A;  2ILR A;  1S63 A;  1BU9 A;  4C48 B;  5KJN A;  3SY2 A;  1OCO E;  4IUL A;  2XZT G;  4H7X A;  5CBN A;  4GML A;  2IU1 A;  4N39 A;  3NZS A;  2JLB A;  4B8A A;  1H2T C;  5D0Q D;  4GMJ A;  4G25 A;  1JUQ A;  5AAO A;  1ZU2 A;  2DWZ A;  2R5S A;  3E34 A;  3LS8 A;  3IEG A;  5CRV A;  4GU5 A;  5KJM A;  2X6K A;  4OAV B;  1QBQ A;  3UXG A;  2QFC A;  4WAF A;  4EBA A;  4AXH A;  3PUJ A;  1WG0 A;  2KCK A;  1FVH A;  4I6E A;  4KYO B;  4PS7 A;  4JEU A;  4R7L A;  5EYL A;  2VSY A;  5JJ7 A;  3TWR A;  3G2U A;  3SZ7 A;  5FZS A;  2CHZ A;  4ZHB A;  3Q4A B;  2Y1L E;  3ZKJ A;  3RO2 A;  2XRZ A;  2HO1 A;  2DZN A;  4GPK A;  1DC2 A;  1E8Y A;  1PAQ A;  5A23 A;  3Q15 A;  4IYP A;  5ENP D;  2WXL A;  4JHK A;  1HFA A;  3L08 A;  3BG1 B;  4G11 A;  3CK9 A;  3CR3 A;  3DWL G;  3FUJ A;  4EPZ A;  3MKQ A;  4UWK A;  3DSV A;  4HS2 A;  4A3T A;  4MKT A;  2Y4T A;  3ZFW A;  4OAU C;  5KBA A;  3MEK A;  5BXU A;  5FZR A;  5G2N A;  3RJV A;  1IHG A;  4WNG A;  3UKR G;  1N4P A;  2IOS A;  2KCV A;  3G2V A;  1G3N B;  5ANL A;  1JPL A;  1NA0 A;  4N3B A;  3X2Q E;  3ESK A;  2C0M A;  3MJW A;  3RSE G;  2HM8 A;  3FH7 A;  2ETC A;  4FHJ A;  2VGX B;  3R9M A;  5DBK A;  4L7T A;  4G26 A;  3HVE B;  5EIB E;  4ILH B;  4ILG A;  3ULY A;  4WND A;  3ML9 A;  3ZPJ A;  5G04 C;  5KJL A;  3CVL A;  2VTB B;  4XX5 A;  3HG0 D;  3LDZ A;  5AQ9 A;  5A6C A;  5JJT A;  2V5Q C;  2P9L G;  3SD5 A;  1LTX A;  2EIL E;  4K03 A;  3FDH A;  3B13 A;  3I4G A;  3OXG A;  2WXO A;  3OXF A;  3OXL A;  3KAE A;  1JCQ A;  3PVL A;  3CSF A;  1E8Z A;  4Z68 A;  5BV1 A;  2L0T B;  5G05 J;  3DEP A;  3I5P A;  4GA0 A;  4K5A B;  5AQ7 A;  4LUN U;  3IKO B;  3FP3 A;  3UTM A;  2WXI A;  3TWT A;  4LEU A;  3HXE A;  3DSS A;  2B6C A;  3CQC B;  3CHQ A;  3AS4 A;  3L17 A;  1HF8 A;  1SZ9 A;  3E33 A;  4BY6 A;  4PH4 B;  3T8K A;  1NZN A;  3RRN B;  1Z3Y A;  4TXP A;  1KZP A;  2YHC A;  2EIK E;  2L9B A;  4O6F A;  5C2Y A;  3DSU A;  4PDX A;  1BI7 B;  4XKC A;  3ZXS A;  4TXR A;  2E0I A;  1N4S A;  5ENT D;  3EIJ A;  3LY8 A;  4L9P A;  3L22 A;  1ELR A;  4JPS A;  3CQG B;  2CHW A;  1V55 E;  4DI3 A;  3FTX A;  4XI0 A;  4DK5 A;  3QC1 A;  2OOE A;  4CYM D;  1TN8 A;  4IRU A;  4I9C A;  3B7U X;  2F8X K;  2EQX A;  4AP2 A;  2FF4 A;  4JXT A;  4GTM A;  3FUN A;  4B8C B;  2IF4 A;  5EYP F;  3UI2 A;  3CEQ A;  3DPD A;  4HOT A;  2RFM A;  4DUI A;  4OVU A;  4WNE A;  3TWW A;  4A3V A;  1KLX A;  2A5E A;  4B93 B;  5JA4 D;  3QOU A;  3QK0 A;  1W3B A;  2UWJ G;  3U3W A;  2AWI A;  3MKR A;  3I4R B;  3DSW A;  2I2O A;  1MX6 A;  3HXC A;  2WXN A;  1IHB A;  5JHB A;  3MZL B;  3L6A A;  2R59 A;  4DLQ A;  