2KCNA

Solution structure of the antifungal protein paf from penicillium chrysogenum
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional aspects of the solution structure and dynamics of PAF--a highly-stable antifungal protein from Penicillium chrysogenum
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Antifungal protein
molecule keywords Antifungal protein
total genus 4
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kcnA00
2MHVA 2NB0A 2NBFA 2KCNA 1AFPA
chains in the Genus database with same CATH superfamily
3PUWA 2FJ2A 3WOEA 1PTOF 4HSPA 5IGBA 2K1BA 1FGBD 5D65A 4F7XA 4N9PA 5ELCA 4K8IA 2F0FA 4KI0A 1PRTC 3Q6SA 1TWHB 5C5MA 2SEBD 5C0XG 1PZKD 1MI2A 5M5XB 1VQOA 1L2FA 4R4CA 3RMHA 1G2TA 3V05A 2H5XA 1H9MA 4A3GG 2RHSB 4U673 1VF7A 1PRTB 1LTLA 1AFPA 1QVCA 1YITA 3H3VC 3IAYA 3IFDA 4Y7NB 1SN8A 4CDEC 3T4AC 1ICWA 3CQZB 2MPMA 3HG9A 1TWFH 4IOCA 4HN7A 2K03A 2KUMA 3N6RA 2VUMH 1C0AA 3STBC 1IZ6A 3GTOH 3H91A 1CKMA 1BKBA 4X3SA 2F1MA 4RGTA 2Z1CA 3TMEA 3HOXH 3RR5A 5GADC 1KABA 4LUZA 1H95A 1XNRQ 4LNQA 2E2JH 3I4MG 1OXSC 2UXCL 3NBHA 2IY5B 5JVG3 1XMQL 3HGBA 1TS2A 3FPPA 1PTOB 1CHPD 1I4QA 3NWTA 3GTLH 3GTOB 2WV6D 1YNND 4KK7A 2WAQG 1UUPA 1V8QA 1UAPA 2RDGA 4HTHA 3KJPA 1ESFA 4A93G 3E6ZX 3RLFA 1KXLA 4A3EG 2EJGC 4XDXA 2F0JA 3J80c 4DXFA 2MP1A 1N32L 2WFWA 4UAIA 3J80L 3GTJB 2Z8LA 3A54A 1RD9D 1EEID 4DR6Q 4MHEA 4DGZA 4KHVA 5IP7H 2RQXA 1WCMH 5C3EG 2B2YC 1XJVA 1SMXA 1PRTD 2D0PA 1STEA 4OWTB 3EN2A 4KD3A 3GTQH 3AU7A 4L63B 1ILPA 4IPGA 4R4TA 3CRLC 5ELBA 4DV4Q 5FO8B 3CC4A 3H0GB 4IOAA 3CPWA 3GTJH 4XT3B 3W1GA 1RL2A 1X6OA 1H9KA 4QIWE 1IBLQ 2E75C 1JR0D 3ZYYX 2Z4HA 1EY4A 3S1QH 4LF5Q 1AEXA 1QZHA 1JE5A 1AZQA 3SK4A 2UU9L 3GTQB 4LW1A 1T5EA 4LFBL 2R6GA 4AYBE 4GNXC 4DK1A 4UPAA 1X56A 5FKAC 3H0GG 1MGSA 3F2BA 1B70B 4IUQA 4JYAQ 4A3IG 1Q12A 1U5KA 2GA4B 4B9WA 1A63A 4Q5VA 5LMUL 4HCSA 2B2VA 2KCTA 4KTAA 3IL8A 2XRQD 3IFTA 3VDYA 4JYAL 2LXJA 2HIXA 1E2VA 3KLSA 1SNMA 1TWAB 5IT9E 4C3IB 1Y8NB 4WORA 1WTVA 4G7HC 3DM3A 4WFN3 2HQLA 3QJYA 2L4NA 3VA5A 4EGVA 4K5XA 2JEAI 1M4VA 2CCZA 3PO2G 4HEDA 4HIMA 4DR5Q 1FNUA 3MXGA 2RHQB 5A35A 1EY5A 3E5SA 3HOUB 2R92G 2UUBL 1DOMA 4A3JH 4ULLA 3C2PA 3L7ZC 4P71A 3UDFA 2B2VC 4IUNA 3LWEA 1H9SB 4B08A 4K5WA 4KN7C 2NWGA 4YY3Q 1ASYA 3CPFA 3W5OA 3K5NA 1K83H 2IX3A 4LUVA 2RA4A 3E0JA 4RCOA 3CCRA 3H09A 3I91A 1SE8A 2Y0SB 1Q3LA 3I4OA 2DY7A 4O0AA 4YY3L 2UXDL 3S1RB 3PQIA 4JOIC 4FO2A 2QGQA 4A3JB 1A15A 4RMFA 2EQSA 1TWGB 2G9HD 3OTOL 3BVMA 4DUYQ 1Q90A 2UXDQ 2PW5A 4KKUA 3M85A 1L1OA 4A75A 2R93H 2PQAB 1F9QA 1YIJA 2A68D 3RLNA 1IKLA 3QIAA 3S16H 2OT2A 2J0TD 5M3FH 2E74C 1UWVA 3U58A 2KJXA 2O2LD 1NTGA 1JQYD 3DHQA 5JJKA 1EIGA 1DGSA 5FOBB 3G4SA 5IGCA 1K8GA 3G48A 2RDFA 1IW7C 2C9OA 1TWGH 3HOVB 3Q23A 5IP9H 3HOYH 3E9IA 3M4QA 3ICEA 3NWSA 4FXGC 5LMNL 2I5LX 2MO0A 3C46A 2NYZD 1Z47A 3RZOH 5IT9c 5FK9C 4PZ8A 3IRBA 4LFCL 3CC2A 3J7AV 1CQVA 1K73C 4WJWA 4RHRA 1I3QB 1W2BA 1L1OB 2DNEA 2YTXA 4MIUA 1SROA 2QEXA 2F0IA 3PIOA 4M1UB 2F3VA 3I4NG 3KFUA 1Z9FA 4X65L 1XNQQ 2F0MA 5D14A 3NHHA 1QNKA 1ESRA 4R8NA 4DR4Q 1VQLA 2Z4IA 4RG1A 5JEAH 4R9WA 2VQEL 1WTWA 2A73B 4EQOA 2NZHA 1BCPF 1SJED 4U68A 1L0XB 5T1GA 1S5BD 4JV5Q 3I72A 3SK6A 2KOLA 3H15A 1WTXA 2HHHQ 4F87A 4A3CG 3KUPA 4FF4A 5FJ8G 1H9SA 2VUMB 4R4QA 1SJHD 5F2DA 3O13A 3OIQA 1XPOA 4RWSC 3TQYA 1Y1WB 4IQZA 3QB3A 3TN2A 2F0NA 1VS0A 3W1BA 3KF8A 4A3GB 4LF8Q 2A69D 1SYGA 2OCEA 4WRDA 1CFMA 1TS4A 2VQFL 1AZPA 2NN6H 2X6LA 4KLKA 4DV6Q 1PH8A 1HFNA 2D9UA 4B3RL 3F2CA 5FLMH 5M9OA 2KQ3A 1W6KA 4C3JH 5M5WB 1CT1D 1NMGA 2ID0A 2QDLA 4O1NA 4OGQC 2MJ8A 1GJXA 4HIOA 4KKSA 2B2UA 5IIFA 3TS0A 2O5IC 1G8ZD 1LTAD 2K50A 2NN6G 1EQTA 1X3PA 5EPLA 4P74A 3URYA 4DV2Q 1HXYD 2F3WA 3S1MH 3PF4A 1VQ4A 5IE8A 4GZYC 1HZBA 3I4LA 2R7ZH 1SE4A 3HS0C 4GOPA 2BOSA 3CHBD 3H6MA 4APVA 4ZRZA 2JA6H 2DY8A 1DD2A 1RTOA 1BCPB 1QJOA 1YVCA 4A3CH 4H0LC 1VQ9A 1HNWQ 2HCCA 1BUVT 4OWXB 1CA6A 2E2HH 4DR7L 1WCMB 2ZM6Q 2JA7H 1RTNA 4NPSA 2JK8A 5IYCG 3FKIH 1IYVA 3J7YW 1EZ6A 1YNXA 2FXQA 2IT1A 1PYSB 1DXMA 3CW2C 1N36Q 2NVTB 1WD0A 1HRJA 2ZM6L 1EY7A 1QWYA 3D4DA 3K7UC 3H0GH 1WVLA 1B9NA 3KLRA 1QCBD 4PMCA 3KK7A 5FO9B 4IPCA 4XYQA 4LJZC 2E2HB 1C4QA 5EAYA 5C44G 1PXUA 2JA7B 5CV6A 3EROA 1NAPA 1V1QA 4MTNA 1BXTA 2BH2A 5ELNA 1PDQA 3DM1A 4X6AH 2Q2HA 2NVTH 3QOLA 4QUFA 3J7ZC 4OIJA 2AWOA 1PV4A 4NW2A 3BVZA 2Q2UA 3K58A 1NJIC 1QVFA 3EJIA 1CKOA 1PTOD 3BS1A 2IPKD 1F2MA 1VCIA 1LTRD 3BYYB 3TZUA 5C3WA 4QY7A 2RBMA 1LYLA 2UUCQ 1E2ZA 1II3A 2CKZB 2ZXPA 1XPUA 2NVQH 3HZXA 3AMUA 1K0SA 1HTLD 4A3KG 2WKDA 4BA2I 1HHVA 4N9TA 1RKNA 4R4IA 1CHQD 1PFNA 2WB1G 2YTYA 2EJMA 4IALA 1U0LA 4XYOA 1SNCA 4P75A 2G9DA 4P73A 2E8GA 2BE5C 3OMCA 4BY1G 4RH6A 2Z6KC 3JAML 2XWBB 3M3YB 2K28A 3R2TA 1B3AA 1ILQA 2MHVA 5BN5A 4K14A 4FNFA 1LTSD 1EOVA 1KL9A 1NSNS 3RUZA 4X3UA 1DONA 4C56C 1E22A 1A2UA 3NP8A 1KAWA 3JAMi 3M4PA 2KCCA 3HKZG 1W6JA 2WKCA 1I6HH 3CAMA 4QB4A 1QOHA 4RHSA 1Y8OB 5HURA 2VNUD 1D2BA 3JC66 4IUPA 4WJ3M 2F0PA 2H4OA 4JW0A 1I6VC 2WAQB 4HMJA 2EY6A 1KNEA 5FLXE 2EXZA 4X3TA 2Q2IA 3PUYA 4JCVE 3DXJC 4BBRB 4JI6L 1TVXA 2JSOA 2XN9C 2KCMA 5D3DA 5ELFA 1O80A 5CV4A 1EWCA 4X3KA 1PFMA 1CKNA 4AQYL 3HOYB 3NE5B 5HGTA 4BXXH 2RCNA 5C0XI 1E0BA 4L5SA 4BBSB 3S17B 2K5WA 2ZJRA 2BA1A 3DEPA 2KCNA 1JMCA 1S3OA 4I7AA 4MNOA 4YIJA 1N8RC 3UDGA 3Q8DA 3SK5A 3BZKA 4A3EB 1HNZQ 4KV6A 4OX9L 5C3XA 2F0QA 1SNQA 4KHZA 2R7ZG 5J1ZA 5C4JB 