1MHQ A;  1BD8 A;  1SQM A;  2A5U A;  4CGW A;  3UT7 A;  3NOC D;  2ZGG A;  2KCL A;  1H0A A;  2E2E A;  3UT4 A;  4BES A;  2OV8 A;  1YCS B;  3B7S A;  1Z5S C;  3SF4 A;  2BED A;  3ENE A;  4F7A A;  4E6H A;  4JA7 A;  4A63 B;  3NF1 A;  3ZUV B;  3V79 K;  4EZK A;  3KEA A;  4A1G A;  5KCM A;  1MZC A;  4ANX A;  2NYJ A;  2YHE A;  1YYH A;  3EHN A;  5LFA A;  4GA1 A;  1OT8 A;  2R05 A;  3ASG A;  2EIN E;  5BT1 A;  4J8E A;  2DBA A;  3FTW A;  3HYM B;  3E32 A;  2OCC E;  3FU6 A;  5D0O D;  4APO A;  3UMV A;  4TV3 A;  4FHK A;  3CK8 A;  3JUE A;  1TN7 A;  2PM6 A;  3UM3 A;  4FLB A;  4I1A A;  3RO3 A;  1NA3 A;  1ELW A;  4F1P A;  3PUK A;  5FIN A;  4DX1 A;  1K1B A;  5AJD A;  4HLE A;  5CMY A;  5HRY A;  2L6B A;  4U95 D;  5BW8 C;  3ZXP A;  4URK A;  2WXJ A;  4N2S A;  2VSN A;  3LYA A;  3EU5 A;  3VTX A;  3HDX A;  3DXK G;  3AG1 E;  4BT9 A;  2QYU A;  4QQI A;  3V2X A;  2V4H C;  4DX2 A;  3FHE A;  3ASN E;  1IYG A;  3AAA C;  4HFG A;  2R02 A;  2CG2 A;  4JD2 G;  4U0Z A;  2QYJ A;  1H6P A;  4ANW A;  4KBQ A;  3ZN3 A;  4FU3 A;  5ITZ F;  3R7R A;  4KMO A;  2PQN A;  2Y0B G;  3G2S A;  5KWD A;  3LY9 A;  3G2W A;  4LG6 A;  1HXI A;  3DRA A;  1OXJ A;  3CVP A;  5AQA A;  2ION A;  1FVF A;  4DLO A;  1D9S A;  4E85 A;  3FTS A;  5CEC B;  4HQD A;  1Y6I A;  3T5V A;  2ZGD A;  5BXO A;  2P9I G;  1TJF A;  4K0R A;  3IHY A;  3Q9N C;  3CHM A;  3CVN A;  5HKP A;  2I1K A;  1N11 A;  4G8L A;  4HRM B;  4AEZ C;  3UM1 A;  2VJ8 A;  1TEZ A;  2WMO A;  1JWF A;  5B1B E;  4I1M A;  1K8K G;  5CBO A;  4UWG A;  4FP7 A;  5HS0 A;  2AXU A;  4ZFH A;  4GZD A;  3TGO A;  3CLJ A;  1OCR E;  3ML8 A;  3L9T A;  3EDT B;  1HO8 A;  1E7U A;  5EX0 A;  3PNL B;  3FEX A;  1IKN D;  3CHP A;  4UI9 C;  5CCL A;  1E7V A;  2AXZ A;  3D9H A;  2UY1 A;  3SO8 A;  2R03 A;  4UUC A;  4BTB A;  1KZO A;  3QAR A;  3JQ1 A;  5D66 A;  1O1S A;  1LD8 A;  4M7C A;  4MRU A;  4LNB A;  4WUY A;  3FU5 A;  5ENS D;  4UQY A;  1AP7 A;  4TRQ A;  1WDY A;  4I2W A;  3FUL A;  4NQ0 A;  3PE3 A;  3PZ3 A;  4CEM A;  3IXE A;  4NRH B;  3ZGQ A;  4A55 A;  2EIJ E;  5LCW C;  3SHF A;  4J0U A;  1AWC B;  2XS8 A;  3PH0 C;  3IV0 A;  3U4T A;  4MS6 A;  3RRU A;  1MX2 A;  5JJ6 A;  2XEH A;  4B0Z A;  2ZU6 B;  2B0O E;  2C0L A;  3ONL A;  3TG5 A;  3G2T A;  3ZVV A;  2FUL A;  4FJZ A;  2HR2 A;  4HB5 A;  3CKB A;  2X6J A;  3RU0 A;  2AW6 A;  4GTS A;  1S64 A;  1V54 E;  2RFA A;  4U04 A;  3FTZ A;  4V3I A;  4KZ0 A;  4FUL A;  3ASH A;  5CHE E;  2Q7F A;  3MX3 A;  1UOH A;  5CRU A;  2F37 A;  3CVX A;  4LNU D;  4I17 A;  2IJG X;  4UQZ A;  3D9P A;  2PL2 A;  2IEJ A;  2WXR A;  4GTQ A;  4J8Y A;  3TWU A;  3PRE A;  1N54 A;  2FI7 A;  2V8S E;  2IQC A;  1EF1 C;  1DNP A;  4J8D A;  5AYW D;  4O1O A;  2I6H A;  1TNZ A;  4FA6 A;  2F0Y A;  5BUZ A;  2QY7 A;  1MYO A;  2J9Q A;  1N52 A;  4C9B B;  1H2V C;  2XEE A;  3QWW A;  3Q5M A;  2DZO A;  4ANU A;  4XI9 A;  2LO6 A;  3C5R A;  2KAT A;  2PQR A;  3AS5 A;  3VTY A;  1Y8M A;  2WQ7 A;  4LCT A;  3ESL A;  3FU3 A;  1PY1 A;  3SFX A;  4XIF A;  1RW2 A;  3D9J A;  3EHQ A;  3CHO A;  2F8Y A;  2I1J A;  4L23 A;  3LCA A;  3W9F A;  4AIF A;  4JA9 A;  2OEV A;  3FUM A;  1YMP A;  3D9N A;  4HNA D;  4JW1 A;  4F3V A;  1DCQ A;  4DRX E;  1ELK A;  2RKK A;  3VLE A;  4JC8 A;  2BUG A;  2IO3 C;  2R2L A;  1NI1 A;  1TR4 A;  5BV0 A;  3PRZ A;  4NIK A;  2L0I A;  4M3O A;  3JCK C;  3RK6 A;  3D9O A;  2KXP C;  1EYH A;  3Q75 A;  3SFY A;  3AS8 A;  5ANR A;  3SGH A;  3ZHE B;  3NAW A;  1HE8 A;  4I6G A;  4HOS A;  4HBD A;  1UJJ A;  1U3C A;  3QKY A;  5JHA A;  3C98 A;  4JB8 P;  3ZRH A;  3CGH A;  4RG9 A;  3EJN A;  1TJC A;  3MV3 B;  4YDO A;  4AVX A;  4CZ2 D;  3IBE A;  3TXM A;  3E30 A;  3D9L A;  4N3C A;  1H2U A;  2PZI A;  2H6H A;  4FJY A;  3J5P A;  3W9G A;  1N4R A;  4N3A A;  5KJK A;  4LNG A;  3CK7 A;  1U2V G;  4AM9 A;  1HX8 A;  2GRQ B;  1TN6 A;  1PC2 A;  3OTN A;  1SA4 A;  4YDE A;  4ATZ D;  2H6F A;  1JWG A;  4FLH A;  1HZ4 A;  4X8Q A;  4KXK B;  4KVO A;  4K5C A;  3PEV B;  1O5M A;  4U8V D;  4UI9 K;  4KT6 B;  4EEC A;  2J07 A;  2KZT A;  3ZYL A;  3GZS A;  1A5E A;  2EIM E;  4U0U A;  3NQP A;  2P9N G;  5CMW A;  4RLY A;  3Q73 A;  1QQE A;  1HG5 A;  1RZ4 A;  2R17 C;  4G2V A;  2WXQ A;  5FQ7 A;  2NXP A;  3MKQ B;  4G23 A;  3C3Q A;  1OCZ E;  5FJY A;  4F6R D;  2GRR B;  1TNB A;  5ENN A;  2XPY A;  3KSL A;  4RG6 A;  3EHR A;  3RRM B;  4AY5 A;  3GYZ A;  3HXD A;  3O4Z A;  3TWS A;  3KS2 A;  4APF A;  3RAU A;  3UX4 A;  4O1P A;  3PE4 A;  1Z6T A;  5LP0 A;  1D8D A;  4I43 A;  4DX6 D;  5ARF A;  4U8Y D;  4GYY A;  1WAO 1;  3S7B A;  2X6I A;  4FAD A;  3K9I A;  2XS1 A;  4J8S A;  3C3R A;  3PDN A;  3HIZ A;  1UJK A;  2CFZ A;  2ZIS A;  5AQB A;  1MX4 A;  2I9C A;  4GZC A;  2XCB A;  3L54 A;  3ASD A;  1XNF A;  3Q7A A;  2WXG A;  3FY4 A;  2Y69 E;  4J8F A;  5FQ4 A;  1O1R A;  5M72 A;  3QWV A;  3CIA A;  2GRM A;  1L5J A;  3BU8 A;  5AJL A;  3L82 A;  1ZBP A;  5H7P A;  3QWP A;  4Q94 A;  1E96 B;  4LRZ A;  2OVF A;  3ASO E;  3JXJ A;  1NP7 A;  2ETA A;  1SVX A;  1S0P A;  5EKQ D;  4EBA G;  2P9P G;  3KEZ A;  5AN8 A;  5DIZ A;  2XRY A;  4Y6C A;  3DEO A;  1UN9 A;  3B7R L;  4Q69 A;  3PZ1 A;  2VGE A;  1TNO A;  1Q2Z A;  4EHM A;  3ULE G;  2GRL A;  5ARG A;  4HVB A;  4ABN A;  4UQX A;  3TWV A;  1H19 