1Q8KA 1FYCA 1BBWA 1A2TA 3S17H 2QCPX 1GKHA 4JI5Q 3S2HB 1SMYC 1R9TH 2WB1B 1P8LA 3U4VA 2B2UC 2X6GA 2QILA 3UDXA 1XTCD 2B63G 1A6XA 4XTCS 5IP7G 2F0TA 1AP0A 2N88A 3DWAA 3KOJA 4LK1C 4BY1H 3MWYW 2XVSA 4A3KH 1TIID 1VQDA 3NQTA 1RDPD 1Q7YC 2OQKA 2VS1A 1JJGA 5AFWA 1R9TB 1D8LA 2B2TA 2UUAQ 5DLQE 5BN3A 4H7BA 2EY5A 5KRUA 3S14B 1YJWA 4OO1H 2YYZA 3G7LA 3U4ZA 4JI8L 1VQPA 1EYAA 1JWUD 3T16A 1G2SA 2MNAA 4B3ML 2ZTEA 1Q82C 2ZJQA 1IL8A 3PO3H 5C44B 2IX0A 1Y1WG 1SEBD 2PNRC 3NBHB 1GUOA 4DR2Q 1Z6HA 1EZ8A 1FJGL 4C2MH 1SBBB 5I9OA 2AKWB 1Q46A 2MFIA 2I5MX 1CA5A 3HOYG 1F2LA 3MEFA 1LABA 4DV7Q 4JI3L 5LL6S 5C44H 3K5OA 1XMOQ 2CW0C 1STAA 5L37A 4CDFC 3I4NB 4OHJA 2B63B 1VQ7A 1K9MC 3BDLA 3FKIB 4BY7G 4NB3A 4Q0FA 2CHBD 4DU9A 2RSNA 1SSOA 3BU2A 2VY3A 3KF6B 1Y1VG 4C1NI 1A8VA 3A55A 5M5YH 4CGYB 3KDFA 1XMQQ 3M7GA 1A3VA 2BCOA 4A3FB 2LKVA 3PUVA 2F4VL 1HJPA 3PGZA 1QVGA 3D31A 3SVMA 2A6HD 1N9WA 3HOUG 4LF9L 3OOCA 4G4KA 4X66L 1VMCA 4TKOB 5EPKA 3HOVG 2VL6A 3M4OH 2MO1A 1VQEA 3BZCA 1X9NA 2F4IA 4OO1G 1EQVA 4ZCKA 3DEOA 1GHJA 4X66Q 3VR3A 2E2DC 2IWHA 2ASBA 3PMFA 4DAYA 2E2IH 3AEVA 5E3FA 2EIFA 3EBEA 5IT9L 5EJWA 1YI2A 4NP5A 4RAUC 3DMUA 1TWHH 5JAVA 4FXKC 1EY8A 4GKJL 2A19A 3UE1A 2VB3X 2RCFA 1WTQA 2YTVA 4HJ9A 2DN8A 1FNWA 3R3OA 4B9XA 1JWSD 1AE3A 4XIGS 1K3RA 3UE0A 1ZEQX 4L8JA 4TSSA 4GKJQ 3RNUA 4ZK9B 1CM9A 2R7DA 4PZ7A 5FJ8H 2BDNA 4DV1Q 1TT2A 1SRUA 2PQEA 4H13C 5KNBA 3S15B 1PLFA 5HY6A 5IOCA 1S40A 3GQBA 4TVAB 1SLJA 1TWCB 2K14A 1E3PA 2JA8B 3PSIA 3E0EA 2KA7A 4IFDG 2I5HA 1K8OA 1VQIA 2UU9Q 4LFBQ 3NPPA 2GVBA 5K36G 3A7AB 4A76A 1F9SA 4IPHA 2E2JB 2JA7G 5DM73 4X64L 1C9OA 2AUKA 3CCLA 3DWPA 2QKIC 3SK8A 1JORA 4LWCA 1EYGA 2A69C 1ZKOA 1B4OA 2EYFA 3KYHC 3P20A 1ENAA 2LY7A 1Q1EA 2O4XA 2JA8H 5LMUQ 4ME3A 4JI4Q 2KEDA 2VB2X 4LFAQ 3Q24A 2PZUA 1ZYRD 1I50H 1U4RA 2P5ZX 4OXPA 1EL0A 2A6ED 1O78A 4G7ZC 1TU2B 1STGA 3A8IE 5CV5A 5C3EH 3QOJA 1UEAB 2L12A 4K0KQ 5C0XJ 4NDXA 4UP7A 2CQAA 2EYHA 2B8GA 2AUJD 4FF1A 4F8MA 2F0LA 2UUBQ 2R7FA 3T13A 1KIXA 4KHPL 1BR9A 1SYFA 1I50B 4XQJA 1O7LA 5BR8L 1W3SA 3ULJA 1J9OA 2IHFA 1BNZA 3CMAA 1SYCA 2RSOA 4QGUA 2Z0SA 1PH3A 4KHPQ 3K7AB 4B3SQ 2I07B 4V0BA 1MJCA 4A3EH 1EFID 3G71A 2YU9B 3G6JB 5GROA 4DNIA 1A0IA 1X3EA 3VR4A 5C4JH 5C4XB 4K2KA 2Y0SE 4IPDA 1JOKA 1KRTA 1HUMA 3KLWA 1WI5A 5FO7B 4JI1L 2HT1A 2SNSA 2FMCA 4FDBA 1N36L 1WYDA 1Y69U 3VR5A 4CJ0B 1LACA 3X3NA 3C1EA 3K7AH 2K6AA 4DV0Q 1D1KA 1BCPC 3I3CA 2MGSA 1GD7A 1HNXQ 1GUGA 4YHHQ 3P75A 2VUMG 1LM0A 4IFDI 2J7ZA 4BY1B 3R8BA 1I4RA 2F52A 3NELA 4JBWA 3DLLA 1KRSA 3HOZH 3CD6A 3E9HA 4DNTB 3K57A 2ZTCA 4A3IB 5M3MH 4LF4Q 1G6ZA 2NVYH 2IW3A 4C3IH 4ODGA 3ER0A 1DYQA 3H94A 4GN3B 5KGUA 3S14H 2F0SA 1VQAA 1HR0W 1STHA 2F3IA 4JOIA 1RF2D 2I46A 3UDIA 1LT3D 1P16A 2CWAA 4JI7L 1XNQL 4YWLA 4A3MH 4N8FA 5EKKA 3CKIB 2F0VA 2RKSA 3VYUA 2B39A 1CI3M 2EXDA 3GD7A 2K5NA 1BVSA 4JI7Q 4CHTB 2WACA 3M9BA 5ELEA 2JE6I 4AH6A 1RODA 1G91A 1B9MA 5A2QE 3J81j 5FLMG 2EY1A 4OWWB 3PIO3 2KHJA 1HUNA 3NSWA 1S4ZA 4YCVA 1YJ9A 2F0OA 4LF8L 4FXDA 5JPMC 4AIMA 3MXUA 5EPJA 3TBIB 2K7VA 1LO5D 5JJZA 2EYPA 3F1ZA 1YZ6A 5COYA 2VQFQ 2NN6I 4A3FH 3VR6A 1CUKA 1KHIA 3STBD 3QR8A 5ELDA 4A3FG 1XNRL 1PYBA 3M4OB 2UXCQ 1OXVA 1VF5C 2HUGA 2K5VA 4A3DG 5M5XH 4TRDA 2PZTA 4OIKA 1QE6A 1Y14B 2FFKB 1XYIA 1I4HA 3K5MA 5EGTA 3I4MB 1RJTA 4J1MA 4QQBX 1FR3A 3NBIA 4DV5L 5IYDG 4NXMQ 4F88A 3NK9A 2RVLA 4Y7NH 2K5HA 1BCPD 4PMWA 2K75A 4YWKA 4IURA 5JEAG 1SNPA 1TWFB 1SFOH 4AQYQ 1B50A 1B3QA 1HNWL 4DV3Q 1U4MA 1KTKA 1N32Q 2KEEA 2AQ3B 2PO4A 1PA6A 1FL0A 1EOTA 1UE1A 4A4IA 4C3IG 3I4MH 4DR6L 1EUJA 4L5QA 5DM63 4XT1B 5CV7A 2B8FA 2WB1E 3LX0A 1HR0Q 4ZKBB 2BDOA 5ELOA 3S15H 4PMBA 2NUCA 1A62A 1VQKA 1SYBA 1FVIA 1LTID 1PTOH 2L11A 3FVQA 3TP7A 1MSGA 5M3MG 5IGGA 3GTLB 4POFA 1N33L 1CK1A 4H44C 4LF7Q 1YBYA 5IYBH 1X3FA 2XNAC 3PO3G 2K4KA 4EQ5A 3BZDB 1QZGA 1IBLL 1OTCA 5T1IA 4A3GH 1SR3A 4E6IA 3KBXA 2O5JC 2XRSD 1B53A 1DM0B 4HJ7A 3BDOA 4LF7L 4JVZA 3CCUA 1NCVA 3J81i 3CQZH 1RHPA 2F0EA 3Q22A 1SAPA 3D6WA 1V9PA 3I7FA 1JOQA 2BH8A 3MXNB 3HOXB 4ZUIA 3D0FA 3U50C 1KNAA 1VQMA 1U4PA 4ME5A 3RLOA 1EY6A 3OIPA 4FF2A 2LXKA 5C3EB 2R7ZB 4JI8Q 3W2DA 1LT5D 1O7YA 2HD3A 4RKBA 5C4ZA 3GTMH 4Y52H 2B3GA 1PHJA 1C48A 3KLSX 1D7QA 2HQEA 4MN3A 1I4GA 2SNMA 3EFXD 1NBWA 1EU3A 3CP0A 4DR2L 3K59A 2ICEC 3CC7A 3T51B 1PFBA 4FYDA 4JBMA 1T5XD 4O2DA 2NB0A 2EOTA 4UY8C 3VYRA 3CCSA 2EPBA 1U4LA 5C4XG 1D1IA 2JN4A 4IUVA 1QUQA 1STBA 5NUCA 2D5DA 2FHTA 1CTMA 4JI3Q 2N55A 2F0WA 5JVH3 3R2IA 1JE4A 4GKKQ 4HSVA 1SDFA 1F2ZA 2D0OA 1F9PA 2IX1A 4RGMA 2Q2TA 1M8AA 3ULPA 1C7YA 2OWOA 4CKEA 4ZAIA 4TQUS 2F4VQ 5J39A 1GOZA 4IFDH 2FINB 4LF9Q 1GO3E 4IJHA 3SGIA 1IBML 3L0OA 3HKZB 2EYMA 2L1BA 4CDCC 3KJOA 4A3IH 1CZWA 4I7ZC 5KYLA 3J7A5 1MKHA 1WD1A 5AJ3Q 2KENA 3I2ZA 4ZQ3A 2A68C 4DF7A 1BBXC 3MXNA 3HOWB 3OWEB 3K0XA 2D62A 1V43A 2MQHA 1F2YA 1X54A 1N34Q 4KKTA 3U9SA 2QEJC 1UNSA 2ZXOA 4HAEA 4DV4L 3QG1A 3CCQA 4NXNL 1A3UA 4P72A 2QW7A 3I55A 1SNDA 1WTOA 1STYA 2PCFB 3SE0A 3MAQA 1TXYA 4X65Q 3CCMA 5FLXL 2B2TC 4DXGA 5J3BA 4GS3A 1NR4A 3PV0A 5EQ0A 4I65A 2BA0A 4DV1L 1LT4D 1I6HB 5E1FA 4RA8A 4GNXA 4A3BH 5JPNC 4C3HG 1EYCA 1EQQA 1VQGA 1UE7A 1Q81C 1H9RA 3GTKB 3RN5A 3A7LA 4WJ4A 1DCZA 3CXCA 4GN5A 1GM5A 3HOVH 2AWNA 4QJFA 4DR1Q 3SHLA 4UHVA 3CCJA 3S2DH 3NQIA 1BBUA 1EQRA 3S1NB 5A2QL 2L15A 4BWGB 3Q0AA 5CMDA 4B3TQ 1S72A 3NTHA 4UP9A 3A5UA 1LTTD 1Y8PB 4FVMA 2EDGA 4RGOS 3NXWA 5IYBG 1J5EQ 