A;  1EDU A;  2J4D A;  4GTV A;  3MGB A;  1B89 A;  3UIP C;  3P1U A;  1OUV A;  4BSX A;  2VGX A;  5HQ8 A;  2KC7 A;  2J49 A;  2XCC A;  2A4Z A;  2XGM A;  4L2L A;  2P9K G;  4F1S A;  3PZ4 A;  4C0M A;  2KBX A;  3FTV A;  3HVE A;  4TXQ A;  5CCM A;  3TWX A;  4BEP A;  4I6J A;  3Q9U C;  4YND A;  3V2O A;  3Q7F A;  2IFU A;  4I2Z A;  4BER A;  3NB2 A;  2VTB A;  2PNN A;  1X5B A;  4KVM A;  4OVV A;  1QYM A;  3ABM E;  3UM0 A;  2V4L A;  2X3M A;  3FH5 A;  3GW4 A;  3D9K A;  4GTT A;  3ZIM A;  1IXV A;  4GTO A;  1N0Q A;  3FUD A;  1FPP A;  2P2C P;  4OYS A;  3TJP A;  1FCH A;  3TAX A;  3UM2 A;  2MYO A;  3ZU7 B;  4DX5 D;  3BEE A;  2X6H A;  2C2L A;  3TG4 A;  4CT0 A;  5AAR A;  4C0E A;  2LAI A;  3B7T A;  2CFU A;  1TYQ G;  1UN8 A;  4U63 A;  4N5C A;  4J6I A;  3AG2 E;  3LKU A;  3O48 A;  5HI7 A;  3CKC A;  3D3M A;  2LNI A;  3DSX A;  3FUK A;  5EIL A;  4RSY A;  4PS3 A;  3ONK A;  3QDN A;  2H6I A;  1S70 B;  2GRP B;  1HU3 A;  3FEY A;  4HLL A;  3UKU G;  1SA5 A;  3TL5 A;  3C72 A;  1SZA A;  5AEN A;  2ZIR A;  3UPV A;  4GA2 A;  5E75 A;  2JAB A;  4CT4 A;  3MCX A;  4ACL A;  4HOQ A;  4O60 A;  1N4Q A;  1JCR A;  3LEW A;  4YDY A;  5EID A;  3C3O A;  5KNH D;  4HXI A;  3T5X A;  4YDW A;  2MOW A;  2WXH A;  4GTR A;  1TNU A;  3CST A;  4JL0 A;  4CGV A;  4I9E A;  3GZ2 A;  1E90 A;  4XE0 A;  3HHM A;  3Q47 B;  1N95 A;  2VQ2 A;  4GTP A;  3EU9 A;  4UWL A;  3NZU A;  1N9A A;  4GZ3 A;  3R9A B;  3UT8 A;  3U9W A;  5LCW J;  4XZ4 A;  2DIW A;  3J5Q B;  5LOZ A;  3EHM A;  4JVS A;  2X6F A;  5JMN D;  2V0P A;  3UIO C;  1WY6 A;  3ZYM A;  4BTA A;  3MYV A;  2RD0 A;  2XQ0 A;  4BT8 A;  3WXX A;  5E76 A;  2WQ6 A;  2CHX A;  3DXM G;  3CVV A;  3UIN C;  3FUI A;  3DPY A;  4FC8 A;  3TXN A;  1OWM A;  2BF0 X;  2NSZ A;  4WNF A;  2V5F A;  4L1B A;  4NAC A;  4XKB A;  2DYS E;  4ILI A;  3LXU X;  4GAA A;  3L13 A;  1K1A A;  3SI5 A;  2P9U G;  2XZD G;  4HOU A;  3JUI A;  2MRI A;  1QZ2 A;  4U07 A;  4D10 C;  1YA0 A;  3PEU B;  3MV2 B;  4BSZ B;  2YQ8 A;  4K5B A;  1KPS B;  3CV0 A;  4N5Q A;  3JXI A;  4U8H A;  5G05 C;  5ENO D;  1BI8 B;  3U64 A;  4Y6W A;  3CHS A;  3FTU A;  1GW6 A;  2HE0 A;  2M63 A;  4UWH A;  1X81 A;  5FIO A;  1LD7 A;  5EN5 D;  3V31 A;  3VLF A;  3SBS A;  2RG8 A;  4DI4 A;  4I1O B;  4Q96 A;  4AV7 A;  2L6J A;  2UY1 B;  3LY7 A;  3PNT B;  2QZA A;  5ENQ D;  2DCP A;  2WQH A;  3APD A;  2HYZ A;  2IY0 C;  4BWR A;  2FEZ A;  3U66 A;  3AG4 E;  4JEH A;  1OWN A;  3B95 A;  2WVI A;  1QNF A;  2J4B A;  4U7E B;  5G04 J;  2GW1 A;  2X38 A;  4PUC A;  3LVR E;  2MHK A;  5EDS A;  4GYW A;  4ANV A;  4MBG A;  1MQS A;  3AJI A;  2J08 A;  3AU5 A;  4CRW A;  1E8W A;  5D2M C;  5CER B;  2OND A;  2OEW A;  4ME2 A;  3PZD A;  2GRO B;  1K3Z D;  4AOF A;  3VLD A;  5LX8 A;  3Q79 A;  3UUX A;  4TUU A;  3DBS A;  3BUA A;  2LUH A;  2AXV A;  5FZQ A;  4H7Y A;  4JZY A;  3CVU A;  1INZ A;  1OY3 D;  2BKK B;  3E37 A;  1OWO A;  4WWN A;  2GGF A;  3UQ3 A;  3ZW3 A;  5FQ8 A;  4GCN A;  4GB9 A;  3PS6 A;  4U0S A;  3ZEF A;  2VYI A;  4G1T A;  2J09 A;  3ASF A;  3LPZ A;  1BPO A;  4GZ6 A;  3SFZ A;  3F6Q A;  4HI8 A;  2IOL A;  3FUF A;  4CDM A;  5CED B;  2Y3A A;  3HXF A;  1D8E A;  4B89 A;  4AJW A;  1H6K A;  3ZYQ A;  3T9K A;  4HOR A;  4GPM A;  1DCE A;  3TWQ A;  1VDY A;  4G24 A;  4J7W A;  3QJZ A;  3Q78 A;  3NBN B;  1A17 A;  4F53 A;  1MJ0 A;  2FO7 A;  3ABK E;  4CCA A;  3N71 A;  2VGY A;  2WXP A;  3DST A;  1KT1 A;  2GRN B;  3FUH A;  2H6G A;  3BG0 B;  4CDN A;  1KT0 A;  2WXK A;  3L16 A;  5AIJ A;  3GZ1 A;  4DJA A;  4BX9 A;  3APF A;  4DX7 D;  3MA5 A;  2P9S G;  3CHR A;  3QB2 A;  3AG3 E;  5FTP A;  4PS8 A;  2BTD A;  3WG7 E;  2VSO E;  1N94 A;  1O1T A;  4DPR A;  3V30 A;  2Y4U A;  3LJN A;  4B94 A;  4G8K A;  2AJA A;  3NOG D;  4ATG A;  5ENR D;  5A7D B;  3D9I A;  3FFL A;  3ZYK A;  3JYS A;  2WB2 A;  5EX3 A;  3URZ A;  2LAH A;  4QFV A;  5J90 A;  2PM7 A;  1JCS A;  5J08 A;  1SW6 A;  2WPV A;  4BFR A;  2FBN A;  1NFI E;  2LXM A;  2YIN A;  3CVY A;  3D9M A;  3P2B A; 
#chains in the Genus database with same CATH homology
 2LO6 A;  4N5C A;  4J6I A;  4AP2 A;  2FF4 A;  2KAT A;  2PQR A;  3AS5 A;  4JXT A;  3VTY A;  3LKU A;  4JHR A;  3FUN A;  1Y8M A;  3O48 A;  3R7Q A;  4ACK A;  5HI7 A;  1IQR A;  4B8C B;  2IF4 A;  3CKC A;  3D3M A;  4A1S A;  2LNI A;  3FUK A;  2WQ7 A;  4LCT A;  4RSY A;  4PS3 A;  3CEQ A;  3DPD A;  3ESL A;  3FU3 A;  4HOT A;  5T3R A;  1PY1 A;  3ONK A;  3QDN A;  4EQF A;  4XIF A;  3D9J A;  2XGS A;  1WM5 A;  4OVU A;  3CHO A;  4WNE A;  2I1J A;  4L23 A;  4A3V A;  1KLX A;  1UW4 B;  3FWV A;  3LCA A;  4BX8 A;  1HU3 A;  3FEY A;  3QOU A;  3QK0 A;  4WWO A;  4AIF A;  4JA9 A;  4KZC A;  4EZL A;  3CVW A;  5BPP A;  3TL5 A;  1W3B A;  3FUM A;  1SZA A;  5AEN A;  2WM9 A;  3UPV A;  3D9N A;  2UWJ G;  4JW1 A;  3U3W A;  2AWI A;  4GA2 A;  3MKR A;  5E75 A;  4LER A;  4F3V A;  3I4R B;  4CT4 A;  3MCX A;  4ACL A;  1ELK A;  1LF8 A;  4HOQ A;  2I2O A;  3CVQ A;  4CDR A;  3LEW A;  3S7F A;  3VLE A;  1UG3 A;  4JC8 A;  2BUG A;  3FU0 A;  2WXN A;  4GZ5 A;  4HXI A;  4WWP A;  2XEV A;  3T5X A;  2MOW A;  5C1D A;  1DVP A;  2WXH A;  5JHB A;  3MZL B;  3CST A;  3L6A A;  4JL0 A;  5BV0 A;  2R59 A;  3PRZ A;  1MHQ A;  3FUE A;  4DLQ A;  2L0I A;  4CGV A;  4I9E