1A3TA 1ONLA 3S1RH 2F0KA 3TDQA 4B3TL 3ERQA 3HFZB 3EIVA 3GTKH 3S9WA 1ZYRC 2VW9A 3BYTB 2X69A 5CV9A 4JK1C 2K33A 2XGTA 3PIP3 3OSOA 3AFPA 3HOXG 1PH2A 1JOOA 3OWFA 1FJGQ 1MBYA 2CH4W 5ISRA 1VQ5A 1VMPA 2JQOA 2K5DA 4MTKA 3MC0B 1BDOA 3QWNA 5FLXc 4CDDC 1HFGA 2M2LA 3CCVA 4DV2L 5KNDA 5CBAE 1AN8A 5GAGC 5KNCA 4DV7L 3S24A 1U9RA 3NENA 1DOLA 3AYHB 1XMOL 3TZDA 1Y1WH 4IUTA 5M3FG 3DWQA 2RDHA 4OELB 3FKIG 1B44D 2N49A 4K5VA 1IKMA 5C0XH 3PUZA 3RZOB 3K5LA 1ML0D 1ET9A 1PFSA 4N8X1 4IFDJ 2OXPA 4JI2L 3WWVA 3S2HH 3KBGA 4JBKA 1SNOA 1I3QH 4B3SL 1K8AC 4JI0Q 3I73A 3J81E 4PQXA 5CC4A 1GXDC 4JI2Q 4KY5A 5M5WH 3K8AA 1QUQB 5CYUA 5CV8A 4O42A 3SXHA 3I8ZA 3TREA 1EFWA 4DUZL 1PMRA 5GAEC 3AB9A 3I90A 4K6LA 4HCEA 1PRTF 3GTPB 3BG3A 5BN4A 1PH6A 2QF7A 2PPBC 3A74A 3VYTA 1HNXL 1JB3A 1UEBA 4POGA 1HZCA 4A93B 2WINB 4ZLTF 2GVAA 3MFYA 2VZAA 4JBJA 4CKCA 3T1YQ 3UI2A 4IJLA 1Y1VB 2F0DA 1QB5D 3PUXA 2F03A 4A3LH 1J8IA 1D6EC 1VQHA 4LF4L 1QNUA 1I4XA 4YCUA 3GTPH 2JYOA 5LL6X 4KY6A 4BA1I 1CZGA 3GTMB 4A93H 3FPUB 4V190 3D8GA 3D3RA 3JAME 1YEZA 4DR4L 1RCVD 2ZTDA 1EIYB 3M4YA 2L55A 3HRZC 4LAAA 4G57A 5IY0A 4J6HA 1LT6D 1PZJD 4JV5L 4EX5A 3I4NH 1ICFB 2D2CC 2NBFA 3NEMA 4AYBG 3S1MB 3LWUA 4OEMB 3B6YA 1L0WA 5EKIA 1ET6A 4XQQA 2C5CA 2IJ0A 3EVQA 2J4XA 1S5DD 2JXMB 4QF4A 3N52A 3HOZG 3NUCA 3L3OC 4J8QA 1X3GA 3L9AX 2K04A 4R1JA 3S1QB 1HCZA 4KJOA 1H9JA 4JC0A 2EJFC 3DUZA 4JI4L 3MXPA 3OMGA 3GDEA 1EWHA 4L6TB 1DOKA 1X3QA 1D5XC 1HA5A 2KHSA 4ZKCB 1EU4A 4BBRG 1C8CA 1GUSA 1HPCA 5E4WC 2K52A 1V1PB 3FRPB 4QUCA 1VDZA 1E1TA 3J81L 5HGQA 1DZ1A 1EY9A 2B2WA 1LLRD 2C35B 2XTIA 1TY0A 3V2TA 1FNVA 3HOWH 2N8NA 1PYWD 3ULLA 2JJQA 2V4DA 4HIDA 2R93G 4DR7Q 3RD4A 2AMCB 1TQOA 1BQQT 5JJLA 1TS5A 1J6QA 4KMUC 4HJAA 5JOBA 2A1AA 5CORA 3HOUH 1KQSA 1XPRA 1K8MA 3T1HL 4DV3L 1JJCB 2HDMA 5KYIA 1WTPA 3GO5A 2NVQB 2Q8RE 4GLVB 3AFQA 2JA5H 1EYDA 4HIKA 3PF5A 2AQ1B 1MHWC 3GTGH 3FEWX 1HNZL 4CJ2C 1EWIA 2HCIA 3T1HQ 2H1EA 3RZDH 3KF6A 3OPOA 1R4PB 2CWPA 3NTIA 3FP9A 4DFAA 3GV6A 2M9VA 1JB7A 4GLXA 1ASZA 4A3BB 1Q8IA 3PIPA 4OONA 4BBRH 1RIPA 5G3LF 4XQNA 3PO2H 1TS3A 4YHHL 1X65A 1N33Q 3SEBA 4KJNA 4IO9A 2A8VA 1PH4A 4LF5L 3TRZA 2PQAA 3MHBA 4QIWB 2ZT9C 3FDTA 3S1NH 1JJ2A 4K2LA 3RZDB 1SE3A 2HDLA 3BDCA 1AE2A 4BBSH 4QCLA 2NZ1D 4DK6C 2EE1A 2DJGC 1Q1BA 1YNJC 2B2YA 1IBKQ 1KC8C 4CJ1B 4KN4C 5KEEA 1VQBA 5I2YA 4EVOA 1G6PA 1OXTA 2OTLA 4J15A 2JA6G 1IBKL 4R8IA 1HQRD 4B3MQ 4R4OA 5K36H 2LFNA 5J22A 1GVPA 4GOPB 2ICIA 1NR2A 1V1PA 2PYKA 1PTOC 2L0CA 3ND8A 3PCOB 5C6AA 2NTTA 4C3JG 3HP3A 1JC7A 2DGYA 3D4WA 5I9PA 1WOCA 4ILWA 4LF6L 5E4XA 5C4XH 4A3DH 4PNYA 4JPBW 2N78A 3FHWA 3A5ZB 4BS9A 4CBVA 1OO9B 4DPGA 3WDNA 3J80i 1LTGD 5EBDA 2JEBI 3LGJA 5CBEE 4LF6Q 2A74C 2A6HC 3ZJYC 1R4QB 2L5TA 3F2UA 5I2XA 2XIWA 5I6WA 2BE5D 2PW7A 3NTKA 1I94L 3KF8B 2NVXB 1OXXK 4ABNA 5I4DA 3D4RA 2DJFC 4A3DB 2LSSA 3D6CA 3PO3B 4G7OC 2B2WC 4DUYL 1I94Q 2CVRA 1SE2A 5M3MB 1M90C 1ENFA 2NVYB 1HTPA 4YWMA 1AW7A 4HMIA 1XWEA 1O7IA 4A3MG 2K05A 1VQNA 1K28A 3TP8A 1BF4A 1HA6A 2K32A 4C3JB 5GAHC 3TEHB 1Y1VH 2XSCA 4DAVA 4HJ8A 3FMCA 1STNA 4PV1C 1IHZA 2PMZE 2R3ZA 1IL2A 1LV9A 4A3MB 4DR3Q 2KHIA 2IHEA 2KECA 3I70A 2Z9HA 3ND9A 5LMNQ 4BY7H 5IGFA 3KDFB 3QO2A 3J7AF 1YHQA 2YV5A 3TP6A 5IODA 5K5PA 4OX9Q 2JA6B 1K3BC 3K81C 4OO1I 4DR3L 1N34L 1HR0L 4LMQD 4AYBB 5M5YB 2NZOA 2Z6KA 3P1HA 3GP7A 1CQFA 2NTSA 1TY2A 3EQLC 2OTJA 5IP9G 1SYDA 2ZJPA 3OHXC 4PZ6A 4LUOA 4JG2A 4BY7B 2VQEQ 3OYYA 5IYCH 4ZUJA 2FMMA 4XXEA 3I56A 2A5HA 2JP1A 3MA2B 1B2TA 1HZAA 5G3LD 2HHHL 5KIXA 2AQ2B 1S5FD 4KD4A 3H3VH 1E2WA 3HKSA 5D3IB 4GOPC 3C3LA 2WAQE 2UUAL 2PZWA 5EKLA 1KLUD 2ALYB 2Q8TA 4RKLA 4DR1L 2EYOA 1FD7D 3WOFA 1EIFA 1SMYD 1D5MC 4HR7B 2IL8A 3J81c 4FP5D 1NE3A 4DA2A 5H1SE 1J5EL 4DV6L 3SDZA 1Q86C 2SOBA 4LFAL 1KD1C 2LMCB 1VQCA 4DR5L 3ONAB 3HEJA 2OF1A 1F77A 5DAUA 1DJRD 4UDUC 1O7ZA 2L9HA 1KAAA 1SFOB 1S5CD 2CW0D 4K8JA 1CSPA 4NKLA 4C1NK 3MTSA 4Z9CB 4L5RC 1F9RA 5LHY1 3K6OA 2A6EC 2ZXRA 2E2IB 4A3JG 1L1OC 2PI2A 2R92H 2AHOB 2XWJB 4CKBA 3GV3A 2Y0SG 1GHKA 2TSSA 2I0QA 2GN5A 2K01A 5BR8Q 2ES2A 1JT8A 2UXBL 4K6DA 3M3YH 3A8KE 4GN4B 2EYLA 5DNFA 2N3SA 3VA7A 1ZXTA 4GKKL 1PVOA 4PG3A 1S5ED 2JA5B 3L2PA 3MVVA 5CR3A 3OTOQ 1IYUA 1G291 2QDBA 5IGDA 3GTGB 2UXBQ 3CRKC 2EZVA 4IN3A 2R92B 1EY0A 1NMFA 3SR1A 2B29A 1SYEA 1MJEA 3A8JE 4S3SA 1B7YB 5E7NA 2Z6BA 4JI1Q 3PO2B 2F0UA 1MIUA 2F0GA 4P2CB 1TWCH 1B1ZA 3ERSX 3CCEA 2EYJA 4DV0L 4BBSG 5GQOA 1JWMD 1LTBD 1IBMQ 1M1KC 3T56B 1WTRA 2CH4A 4DUZQ 2WP8J 4GNXB 1JCKB 4DAPA 1I4PA 5AJ3L 1YJNA 3VYSA 3BJUA 3V96A 4X62Q 4M8AA 2KVMA 2JA5G 3TSSA 4LFCQ 4A3LG 1HH2P 5EBCA 1X55A 3OW7A 4GLAC 2Q8IB 4ALPA 3A56A 5JEAJ 1PH5A 3T1YL 4X62L 3OW2A 2EY2A 3CU7A 2V1CC 2YU9H 1YNJD 1IXRA 5LMNW 4ZYSA 3IKJA 2DNCA 2DUDA 4NXNQ 1QILA 4DN4M 3C1FA 3TS2A 5CGKA 1XTDA 1T9HA 2R61A 5JJIA 3A0JA 3CMEA 1LUZA 2TMPA 4RFBA 4DK0A 1MSHA 1BOSA 1KDBA 5IWAL 2QA4A 3JAMc 3TP5A 2WIIB 3ITPA 1ENCA 1UE6A 1AH9A 1EIHA 2JA9A 4A3BG 5IWAQ 1IYJB 2F0HA 3LNNA 4X64Q 3HOZB 4EQPA 4UP8A 3K80C 3MZ5A 1WJJA 4HJ5A 3HOWG 1D5ZC 1E7ZA 2EVBA 3M7NA 1E24A 2ATWA 2NVXH 4B3RQ 3MEHA 1GUWA 4EQNA 4A3KB 1KDCA 2HIVA 2MUYA 3W3AA 4DAMA 4FF3A 2JA8G 1PH9A 1G51A 3F8TA 3J80E 3P7JA 3MFGA 2LS01 4H02A 4K0KL 1JICA 1TWAH 4NMZA 3BVGA 1YHAA 3AQQA 3R93A 4MZ9A 1B8AA 3F2DA 2K5QA 4BXXG 1I5FA 3CF5A 4JI6Q 3HKZE 1PZID 2KBNA 1VQ6A 1Z7TA 4IUUA 4DKAC 4DNRB 2PNHA 1X32A 2E76C 1PH1A 4DV5Q 1UE5A 1YHBA 4L5TA 5C4HA 5I6YA 4NXML 1TKWB 4C2MB 4YCWA 3RN2A 1PH7A 1V1OA 1L0YB 1QG7A 1HQMC 1K83B 1K0RA 1NUCA 2SDFA 4QMGA 2E5LL 2OQ0A 4JI0L 4OL7A 5IGEA 3EA6A 3X3MA 4DK3C 4RGNA 1KLGD 2G5DA 1NNXA 5IYDH 3G6EA 4C3HH 1XX8A 2RF4A 1TR5A 2B63H 1CSQA 2CFMA 1WFQA 5C5LA 1HZ9A 1VQFA 2E5LQ 1GUTA 2PMZB 3E3XA 1SXTA 1MD2D 3S2DB 4JI5L 1OXUA 2VXWA 1WCMG 1BO0A 4ID6A 2R93B 1YNNC 2M00A 1VQJA 1FGUA 1IW7D 1VQ8A 1E1OA 2OEOA 3S16B 4QL5A 3H3VI 5M3FB 2CQOA 1XXGA 1KDAA 4KY7A 1GUNA 4C3HB 1CKNB 4IZ8A 5DEHA 3U9OA 4DAYB 1WTHA 3K0YA 1NY4A 2ENBA 5TSSA 3T53B 1EEFD 2UUCL 4RCNA 2PI2E 3VR2A