A;  4M3O A;  3GZ2 A;  1OWL A;  3JCK C;  4GYO A;  3ULQ A;  1E90 A;  2P58 C;  3I3N A;  4NUR A;  1SQM A;  2A5U A;  3HHM A;  4XE0 A;  1HS6 A;  3Q47 B;  3RK6 A;  3UT7 A;  4CGW A;  2KM4 A;  4RVB A;  3D9O A;  1P5Q A;  2KCL A;  1H0A A;  2E2E A;  4P29 A;  3UT4 A;  1EYH A;  4IN3 B;  3E4B A;  2VQ2 A;  2OV8 A;  2LSV A;  4UWL A;  3AS8 A;  3B7S A;  3NZU A;  5ANR A;  2VSX E;  3SF4 A;  3SGH A;  4GCO A;  5T4Y A;  3SNX A;  3ZHE B;  3ENE A;  4YVO A;  4GZ3 A;  1HE8 A;  3KD7 A;  4I6G A;  4F7A A;  3R9A B;  3UT8 A;  4E6H A;  4HOS A;  4JA7 A;  3U9W A;  3NF1 A;  5LCW J;  4XZ4 A;  1UJJ A;  1U3C A;  2DIW A;  3QKY A;  4EZK A;  5JHA A;  3C98 A;  1E8X A;  5LOZ A;  3ZRH A;  3EHM A;  3CGH A;  2X6F A;  3LVQ E;  2V0P A;  1U3D A;  4JVS A;  4RG9 A;  5KCM A;  4A1G A;  4ANX A;  1WY6 A;  3RKV A;  2YHE A;  3EJN A;  1TJC A;  3APC A;  3EHN A;  5LFA A;  4GA1 A;  3ZYM A;  1IQU A;  3MV3 B;  3ASG A;  4BTA A;  3EIQ C;  2OVB A;  3MYV A;  2RD0 A;  5BT1 A;  2XQ0 A;  1OWP A;  4JHJ A;  2XGO A;  4J8E A;  4AVX A;  2DBA A;  2KZT B;  4BT8 A;  3FTW A;  3WXX A;  1HH8 A;  4EZJ A;  5E76 A;  2WQ6 A;  3HYM B;  2CHX A;  1Z3X A;  3IBE A;  3CVV A;  3TXM A;  3FU6 A;  2JEK A;  5FQ6 A;  5D0O D;  3AU4 A;  3FUI A;  4YVQ C;  3S7J A;  4UWF A;  4APO A;  4FC8 A;  3LJ3 A;  3D9L A;  1XGW A;  4N3C A;  1H2U A;  2PZI A;  2WXM A;  3UMV A;  3TXN A;  4TV3 A;  1OWM A;  2BF0 X;  3QNK A;  2NSZ A;  4WNF A;  4FJY A;  4FHK A;  2V5F A;  3CK8 A;  4L1B A;  4W9R A;  3IHV A;  5KJK A;  2PM6 A;  4N3A A;  4NAC A;  4FLB A;  3CK7 A;  4XKB A;  4I1A A;  3RO3 A;  1NA3 A;  3QAQ A;  3S2A A;  4ILI A;  1ELW A;  3LXU X;  4AM9 A;  2WMN A;  3PUK A;  1HX8 A;  3FH8 A;  4GAA A;  3L13 A;  2XHE A;  4AY6 A;  5AJD A;  4HLE A;  5CMY A;  3SI5 A;  3ZHE A;  4HOU A;  1PC2 A;  3JUI A;  5BW8 C;  2MRI A;  4URK A;  1QZ2 A;  4U07 A;  2WXJ A;  3OTN A;  4D10 C;  4N2S A;  1YA0 A;  2VSN A;  3MV2 B;  3PEU B;  3S7D A;  5FWQ A;  3SBT B;  3LYA A;  2YQ8 A;  3VTX A;  3HDX A;  3OAW A;  3JQ0 A;  3CV0 A;  4BT9 A;  2AVP A;  2LSU A;  5T8I A;  1JWG A;  2YNQ A;  4N2Q A;  2CG3 A;  2WXF A;  4FLH A;  1HZ4 A;  4L2Y A;  3RIB A;  5G05 C;  4KXK B;  4U8H A;  4UI9 J;  5G55 A;  4KVO A;  3PEV B;  2XPZ A;  2NC9 A;  4UI9 K;  3FTY A;  1HG2 A;  4KT6 B;  4EEC A;  2J07 A;  2KZT A;  3Q49 B;  3FHE A;  5FT9 A;  3GZS A;  3U64 A;  4HFG A;  3ZYL A;  1IYG A;  4Y6W A;  3CHS A;  2CG2 A;  1GW6 A;  2XPI A;  3FTU A;  2M63 A;  4U0Z A;  5BNW A;  4ANW A;  4KBQ A;  1EPU A;  3ZN3 A;  4UWH A;  3T8M A;  4FU3 A;  4MLP A;  4U0U A;  3NQP A;  3R7R A;  4KMO A;  2ILR A;  2PQN A;  3G2S A;  