chains in the Genus database with same CATH topology
3PUWA 2FJ2A 3WOEA 1PTOF 4HSPA 5IGBA 2K1BA 1FGBD 5D65A 4F7XA 4N9PA 5ELCA 4K8IA 2F0FA 4KI0A 1PRTC 3Q6SA 1TWHB 5C5MA 2SEBD 5C0XG 1PZKD 1MI2A 5M5XB 3RMHA 1G2TA 3V05A 1H9MA 4U673 1VF7A 1PRTB 1AFPA 3H3VC 3IAYA 3IFDA 4Y7NB 3T4AC 1ICWA 3CQZB 2MPMA 3HG9A 4HN7A 2K03A 2KUMA 3N6RA 3H91A 4X3SA 2F1MA 4RGTA 2Z1CA 3TMEA 1KABA 1OXSC 3NBHA 5JVG3 3HGBA 1TS2A 3FPPA 1PTOB 1CHPD 1I4QA 3NWTA 3GTOB 2WV6D 1YNND 4KK7A 1UUPA 1V8QA 1UAPA 2RDGA 4HTHA 1ESFA 3E6ZX 3RLFA 2EJGC 4XDXA 2F0JA 4DXFA 2MP1A 4UAIA 3J80L 3GTJB 2Z8LA 3A54A 1RD9D 1EEID 4MHEA 4DGZA 4KHVA 2RQXA 2B2YC 1PRTD 1STEA 4KD3A 3AU7A 4L63B 1ILPA 3CRLC 5ELBA 5FO8B 3H0GB 4XT3B 1H9KA 2E75C 1JR0D 3ZYYX 2Z4HA 1EY4A 1AEXA 1AZQA 3SK4A 3GTQB 1T5EA 2R6GA 4DK1A 5FKAC 1MGSA 4IUQA 1Q12A 2GA4B 4B9WA 4Q5VA 4HCSA 2B2VA 4KTAA 3IL8A 2XRQD 3IFTA 1E2VA 3KLSA 1SNMA 1TWAB 5IT9E 4C3IB 1Y8NB 4WORA 1WTVA 4G7HC 4WFN3 3QJYA 2L4NA 3VA5A 4EGVA 4K5XA 2JEAI 1M4VA 4HEDA 1FNUA 3MXGA 5A35A 1EY5A 3E5SA 3HOUB 1DOMA 4ULLA 3C2PA 3L7ZC 2B2VC 4IUNA 3LWEA 1H9SB 4B08A 4K5WA 4KN7C 2NWGA 3K5NA 2IX3A 2RA4A 3E0JA 4RCOA 3H09A 3I91A 2Y0SB 1Q3LA 2DY7A 3S1RB 4FO2A 4A3JB 1A15A 2G9HD 1TWGB 3BVMA 1Q90A 2PW5A 4KKUA 3M85A 1F9QA 2A68D 1IKLA 3QIAA 2OT2A 2J0TD 2E74C 2KJXA 2O2LD 1JQYD 3DHQA 1EIGA 5FOBB 5IGCA 2RDFA 1IW7C 2C9OA 3HOVB 3Q23A 3NWSA 4FXGC 3C46A 2NYZD 1Z47A 5FK9C 3J7AV 1CQVA 4WJWA 4RHRA 1I3QB 2DNEA 4MIUA 2F0IA 4M1UB 2F3VA 2F0MA 5D14A 3NHHA 1QNKA 1ESRA 4R8NA 2Z4IA 5JEAH 4R9WA 1WTWA 2A73B 4EQOA 1BCPF 1SJED 4U68A 1L0XB 5T1GA 1S5BD 3I72A 3SK6A 2KOLA 1WTXA 4F87A 3KUPA 4FF4A 1H9SA 2VUMB 1SJHD 5F2DA 3O13A 3OIQA 4RWSC 1Y1WB 4IQZA 3QB3A 3TN2A 2F0NA 3KF8A 4A3GB 2A69D 1SYGA 4WRDA 1CFMA 1TS4A 1AZPA 2NN6H 2X6LA 1HFNA 2D9UA 5M9OA 2KQ3A 1W6KA 5M5WB 1CT1D 2ID0A 4O1NA 4OGQC 2MJ8A 1GJXA 4KKSA 2B2UA 5IIFA 2O5IC 1G8ZD 1LTAD 2NN6G 1EQTA 1X3PA 5EPLA 3URYA 1HXYD 2F3WA 4GZYC 3I4LA 1SE4A 3HS0C 2BOSA 3CHBD 3H6MA 4ZRZA 2DY8A 1DD2A 1RTOA 1BCPB 1QJOA 4H0LC 2HCCA 1BUVT 1CA6A 1WCMB 1RTNA 1IYVA 3J7YW 1EZ6A 2IT1A 1DXMA 2NVTB 1WD0A 1HRJA 1EY7A 1QWYA 3D4DA 1WVLA 1B9NA 3KLRA 1QCBD 4PMCA 3KK7A 5FO9B 4XYQA 4LJZC 2E2HB 1C4QA 1PXUA 2JA7B 5CV6A 3EROA 1NAPA 1BXTA 1PDQA 3DM1A 3QOLA 4QUFA 4OIJA 2AWOA 4NW2A 3BVZA 3K58A 3EJIA 1PTOD 3BS1A 2IPKD 1F2MA 1VCIA 1LTRD 3BYYB 3TZUA 5C3WA 2RBMA 1E2ZA 1II3A 2ZXPA 3HZXA 3AMUA 1HTLD 4BA2I 2WKDA 1HHVA 4N9TA 1RKNA 1CHQD 1PFNA 2EJMA 4IALA 4XYOA 1SNCA 2G9DA 2BE5C 3OMCA 4RH6A 3JAML 2XWBB 3M3YB 2K28A 3R2TA 1B3AA 1ILQA 2MHVA 5BN5A 4K14A 4FNFA 1LTSD 1NSNS 3RUZA 4X3UA 1DONA 4C56C 1A2UA 3NP8A 2KCCA 1W6JA 2WKCA 4QB4A 1QOHA 4RHSA 1Y8OB 5HURA 2VNUD 1D2BA 4IUPA 2F0PA 2H4OA 1I6VC 2WAQB 4HMJA 2EY6A 1KNEA 5FLXE 2EXZA 4X3TA 3PUYA 3DXJC 4BBRB 1TVXA 2JSOA 2XN9C 5ELFA 5D3DA 1O80A 5CV4A 1EWCA 4X3KA 1PFMA 3HOYB 3NE5B 5HGTA 5C0XI 1E0BA 4BBSB 3S17B 2K5WA 2BA1A 3DEPA 2KCNA 4YIJA 3SK5A 4A3EB 4KV6A 5C3XA 2F0QA 1SNQA 4KHZA 5J1ZA 5C4JB 1FYCA 1A2TA 2QCPX 3S2HB 1SMYC 2WB1B 2B2UC 2X6GA 2QILA 1XTCD 1A6XA 4XTCS 2F0TA 1AP0A 2N88A 3DWAA 4LK1C 3MWYW 2XVSA 1TIID 3NQTA 1RDPD 5AFWA 1R9TB 2B2TA 5BN3A 4H7BA 2EY5A 5KRUA 3S14B 4OO1H 2YYZA 3G7LA 1EYAA 1JWUD 3T16A 1G2SA 1IL8A 5C44B 2IX0A 1SEBD 2PNRC 1GUOA 1Z6HA 1EZ8A 1SBBB 5I9OA 1CA5A 1F2LA 1LABA 5LL6S 3K5OA 2CW0C 1STAA 3I4NB 4OHJA 2B63B 3BDLA 3FKIB 4Q0FA 2CHBD 4DU9A 2RSNA 1SSOA 4C1NI 3A55A 4CGYB 3M7GA 1A3VA 2BCOA 4A3FB 2LKVA 3PUVA 3D31A 3SVMA 2A6HD 3OOCA 4G4KA 1VMCA 4TKOB 5EPKA 2F4IA 4OO1G 1EQVA 3DEOA 1GHJA 3VR3A 2E2DC 2IWHA 3PMFA 4DAYA 5E3FA 5IT9L 5EJWA 4NP5A 4RAUC 3DMUA 5JAVA 4FXKC 1EY8A 2VB3X 1WTQA 2DN8A 1FNWA 3R3OA 4B9XA 1JWSD 4XIGS 1ZEQX 4L8JA 4TSSA 4ZK9B 1CM9A 2BDNA 1TT2A 2PQEA 4H13C 5KNBA 3S15B 1PLFA 5IOCA 3GQBA 1TWCB 2JA8B 2KA7A 4IFDG 1K8OA 3NPPA 5K36G 3A7AB 1F9SA 2E2JB 5DM73 2AUKA 3DWPA 2QKIC 3SK8A 1JORA 2A69C 1ZKOA 1B4OA 2EYFA 3P20A 1ENAA 2LY7A 1Q1EA 2O4XA 2KEDA 2VB2X 3Q24A 2PZUA 1ZYRD 1U4RA 1EL0A 2A6ED 1O78A 4G7ZC 1TU2B 1STGA 3A8IE 5CV5A 3QOJA 1UEAB 2L12A 5C0XJ 4NDXA 2CQAA 2EYHA 2B8GA 2AUJD 4FF1A 4F8MA 2F0LA 3T13A 1BR9A 1SYFA 1I50B 4XQJA 1O7LA 1J9OA 1BNZA 1SYCA 2RSOA 3K7AB 2I07B 4V0BA 1EFID 2YU9B 3G6JB 3VR4A 5C4XB 4K2KA 1JOKA 1HUMA 5FO7B 2SNSA 2FMCA 1Y69U 3VR5A 4CJ0B 1LACA 3X3NA 3C1EA 2K6AA 1D1KA 1BCPC 3I3CA 2MGSA 1GUGA 3P75A 4IFDI 2J7ZA 4BY1B 3R8BA 1I4RA 4JBWA 4DNTB 3K57A 4A3IB 1G6ZA 2IW3A 4ODGA 1DYQA 3H94A 5KGUA 2F0SA 1STHA 1RF2D 2I46A 1LT3D 5EKKA 3CKIB 2F0VA 2RKSA 3VYUA 2B39A 1CI3M 3GD7A 4CHTB 2WACA 5ELEA 2JE6I 1G91A 1RODA 1B9MA 5A2QE 2EY1A 3PIO3 1HUNA 3NSWA 1S4ZA 2F0OA 4FXDA 5JPMC 3MXUA 5EPJA 3TBIB 2K7VA 1LO5D 5JJZA 2EYPA 5COYA 2NN6I 3VR6A 5ELDA 3M4OB 1OXVA 1VF5C 2HUGA 4TRDA 2PZTA 1QE6A 2FFKB 4OIKA 1XYIA 1I4HA 3K5MA 5EGTA 3I4MB 1RJTA 