5KJN A;  3LY9 A;  3G2W A;  3VLF A;  5CMW A;  4IUL A;  3SBS A;  2RG8 A;  4H7X A;  1HXI A;  1QQE A;  4GML A;  2IU1 A;  3CVP A;  4DI4 A;  1HG5 A;  2ION A;  4I1O B;  2R17 C;  3NZS A;  2JLB A;  1FVF A;  4G2V A;  4N39 A;  4Q96 A;  1H2T C;  5D0Q D;  4B8A A;  2L6J A;  4AV7 A;  2WXQ A;  2UY1 B;  4GMJ A;  4G25 A;  3LY7 A;  1JUQ A;  3PNT B;  5FQ7 A;  2NXP A;  2DCP A;  3MKQ B;  4G23 A;  4DLO A;  2WQH A;  1ZU2 A;  5FJY A;  4E85 A;  3FTS A;  2R5S A;  3APD A;  3LS8 A;  3IEG A;  1Y6I A;  4GU5 A;  3T5V A;  5KJM A;  2X6K A;  1TJF A;  4K0R A;  2HYZ A;  3IHY A;  3CHM A;  4BWR A;  2FEZ A;  3CVN A;  2QFC A;  2I1K A;  4WAF A;  3U66 A;  4JEH A;  1OWN A;  4EBA A;  2WVI A;  4AXH A;  5ENN A;  3PUJ A;  4AEZ C;  2XPY A;  1QNF A;  2KCK A;  2J4B A;  2VJ8 A;  1TEZ A;  2WMO A;  1JWF A;  5G04 J;  4I1M A;  1FVH A;  4RG6 A;  4UWG A;  4FP7 A;  2GW1 A;  4I6E A;  2AXU A;  3RRM B;  4KYO B;  4PS7 A;  4JEU A;  2X38 A;  4R7L A;  3GYZ A;  4AY5 A;  3O4Z A;  4PUC A;  2VSY A;  5JJ7 A;  3LVR E;  3KS2 A;  4GZD A;  2MHK A;  3TGO A;  4APF A;  3G2U A;  3SZ7 A;  5FZS A;  4GYW A;  5EDS A;  2CHZ A;  3UX4 A;  3CLJ A;  3ML8 A;  3PE4 A;  1Z6T A;  5LP0 A;  3EDT B;  4I43 A;  4ANV A;  1HO8 A;  3Q4A B;  5ARF A;  3RO2 A;  2XRZ A;  1E7U A;  4GYY A;  5EX0 A;  1MQS A;  3PNL B;  3FEX A;  1WAO 1;  2HO1 A;  2J08 A;  4GPK A;  3AU5 A;  1E8Y A;  1PAQ A;  5A23 A;  3Q15 A;  4IYP A;  3S7B A;  4CRW A;  2WXL A;  1E8W A;  3CHP A;  4UI9 C;  5CCL A;  2X6I A;  4FAD A;  1E7V A;  3K9I A;  1HFA A;  4JHK A;  2AXZ A;  3BG1 B;  3L08 A;  4J8S A;  2UY1 A;  4G11 A;  2OND A;  3PDN A;  3CK9 A;  3HIZ A;  3CR3 A;  1UJK A;  2CFZ A;  4ME2 A;  3FUJ A;  3PZD A;  3MKQ A;  4EPZ A;  4UWK A;  4HS2 A;  4BTB A;  4A3T A;  4MKT A;  3QAR A;  3JQ1 A;  2Y4T A;  2I9C A;  3ZFW A;  3VLD A;  4AOF A;  4GZC A;  5LX8 A;  3MEK A;  2XCB A;  4MRU A;  4WUY A;  5FZR A;  5G2N A;  3FU5 A;  3L54 A;  3RJV A;  1IHG A;  3ASD A;  4TUU A;  4WNG A;  3UUX A;  4UQY A;  3DBS A;  2IOS A;  3G2V A;  2KCV A;  5ANL A;  2AXV A;  4TRQ A;  5FZQ A;  1XNF A;  4H7Y A;  2WXG A;  1JPL A;  1NA0 A;  4JZY A;  3FY4 A;  4N3B A;  3CVU A;  4I2W A;  3ESK A;  3FUL A;  4J8F A;  4NQ0 A;  2C0M A;  3PE3 A;  5FQ4 A;  1INZ A;  3MJW A;  5M72 A;  1OWO A;  2HM8 A;  3QWV A;  3FH7 A;  4WWN A;  3CIA A;  4FHJ A;  2GRM A;  4CEM A;  2GGF A;  2VGX B;  3UQ3 A;  5DBK A;  4L7T A;  1L5J A;  4G26 A;  5AJL A;  1ZBP A;  5FQ8 A;  3ZW3 A;  4GCN A;  3HVE B;  4NRH B;  3ZGQ A;  4C9B B;  3QWP A;  4GB9 A;  4A55 A;  5LCW C;  4Q94 A;  3PS6 A;  4ILH B;  4ILG A;  4J0U A;  4U0S A;  3SHF A;  