4J1MA 1FR3A 3NBIA 4F88A 3NK9A 2RVLA 1BCPD 4PMWA 4IURA 5JEAG 1SNPA 1TWFB 1B50A 1U4MA 1KTKA 2KEEA 2AQ3B 2PO4A 1EOTA 4C3IG 5DM63 4XT1B 5CV7A 2B8FA 3LX0A 4ZKBB 2BDOA 4PMBA 2NUCA 1SYBA 1LTID 1PTOH 3FVQA 2L11A 3TP7A 1MSGA 3GTLB 5IGGA 1CK1A 4H44C 2XNAC 3BZDB 5T1IA 4E6IA 3KBXA 2O5JC 2XRSD 1B53A 1DM0B 3BDOA 1NCVA 1RHPA 2F0EA 3Q22A 1SAPA 3D6WA 1JOQA 3HOXB 4ZUIA 1KNAA 1U4PA 4ME5A 1EY6A 3OIPA 4FF2A 5C3EB 2R7ZB 3W2DA 1LT5D 1O7YA 4RKBA 5C4ZA 1C48A 3KLSX 2HQEA 4MN3A 1I4GA 2SNMA 3EFXD 1EU3A 3K59A 2ICEC 3T51B 1PFBA 4FYDA 1T5XD 2NB0A 2EOTA 3VYRA 2EPBA 1U4LA 1D1IA 4IUVA 1STBA 5NUCA 2D5DA 2FHTA 1CTMA 2N55A 2F0WA 5JVH3 3R2IA 1JE4A 4HSVA 1SDFA 1F2ZA 1F9PA 2IX1A 4RGMA 1M8AA 4CKEA 4ZAIA 4TQUS 5J39A 1GOZA 4IFDH 2FINB 3HKZB 2EYMA 2L1BA 1CZWA 4I7ZC 5KYLA 1WD1A 4ZQ3A 2A68C 4DF7A 1BBXC 3MXNA 3HOWB 3OWEB 2D62A 1V43A 1F2YA 4KKTA 3U9SA 2QEJC 1UNSA 2ZXOA 4HAEA 3QG1A 1A3UA 1WTOA 1SNDA 1STYA 2PCFB 3SE0A 3MAQA 5FLXL 2B2TC 4DXGA 1NR4A 3PV0A 5EQ0A 4I65A 2BA0A 1LT4D 1I6HB 5E1FA 4RA8A 5JPNC 4C3HG 1EYCA 1H9RA 3GTKB 3A7LA 1DCZA 2AWNA 3SHLA 3NQIA 3S1NB 5A2QL 4BWGB 3Q0AA 5CMDA 3NTHA 1LTTD 1Y8PB 4FVMA 2EDGA 4RGOS 3NXWA 1A3TA 1ONLA 2F0KA 3TDQA 3ERQA 3S9WA 1ZYRC 3BYTB 2X69A 5CV9A 4JK1C 2K33A 3PIP3 3OSOA 1JOOA 3OWFA 1MBYA 5ISRA 1VMPA 2K5DA 3MC0B 1BDOA 3QWNA 1HFGA 2M2LA 5KNDA 5CBAE 1AN8A 5KNCA 1U9RA 1DOLA 3TZDA 4IUTA 3DWQA 2RDHA 1IKMA 1B44D 4K5VA 5C0XH 3PUZA 3RZOB 3K5LA 1ML0D 1ET9A 4IFDJ 2OXPA 3KBGA 1SNOA 3I73A 3J81E 4PQXA 5CC4A 1GXDC 4KY5A 5CYUA 5CV8A 4O42A 3SXHA 3I8ZA 1PMRA 3AB9A 3I90A 4K6LA 4HCEA 1PRTF 3GTPB 3BG3A 5BN4A 2QF7A 2PPBC 3VYTA 1JB3A 4A93B 2WINB 4ZLTF 3MFYA 4CKCA 3UI2A 1Y1VB 2F0DA 1QB5D 3PUXA 2F03A 1J8IA 1D6EC 1QNUA 1I4XA 2JYOA 5LL6X 4KY6A 4BA1I 1CZGA 3GTMB 3FPUB 4V190 3D8GA 3D3RA 3JAME 1RCVD 3M4YA 2L55A 3HRZC 4LAAA 4G57A 4J6HA 1LT6D 1PZJD 2D2CC 2NBFA 3S1MB 3LWUA 5EKIA 1ET6A 4XQQA 2C5CA 2IJ0A 3EVQA 2J4XA 1S5DD 2JXMB 4QF4A 3N52A 3NUCA 3L3OC 4J8QA 3L9AX 2K04A 3S1QB 1HCZA 4KJOA 1H9JA 2EJFC 3DUZA 3MXPA 3OMGA 1EWHA 4L6TB 1DOKA 1X3QA 1D5XC 1HA5A 2KHSA 4ZKCB 1EU4A 1C8CA 1GUSA 1HPCA 5E4WC 1V1PB 3FRPB 4QUCA 1VDZA 3J81L 1DZ1A 1EY9A 2B2WA 1LLRD 1TY0A 3V2TA 1FNVA 1PYWD 2V4DA 3RD4A 1TQOA 1BQQT 1TS5A 4KMUC 5JOBA 5CORA 1K8MA 2HDMA 5KYIA 1WTPA 3GO5A 2NVQB 2Q8RE 1EYDA 2AQ1B 3FEWX 4CJ2C 2HCIA 2H1EA 3OPOA 1R4PB 3NTIA 4DFAA 3GV6A 2M9VA 4A3BB 1Q8IA 5G3LF 4XQNA 1TS3A 3SEBA 4KJNA 3MHBA 4QIWB 2ZT9C 3FDTA 4K2LA 3RZDB 1SE3A 2HDLA 3BDCA 4QCLA 2NZ1D 2EE1A 1Q1BA 1YNJC 2B2YA 4CJ1B 4KN4C 5KEEA 5I2YA 4EVOA 1OXTA 4R8IA 1HQRD 5K36H 2LFNA 5J22A 2ICIA 1NR2A 1V1PA 2PYKA 1PTOC 2L0CA 3ND8A 5C6AA 2NTTA 4C3JG 3HP3A 1JC7A 3D4WA 5I9PA 4ILWA 5E4XA 4PNYA 4BS9A 4CBVA 1OO9B 3WDNA 1LTGD 5EBDA 2JEBI 5CBEE 2A74C 2A6HC 1R4QB 2L5TA 3F2UA 5I2XA 2XIWA 5I6WA 2BE5D 2PW7A 3NTKA 2NVXB 1OXXK 4ABNA 5I4DA 3D4RA 4A3DB 3D6CA 3PO3B 4G7OC 2B2WC 2CVRA 1SE2A 5M3MB 1ENFA 2NVYB 1HTPA 1AW7A 4HMIA 1XWEA 2K05A 3TP8A 1BF4A 1HA6A 2K32A 4C3JB 2XSCA 4DAVA 3FMCA 1STNA 4PV1C 1IHZA 2R3ZA 1LV9A 4A3MB 2KECA 3I70A 3ND9A 5IGFA 3QO2A 3J7AF 3TP6A 5IODA 5K5PA 2JA6B 4OO1I 4LMQD 4AYBB 5M5YB 3P1HA 3GP7A 1CQFA 2NTSA 1TY2A 3EQLC 1SYDA 3OHXC 4BY7B 4ZUJA 2FMMA 4XXEA 2A5HA 2JP1A 3MA2B 1B2TA 5G3LD 5KIXA 2AQ2B 1S5FD 4KD4A 1E2WA 5D3IB 3C3LA 2PZWA 5EKLA 1KLUD 2Q8TA 4RKLA 2EYOA 1FD7D 3WOFA 1SMYD 1D5MC 4HR7B 2IL8A 4FP5D 4DA2A 3SDZA 2SOBA 2LMCB 3ONAB 3HEJA 2OF1A 1F77A 5DAUA 1DJRD 4UDUC 1O7ZA 2L9HA 1KAAA 1SFOB 1S5CD 2CW0D 4K8JA 4NKLA 4C1NK 3MTSA 4Z9CB 1F9RA 5LHY1 3K6OA 2A6EC 2ZXRA 2E2IB 2XWJB 4CKBA 3GV3A 1GHKA 2TSSA 2K01A 4K6DA 3A8KE 2EYLA 5DNFA 3VA7A 1ZXTA 2JA5B 1S5ED 3MVVA 5CR3A 1IYUA 1G291 2QDBA 5IGDA 3GTGB 3CRKC 2EZVA 4IN3A 2R92B 1EY0A 3SR1A 1SYEA 3A8JE 4S3SA 3PO2B 2F0UA 2F0GA 4P2CB 1B1ZA 2EYJA 1JWMD 1LTBD 3T56B 1WTRA 2WP8J 1JCKB 4DAPA 1I4PA 3VYSA 3V96A 4M8AA 2KVMA 3TSSA 5EBCA 3OW7A 2Q8IB 3A56A 5JEAJ 2EY2A 3CU7A 1YNJD 4ZYSA 3IKJA 2DNCA 1QILA 4DN4M 3C1FA 5CGKA 2R61A 2TMPA 4RFBA 4DK0A 1MSHA 1BOSA 1KDBA 3TP5A 2WIIB 3ITPA 1ENCA 1EIHA 2F0HA 3LNNA 3HOZB 4EQPA 3MZ5A 1D5ZC 2EVBA 3M7NA 3MEHA 1GUWA 4EQNA 4A3KB 1KDCA 2MUYA 3W3AA 4FF3A 3J80E 3P7JA 3MFGA 2LS01 1JICA 4NMZA 3BVGA 3R93A 2K5QA 1PZID 1Z7TA 4IUUA 4DNRB 1X32A 2E76C 5C4HA 5I6YA 1TKWB 4C2MB 1V1OA 1L0YB 1QG7A 1HQMC 1K83B 1NUCA 2SDFA 4QMGA 4OL7A 5IGEA 3EA6A 3X3MA 4RGNA 1KLGD 1XX8A 1TR5A 5C5LA 1GUTA 2PMZB 1SXTA 1MD2D 3S2DB 1OXUA 2VXWA 1BO0A 4ID6A 2R93B 1YNNC 2M00A 1IW7D 2OEOA 3S16B 5M3FB 1XXGA 1KDAA 4KY7A 1GUNA 4C3HB 4IZ8A 5DEHA 3U9OA 3K0YA 5TSSA 3T53B 2ENBA 1EEFD 4RCNA 3VR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHV A;  2NB0 A;  2NBF A;  2KCN A;  1AFP A; 
#chains in the Genus database with same CATH topology
 3PUW A;  2FJ2 A;  3WOE A;  1PTO F;  4HSP A;  5IGB A;  2K1B A;  1FGB D;  5D65 A;  4F7X A;  4N9P A;  5ELC A;  4K8I A;  2F0F A;  4KI0 A;  1PRT C;  3Q6S A;  1TWH B;  5C5M A;  2SEB D;  5C0X G;  1PZK D;  1MI2 A;  5M5X B;  1VQO A;  1L2F A;  4R4C A;  3RMH A;  1G2T A;  3V05 A;  2H5X A;  1H9M A;  4A3G G;  2RHS B;  4U67 3;  1VF7 A;  1PRT B;  1LTL A;  1AFP A;  1QVC A;  1YIT A;  3H3V C;  3IAY A;  3IFD A;  4Y7N B;  1SN8 A;  4CDE C;  3T4A C;  1ICW A;  3CQZ B;  2MPM A;  3HG9 A;  1TWF H;  4IOC A;  4HN7 A;  2K03 A;  2KUM A;  3N6R A;  2VUM H;  1C0A A;  3STB C;  1IZ6 A;  3GTO H;  3H91 A;  1CKM A;  1BKB A;  4X3S A;  2F1M A;  4RGT A;  2Z1C A;  3TME A;  3HOX H;  3RR5 A;  5GAD C;  1KAB A;  4LUZ A;  1H95 A;  1XNR Q;  4LNQ A;  2E2J H;  3I4M G;  1OXS C;  2UXC L;  3NBH A;  2IY5 B;  5JVG 3;  1XMQ L;  3HGB A;  1TS2 A;  3FPP A;  1PTO B;  1CHP D;  1I4Q A;  3NWT A;  3GTL H;  3GTO B;  2WV6 D;  1YNN D;  4KK7 A;  2WAQ G;  1UUP A;  1V8Q A;  1UAP A;  2RDG A;  4HTH A;  3KJP A;  1ESF A;  4A93 G;  3E6Z X;  3RLF A;  1KXL A;  4A3E G;  2EJG C;  4XDX A;  2F0J A;  3J80 c;  4DXF A;  2MP1 A;  1N32 L;  2WFW A;  4UAI A;  3J80 L;  3GTJ B;  2Z8L A;  3A54 A;  1RD9 D;  1EEI D;  4DR6 Q;  4MHE A;  4DGZ A;  4KHV A;  5IP7 H;  2RQX A;  1WCM H;  5C3E G;  2B2Y C;  1XJV A;  1SMX A;  1PRT D;  2D0P A;  1STE A;  4OWT B;  3EN2 A;  4KD3 A;  3GTQ H;  3AU7 A;  4L63 B;  1ILP A;  4IPG A;  4R4T A;  3CRL C;  5ELB A;  4DV4 Q;  5FO8 B;  3CC4 A;  3H0G B;  4IOA A;  3CPW A;  3GTJ H;  4XT3 B;  3W1G A;  1RL2 A;  1X6O A;  1H9K A;  4QIW E;  1IBL Q;  2E75 C;  1JR0 D;  3ZYY X;  2Z4H A;  1EY4 A;  3S1Q H;  4LF5 Q;  1AEX A;  1QZH A;  1JE5 A;  1AZQ A;  3SK4 A;  2UU9 L;  3GTQ B;  4LW1 A;  1T5E A;  4LFB L;  2R6G A;  4AYB E;  4GNX C;  4DK1 A;  4UPA A;  1X56 A;  5FKA C;  3H0G G;  1MGS A;  3F2B A;  1B70 B;  4IUQ A;  4JYA Q;  4A3I G;  1Q12 A;  1U5K A;  2GA4 B;  4B9W A;  1A63 A;  4Q5V A;  5LMU L;  4HCS A;  2B2V A;  2KCT A;  4KTA A;  3IL8 A;  2XRQ D;  3IFT A;  3VDY A;  4JYA L;  2LXJ A;  2HIX A;  1E2V A;  3KLS A;  1SNM A;  1TWA B;  5IT9 E;  4C3I B;  1Y8N B;  4WOR A;  1WTV A;  4G7H C;  3DM3 A;  4WFN 3;  2HQL A;  3QJY A;  2L4N A;  3VA5 A;  4EGV A;  4K5X A;  2JEA I;  1M4V A;  2CCZ A;  3PO2 G;  4HED A;  4HIM A;  4DR5 Q;  1FNU A;  3MXG A;  2RHQ B;  5A35 A;  1EY5 A;  3E5S A;  3HOU B;  2R92 G;  2UUB L;  1DOM A;  4A3J H;  4ULL A;  3C2P A;  3L7Z C;  4P71 A;  3UDF A;  2B2V C;  4IUN A;  3LWE A;  1H9S B;  4B08 A;  4K5W A;  4KN7 C;  2NWG A;  4YY3 Q;  1ASY A;  3CPF A;  3W5O A;  3K5N A;  1K83 H;  2IX3 A;  4LUV A;  2RA4 A;  3E0J A;  4RCO A;  3CCR A;  3H09 A;  3I91 A;  1SE8 A;  2Y0S B;  1Q3L A;  3I4O A;  2DY7 A;  4O0A A;  4YY3 L;  2UXD L;  3S1R B;  3PQI A;  4JOI C;  4FO2 A;  2QGQ A;  4A3J B;  1A15 A;  4RMF A;  2EQS A;  1TWG B;  2G9H D;  3OTO L;  3BVM A;  4DUY Q;  1Q90 A;  2UXD Q;  2PW5 A;  4KKU A;  3M85 A;  1L1O A;  4A75 A;  2R93 H;  2PQA B;  1F9Q A;  1YIJ A;  2A68 D;  3RLN A;  1IKL A;  3QIA A;  3S16 H;  2OT2 A;  2J0T D;  5M3F H;  2E74 C;  1UWV A;  3U58 A;  2KJX A;  2O2L D;  1NTG A;  1JQY D;  3DHQ A;  5JJK A;  1EIG A;  1DGS A;  5FOB B;  3G4S A;  5IGC A;  1K8G A;  3G48 A;  2RDF A;  1IW7 C;  2C9O A;  1TWG H;  3HOV B;  3Q23 A;  5IP9 H;  3HOY H;  3E9I A;  3M4Q A;  3ICE A;  3NWS A;  4FXG C;  5LMN L;  2I5L X;  2MO0 A;  3C46 A;  2NYZ D;  1Z47 A;  3RZO H;  5IT9 c;  5FK9 C;  4PZ8 A;  3IRB A;  4LFC L;  3CC2 A;  3J7A V;  1CQV A;  1K73 C;  4WJW A;  4RHR A;  1I3Q B;  1W2B A;  1L1O B;  2DNE A;  2YTX A;  4MIU A;  1SRO A;  2QEX A;  2F0I A;  3PIO A;  4M1U B;  2F3V A;  3I4N G;  3KFU A;  1Z9F A;  4X65 L;  1XNQ Q;  2F0M A;  5D14 A;  3NHH A;  1QNK A;  1ESR A;  4R8N A;  4DR4 Q;  1VQL A;  2Z4I A;  4RG1 A;  5JEA H;  4R9W A;  2VQE L;  1WTW A;  2A73 B;  4EQO A;  2NZH A;  1BCP F;  1SJE D;  4U68 A;  1L0X B;  5T1G A;  1S5B D;  4JV5 Q;  3I72 A;  3SK6 A;  2KOL A;  3H15 A;  1WTX A;  2HHH Q;  4F87 A;  4A3C G;  3KUP A;  4FF4 A;  5FJ8 G;  1H9S A;  2VUM B;  4R4Q A;  1SJH D;  5F2D A;  3O13 A;  3OIQ A;  1XPO A;  4RWS C;  3TQY A;  1Y1W B;  4IQZ A;  3QB3 A;  3TN2 A;  2F0N A;  1VS0 A;  3W1B A;  3KF8 A;  4A3G B;  4LF8 Q;  2A69 D;  1SYG A;  2OCE A;  4WRD A;  1CFM A;  1TS4 A;  2VQF L;  1AZP A;  2NN6 H;  2X6L A;  4KLK A;  4DV6 Q;  1PH8 A;  1HFN A;  2D9U A;  4B3R L;  3F2C A;  5FLM H;  5M9O A;  2KQ3 A;  1W6K A;  4C3J H;  5M5W B;  1CT1 D;  1NMG A;  2ID0 A;  2QDL A;  4O1N A;  4OGQ C;  2MJ8 A;  1GJX A;  4HIO A;  4KKS A;  2B2U A;  5IIF A;  3TS0 A;  2O5I C;  1G8Z D;  1LTA D;  2K50 A;  2NN6 G;  1EQT A;  1X3P A;  5EPL A;  4P74 A;  3URY A;  4DV2 Q;  1HXY D;  2F3W A;  3S1M H;  3PF4 A;  1VQ4 A;  5IE8 A;  4GZY C;  1HZB A;  3I4L A;  2R7Z H;  1SE4 A;  3HS0 C;  4GOP A;  2BOS A;  3CHB D;  3H6M A;  4APV A;  4ZRZ A;  2JA6 H;  2DY8 A;  1DD2 A;  1RTO A;  1BCP B;  1QJO A;  1YVC A;  4A3C H;  4H0L C;  1VQ9 A;  1HNW Q;  2HCC A;  1BUV T;  4OWX B;  1CA6 A;  2E2H H;  4DR7 L;  1WCM B;  2ZM6 Q;  2JA7 H;  1RTN A;  4NPS A;  2JK8 A;  5IYC G;  3FKI H;  1IYV A;  3J7Y W;  1EZ6 A;  1YNX A;  2FXQ A;  2IT1 A;  1PYS B;  1DXM A;  3CW2 C;  1N36 Q;  2NVT B;  1WD0 A;  1HRJ A;  2ZM6 L;  1EY7 A;  1QWY A;  3D4D A;  3K7U C;  3H0G H;  1WVL A;  1B9N A;  3KLR A;  1QCB D;  4PMC A;  3KK7 A;  5FO9 B;  4IPC A;  4XYQ A;  4LJZ C;  2E2H B;  1C4Q A;  5EAY A;  5C44 G;  1PXU A;  2JA7 B;  5CV6 A;  3ERO A;  1NAP A;  1V1Q A;  4MTN A;  1BXT A;  2BH2 A;  5ELN A;  1PDQ A;  3DM1 A;  4X6A H;  2Q2H A;  2NVT H;  3QOL A;  4QUF A;  3J7Z C;  4OIJ A;  2AWO A;  1PV4 A;  4NW2 A;  3BVZ A;  2Q2U A;  3K58 A;  1NJI C;  1QVF A;  3EJI A;  1CKO A;  1PTO D;  3BS1 A;  2IPK D;  1F2M A;  1VCI A;  1LTR D;  3BYY B;  3TZU A;  5C3W A;  4QY7 A;  2RBM A;  1LYL A;  2UUC Q;  1E2Z A;  1II3 A;  2CKZ B;  2ZXP A;  1XPU A;  2NVQ H;  3HZX A;  3AMU A;  1K0S A;  1HTL D;  4A3K G;  2WKD A;  4BA2 I;  1HHV A;  4N9T A;  1RKN A;  4R4I A;  1CHQ D;  