3ZEF A;  4WND A;  2VYI A;  3ML9 A;  4G1T A;  1E96 B;  2J09 A;  3ASF A;  4LRZ A;  3ZPJ A;  5G04 C;  2OVF A;  3LPZ A;  1BPO A;  3PH0 C;  4GZ6 A;  3CVL A;  3SFZ A;  5KJL A;  2VTB B;  3IV0 A;  3U4T A;  4MS6 A;  1NP7 A;  3RRU A;  2IOL A;  4XX5 A;  3FUF A;  4CDM A;  5JJ6 A;  4B0Z A;  2ZU6 B;  2Y3A A;  5EKQ D;  1S0P A;  3LDZ A;  4EBA G;  4B89 A;  5A6C A;  2C0L A;  3ONL A;  4AJW A;  5JJT A;  3TG5 A;  3KEZ A;  3G2T A;  3ZVV A;  3SD5 A;  1H6K A;  3ZYQ A;  2FUL A;  5DIZ A;  4FJZ A;  2HR2 A;  2XRY A;  4Y6C A;  4K03 A;  3FDH A;  1UN9 A;  3B7R L;  4Q69 A;  3B13 A;  3I4G A;  3OXG A;  2WXO A;  3CKB A;  3OXF A;  4HOR A;  2GRL A;  3OXL A;  5ARG A;  1VDY A;  4HVB A;  2X6J A;  3KAE A;  3RU0 A;  4ABN A;  4G24 A;  3PVL A;  2AW6 A;  3QJZ A;  3CSF A;  4UQX A;  1H19 A;  1EDU A;  2J4D A;  1E8Z A;  1A17 A;  4U04 A;  3FTZ A;  3MGB A;  5BV1 A;  1B89 A;  4V3I A;  4KZ0 A;  4FUL A;  4F53 A;  3P1U A;  2L0T B;  5G05 J;  3ASH A;  1OUV A;  3I5P A;  4GA0 A;  2FO7 A;  5CHE E;  4BSX A;  2Q7F A;  2VGX A;  3IKO B;  4LUN U;  5HQ8 A;  2KC7 A;  2J49 A;  3FP3 A;  4CCA A;  2XCC A;  2A4Z A;  2WXI A;  2XGM A;  2VGY A;  2WXP A;  3N71 A;  4L2L A;  1KT1 A;  3MX3 A;  3FUH A;  4LEU A;  4F1S A;  4C0M A;  3CVX A;  3BG0 B;  3FTV A;  3HVE A;  4I17 A;  4CDN A;  5CCM A;  1KT0 A;  2WXK A;  2IJG X;  3L16 A;  4UQZ A;  3D9P A;  5AIJ A;  3GZ1 A;  4I6J A;  3CQC B;  4DJA A;  4BX9 A;  3APF A;  4YND A;  3CHQ A;  2IFU A;  4I2Z A;  3AS4 A;  2PL2 A;  3L17 A;  1HF8 A;  3MA5 A;  2VTB A;  3CHR A;  1SZ9 A;  3QB2 A;  2WXR A;  5FTP A;  4BY6 A;  4PH4 B;  4PS8 A;  2BTD A;  3PRE A;  1NZN A;  1N54 A;  1X5B A;  1Z3Y A;  2FI7 A;  3RRN B;  2YHC A;  4KVM A;  2L9B A;  2V8S E;  4OVV A;  4O6F A;  2IQC A;  5C2Y A;  2V4L A;  2X3M A;  3FH5 A;  1EF1 C;  3GW4 A;  2VSO E;  3D9K A;  4PDX A;  3ZIM A;  1DNP A;  4J8D A;  4DPR A;  5AYW D;  2Y4U A;  4XKC A;  2I6H A;  3ZXS A;  4B94 A;  2E0I A;  4FA6 A;  4ATG A;  3FUD A;  5A7D B;  5BUZ A;  3D9I A;  2QY7 A;  3EIJ A;  3FFL A;  3ZYK A;  3JYS A;  2WB2 A;  2J9Q A;  3LY8 A;  3L22 A;  5EX3 A;  4OYS A;  3URZ A;  2LAH A;  1N52 A;  1ELR A;  4JPS A;  3CQG B;  1H2V C;  2CHW A;  1FCH A;  2PM7 A;  4QFV A;  3TJP A;  3TAX A;  5J90 A;  4DI3 A;  5J08 A;  3QWW A;  3FTX A;  3Q5M A;  4XI0 A;  2WPV A;  4DK5 A;  3QC1 A;  4ANU A;  3BEE A;  4BFR A;  2FBN A;  2X6H A;  2OOE A;  2C2L A;  3TG4 A;  4IRU A;  2YIN A;  4CT0 A;  4XI9 A;  4C0E A;  2LAI A;  3CVY A;  4I9C A;  3B7U X;  3B7T A;  3D9M A;  2EQX A;  3P2B A;  2CFU A;  1UN8 A;  4U63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...