1PFN A;  2WB1 G;  2YTY A;  2EJM A;  4IAL A;  1U0L A;  4XYO A;  1SNC A;  4P75 A;  2G9D A;  4P73 A;  2E8G A;  2BE5 C;  3OMC A;  4BY1 G;  4RH6 A;  2Z6K C;  3JAM L;  2XWB B;  3M3Y B;  2K28 A;  3R2T A;  1B3A A;  1ILQ A;  2MHV A;  5BN5 A;  4K14 A;  4FNF A;  1LTS D;  1EOV A;  1KL9 A;  1NSN S;  3RUZ A;  4X3U A;  1DON A;  4C56 C;  1E22 A;  1A2U A;  3NP8 A;  1KAW A;  3JAM i;  3M4P A;  2KCC A;  3HKZ G;  1W6J A;  2WKC A;  1I6H H;  3CAM A;  4QB4 A;  1QOH A;  4RHS A;  1Y8O B;  5HUR A;  2VNU D;  1D2B A;  3JC6 6;  4IUP A;  4WJ3 M;  2F0P A;  2H4O A;  4JW0 A;  1I6V C;  2WAQ B;  4HMJ A;  2EY6 A;  1KNE A;  5FLX E;  2EXZ A;  4X3T A;  2Q2I A;  3PUY A;  4JCV E;  3DXJ C;  4BBR B;  4JI6 L;  1TVX A;  2JSO A;  2XN9 C;  2KCM A;  5D3D A;  5ELF A;  1O80 A;  5CV4 A;  1EWC A;  4X3K A;  1PFM A;  1CKN A;  4AQY L;  3HOY B;  3NE5 B;  5HGT A;  4BXX H;  2RCN A;  5C0X I;  1E0B A;  4L5S A;  4BBS B;  3S17 B;  2K5W A;  2ZJR A;  2BA1 A;  3DEP A;  2KCN A;  1JMC A;  1S3O A;  4I7A A;  4MNO A;  4YIJ A;  1N8R C;  3UDG A;  3Q8D A;  3SK5 A;  3BZK A;  4A3E B;  1HNZ Q;  4KV6 A;  4OX9 L;  5C3X A;  2F0Q A;  1SNQ A;  4KHZ A;  2R7Z G;  5J1Z A;  5C4J B;  1Q8K A;  1FYC A;  1BBW A;  1A2T A;  3S17 H;  2QCP X;  1GKH A;  4JI5 Q;  3S2H B;  1SMY C;  1R9T H;  2WB1 B;  1P8L A;  3U4V A;  2B2U C;  2X6G A;  2QIL A;  3UDX A;  1XTC D;  2B63 G;  1A6X A;  4XTC S;  5IP7 G;  2F0T A;  1AP0 A;  2N88 A;  3DWA A;  3KOJ A;  4LK1 C;  4BY1 H;  3MWY W;  2XVS A;  4A3K H;  1TII D;  1VQD A;  3NQT A;  1RDP D;  1Q7Y C;  2OQK A;  2VS1 A;  1JJG A;  5AFW A;  1R9T B;  1D8L A;  2B2T A;  2UUA Q;  5DLQ E;  5BN3 A;  4H7B A;  2EY5 A;  5KRU A;  3S14 B;  1YJW A;  4OO1 H;  2YYZ A;  3G7L A;  3U4Z A;  4JI8 L;  1VQP A;  1EYA A;  1JWU D;  3T16 A;  1G2S A;  2MNA A;  4B3M L;  2ZTE A;  1Q82 C;  2ZJQ A;  1IL8 A;  3PO3 H;  5C44 B;  2IX0 A;  1Y1W G;  1SEB D;  2PNR C;  3NBH B;  1GUO A;  4DR2 Q;  1Z6H A;  1EZ8 A;  1FJG L;  4C2M H;  1SBB B;  5I9O A;  2AKW B;  1Q46 A;  2MFI A;  2I5M X;  1CA5 A;  3HOY G;  1F2L A;  3MEF A;  1LAB A;  4DV7 Q;  4JI3 L;  5LL6 S;  5C44 H;  3K5O A;  1XMO Q;  2CW0 C;  1STA A;  5L37 A;  4CDF C;  3I4N B;  4OHJ A;  2B63 B;  1VQ7 A;  1K9M C;  3BDL A;  3FKI B;  4BY7 G;  4NB3 A;  4Q0F A;  2CHB D;  4DU9 A;  2RSN A;  1SSO A;  3BU2 A;  2VY3 A;  3KF6 B;  1Y1V G;  4C1N I;  1A8V A;  3A55 A;  5M5Y H;  4CGY B;  3KDF A;  1XMQ Q;  3M7G A;  1A3V A;  2BCO A;  4A3F B;  2LKV A;  3PUV A;  2F4V L;  1HJP A;  3PGZ A;  1QVG A;  3D31 A;  3SVM A;  2A6H D;  1N9W A;  3HOU G;  4LF9 L;  3OOC A;  4G4K A;  4X66 L;  1VMC A;  4TKO B;  5EPK A;  3HOV G;  2VL6 A;  3M4O H;  2MO1 A;  1VQE A;  3BZC A;  1X9N A;  2F4I A;  4OO1 G;  1EQV A;  4ZCK A;  3DEO A;  1GHJ A;  4X66 Q;  3VR3 A;  2E2D C;  2IWH A;  2ASB A;  3PMF A;  4DAY A;  2E2I H;  3AEV A;  5E3F A;  2EIF A;  3EBE A;  5IT9 L;  5EJW A;  1YI2 A;  4NP5 A;  4RAU C;  3DMU A;  1TWH H;  5JAV A;  4FXK C;  1EY8 A;  4GKJ L;  2A19 A;  3UE1 A;  2VB3 X;  2RCF A;  1WTQ A;  2YTV A;  4HJ9 A;  2DN8 A;  1FNW A;  3R3O A;  4B9X A;  1JWS D;  1AE3 A;  4XIG S;  1K3R A;  3UE0 A;  1ZEQ X;  4L8J A;  4TSS A;  4GKJ Q;  3RNU A;  4ZK9 B;  1CM9 A;  2R7D A;  4PZ7 A;  5FJ8 H;  2BDN A;  4DV1 Q;  1TT2 A;  1SRU A;  2PQE A;  4H13 C;  5KNB A;  3S15 B;  1PLF A;  5HY6 A;  5IOC A;  1S40 A;  3GQB A;  4TVA B;  1SLJ A;  1TWC B;  2K14 A;  1E3P A;  2JA8 B;  3PSI A;  3E0E A;  2KA7 A;  4IFD G;  2I5H A;  1K8O A;  1VQI A;  2UU9 Q;  4LFB Q;  3NPP A;  2GVB A;  5K36 G;  3A7A B;  4A76 A;  1F9S A;  4IPH A;  2E2J B;  2JA7 G;  5DM7 3;  4X64 L;  1C9O A;  2AUK A;  3CCL A;  3DWP A;  2QKI C;  3SK8 A;  1JOR A;  4LWC A;  1EYG A;  2A69 C;  1ZKO A;  1B4O A;  2EYF A;  3KYH C;  3P20 A;  1ENA A;  2LY7 A;  1Q1E A;  2O4X A;  2JA8 H;  5LMU Q;  4ME3 A;  4JI4 Q;  2KED A;  2VB2 X;  4LFA Q;  3Q24 A;  2PZU A;  1ZYR D;  1I50 H;  1U4R A;  2P5Z X;  4OXP A;  1EL0 A;  2A6E D;  1O78 A;  4G7Z C;  1TU2 B;  1STG A;  3A8I E;  5CV5 A;  5C3E H;  3QOJ A;  1UEA B;  2L12 A;  4K0K Q;  5C0X J;  4NDX A;  4UP7 A;  2CQA A;  2EYH A;  2B8G A;  2AUJ D;  4FF1 A;  4F8M A;  2F0L A;  2UUB Q;  2R7F A;  3T13 A;  1KIX A;  4KHP L;  1BR9 A;  1SYF A;  1I50 B;  4XQJ A;  1O7L A;  5BR8 L;  1W3S A;  3ULJ A;  1J9O A;  2IHF A;  1BNZ A;  3CMA A;  1SYC A;  2RSO A;  4QGU A;  2Z0S A;  1PH3 A;  4KHP Q;  3K7A B;  4B3S Q;  2I07 B;  4V0B A;  1MJC A;  4A3E H;  1EFI D;  3G71 A;  2YU9 B;  3G6J B;  5GRO A;  4DNI A;  1A0I A;  1X3E A;  3VR4 A;  5C4J H;  5C4X B;  4K2K A;  2Y0S E;  4IPD A;  1JOK A;  1KRT A;  1HUM A;  3KLW A;  1WI5 A;  5FO7 B;  4JI1 L;  2HT1 A;  2SNS A;  2FMC A;  4FDB A;  1N36 L;  1WYD A;  1Y69 U;  3VR5 A;  4CJ0 B;  1LAC A;  3X3N A;  3C1E A;  3K7A H;  2K6A A;  4DV0 Q;  1D1K A;  1BCP C;  3I3C A;  2MGS A;  1GD7 A;  1HNX Q;  1GUG A;  4YHH Q;  3P75 A;  2VUM G;  1LM0 A;  4IFD I;  2J7Z A;  4BY1 B;  3R8B A;  1I4R A;  2F52 A;  3NEL A;  4JBW A;  3DLL A;  1KRS A;  3HOZ H;  3CD6 A;  3E9H A;  4DNT B;  3K57 A;  2ZTC A;  4A3I B;  5M3M H;  4LF4 Q;  1G6Z A;  2NVY H;  2IW3 A;  4C3I H;  4ODG A;  3ER0 A;  1DYQ A;  3H94 A;  4GN3 B;  5KGU A;  3S14 H;  2F0S A;  1VQA A;  1HR0 W;  1STH A;  2F3I A;  4JOI A;  1RF2 D;  2I46 A;  3UDI A;  1LT3 D;  1P16 A;  2CWA A;  4JI7 L;  1XNQ L;  4YWL A;  4A3M H;  4N8F A;  5EKK A;  3CKI B;  2F0V A;  2RKS A;  3VYU A;  2B39 A;  1CI3 M;  2EXD A;  3GD7 A;  2K5N A;  1BVS A;  4JI7 Q;  4CHT B;  2WAC A;  3M9B A;  5ELE A;  2JE6 I;  4AH6 A;  1ROD A;  1G91 A;  1B9M A;  5A2Q E;  3J81 j;  5FLM G;  2EY1 A;  4OWW B;  3PIO 3;  2KHJ A;  1HUN A;  3NSW A;  1S4Z A;  4YCV A;  1YJ9 A;  2F0O A;  4LF8 L;  4FXD A;  5JPM C;  4AIM A;  3MXU A;  5EPJ A;  3TBI B;  2K7V A;  1LO5 D;  5JJZ A;  2EYP A;  3F1Z A;  1YZ6 A;  5COY A;  2VQF Q;  2NN6 I;  4A3F H;  3VR6 A;  1CUK A;  1KHI A;  3STB D;  3QR8 A;  5ELD A;  4A3F G;  1XNR L;  1PYB A;  3M4O B;  2UXC Q;  1OXV A;  1VF5 C;  2HUG A;  2K5V A;  4A3D G;  5M5X H;  4TRD A;  2PZT A;  4OIK A;  1QE6 A;  1Y14 B;  2FFK B;  1XYI A;  1I4H A;  3K5M A;  5EGT A;  3I4M B;  1RJT A;  4J1M A;  4QQB X;  1FR3 A;  3NBI A;  4DV5 L;  5IYD G;  4NXM Q;  4F88 A;  3NK9 A;  2RVL A;  4Y7N H;  2K5H A;  1BCP D;  4PMW A;  2K75 A;  4YWK A;  4IUR A;  5JEA G;  1SNP A;  1TWF B;  1SFO H;  4AQY Q;  1B50 A;  1B3Q A;  1HNW L;  4DV3 Q;  1U4M A;  1KTK A;  1N32 Q;  2KEE A;  2AQ3 B;  2PO4 A;  1PA6 A;  1FL0 A;  1EOT A;  1UE1 A;  4A4I A;  4C3I G;  3I4M H;  4DR6 L;  1EUJ A;  4L5Q A;  5DM6 3;  4XT1 B;  5CV7 A;  2B8F A;  2WB1 E;  3LX0 A;  1HR0 Q;  4ZKB B;  2BDO A;  5ELO A;  3S15 H;  4PMB A;  2NUC A;  1A62 A;  1VQK A;  1SYB A;  1FVI A;  1LTI D;  1PTO H;  2L11 A;  3FVQ A;  3TP7 A;  1MSG A;  5M3M G;  5IGG A;  3GTL B;  4POF A;  1N33 L;  1CK1 A;  4H44 C;  4LF7 Q;  1YBY A;  5IYB H;  1X3F A;  2XNA C;  3PO3 G;  2K4K A;  4EQ5 A;  3BZD B;  1QZG A;  1IBL L;  1OTC A;  5T1I A;  4A3G H;  1SR3 A;  4E6I A;  3KBX A;  2O5J C;  2XRS D;  1B53 A;  1DM0 B;  4HJ7 A;  3BDO A;  4LF7 L;  4JVZ A;  3CCU A;  1NCV A;  3J81 i;  3CQZ H;  1RHP A;  2F0E A;  3Q22 A;  1SAP A;  3D6W A;  1V9P A;  3I7F A;  1JOQ A;  2BH8 A;  3MXN B;  3HOX B;  4ZUI A;  3D0F A;  3U50 C;  1KNA A;  1VQM A;  1U4P A;  4ME5 A;  3RLO A;  1EY6 A;  3OIP A;  4FF2 A;  2LXK A;  5C3E B;  2R7Z B;  4JI8 Q;  3W2D A;  1LT5 D;  1O7Y A;  2HD3 A;  4RKB A;  5C4Z A;  3GTM H;  4Y52 H;  2B3G A;  1PHJ A;  1C48 A;  3KLS X;  1D7Q A;  2HQE A;  4MN3 A;  1I4G A;  2SNM A;  3EFX D;  1NBW A;  1EU3 A;  3CP0 A;  4DR2 L;  3K59 A;  2ICE C;  3CC7 A;  3T51 B;  1PFB A;  4FYD A;  4JBM A;  1T5X D;  4O2D A;  2NB0 A;  2EOT A;  4UY8 C;  3VYR A;  3CCS A;  2EPB A;  1U4L A;  5C4X G;  1D1I A;  2JN4 A;  4IUV A;  1QUQ A;  1STB A;  5NUC A;  2D5D A;  2FHT A;  1CTM A;  4JI3 Q;  2N55 A;  2F0W A;  5JVH 3;  3R2I A;  1JE4 A;  4GKK Q;  4HSV A;  1SDF A;  1F2Z A;  2D0O A;  1F9P A;  2IX1 A;  4RGM A;  2Q2T A;  1M8A A;  3ULP A;  1C7Y A;  2OWO A;  4CKE A;  4ZAI A;  4TQU S;  2F4V Q;  5J39 A;  1GOZ A;  4IFD H;  2FIN B;  4LF9 Q;  1GO3 E;  4IJH A;  3SGI A;  1IBM L;  3L0O A;  3HKZ B;  2EYM A;  2L1B A;  4CDC C;  3KJO A;  4A3I H;  1CZW A;  4I7Z C;  5KYL A;  3J7A 5;  1MKH A;  1WD1 A;  5AJ3 Q;  2KEN A;  3I2Z A;  4ZQ3 A;  2A68 C;  4DF7 A;  1BBX C;  3MXN A;  3HOW B;  3OWE B;  3K0X A;  2D62 A;  1V43 A;  2MQH A;  1F2Y A;  1X54 A;  1N34 Q;  4KKT A;  3U9S A;  2QEJ C;  1UNS A;  2ZXO A;  4HAE A;  4DV4 L;  3QG1 A;  3CCQ A;  4NXN L;  1A3U A;  4P72 A;  2QW7 A;  3I55 A;  1SND A;  1WTO A;  1STY A;  2PCF B;  3SE0 A;  3MAQ A;  1TXY A;  4X65 Q;  3CCM A;  5FLX L;  2B2T C;  4DXG A;  5J3B A;  4GS3 A;  1NR4 A;  3PV0 A;  5EQ0 A;  4I65 A;  2BA0 A;  4DV1 L;  1LT4 D;  1I6H B;  5E1F A;  4RA8 A;  4GNX A;  4A3B H;  5JPN C;  4C3H G;  1EYC A;  1EQQ A;  1VQG A;  1UE7 A;  1Q81 C;  1H9R A;  3GTK B;  3RN5 A;  3A7L A;  4WJ4 A;  1DCZ A;  3CXC A;  4GN5 A;  1GM5 A;  3HOV H;  2AWN A;  4QJF A;  4DR1 Q;  3SHL A;  4UHV A;  3CCJ A;  3S2D H;  3NQI A;  1BBU A;  1EQR A;  3S1N B;  5A2Q L;  2L15 A;  4BWG B;  3Q0A A;  5CMD A;  4B3T Q;  1S72 A;  3NTH A;  4UP9 A;  3A5U A;  1LTT D;  1Y8P B;  4FVM A;  2EDG A;  4RGO S;  3NXW A;  5IYB G;  1J5E Q;  1A3T A;  1ONL A;  3S1R H;  2F0K A;  3TDQ A;  4B3T L;  3ERQ A;  3HFZ B;  3EIV A;  3GTK H;  3S9W A;  1ZYR C;  2VW9 A;  3BYT B;  2X69 A;  5CV9 A;  4JK1 C;  2K33 A;  2XGT A;  3PIP 3;  3OSO A;  3AFP A;  3HOX G;  1PH2 A;  1JOO A;  3OWF A;  1FJG Q;  1MBY A;  2CH4 W;  5ISR A;  1VQ5 A;  1VMP A;  2JQO A;  2K5D A;  4MTK A;  3MC0 B;  1BDO A;  3QWN A;  5FLX c;  4CDD C;  1HFG A;  2M2L A;  3CCV A;  4DV2 L;  5KND A;  5CBA E;  1AN8 A;  5GAG C;  5KNC A;  4DV7 L;  3S24 A;  1U9R A;  3NEN A;  1DOL A;  3AYH B;  1XMO L;  3TZD A;  1Y1W H;  4IUT A;  5M3F G;  3DWQ A;  2RDH A;  4OEL B;  3FKI G;  1B44 D;  2N49 A;  4K5V A;  1IKM A;  5C0X H;  3PUZ A;  3RZO B;  3K5L A;  1ML0 D;  1ET9 A;  1PFS A;  4N8X 1;  4IFD J;  2OXP A;  4JI2 L;  3WWV A;  3S2H H;  3KBG A;  4JBK A;  1SNO A;  1I3Q H;  4B3S L;  1K8A C;  4JI0 Q;  3I73 A;  3J81 E;  4PQX A;  5CC4 A;  1GXD C;  4JI2 Q;  4KY5 A;  5M5W H;  3K8A A;  1QUQ B;  5CYU A;  5CV8 A;  4O42 A;  3SXH A;  3I8Z A;  3TRE A;  1EFW A;  4DUZ L;  1PMR A;  5GAE C;  3AB9 A;  3I90 A;  4K6L A;  4HCE A;  1PRT F;  3GTP B;  3BG3 A;  5BN4 A;  1PH6 A;  2QF7 A;  2PPB C;  3A74 A;  3VYT A;  1HNX L;  1JB3 A;  1UEB A;  4POG A;  1HZC A;  4A93 B;  2WIN B;  4ZLT F;  2GVA A;  3MFY A;  2VZA A;  4JBJ A;  4CKC A;  3T1Y Q;  3UI2 A;  4IJL A;  1Y1V B;  2F0D A;  1QB5 D;  3PUX A;  2F03 A;  4A3L H;  1J8I A;  1D6E C;  1VQH A;  4LF4 L;  1QNU A;  1I4X A;  4YCU A;  3GTP H;  2JYO A;  5LL6 X;  4KY6 A;  4BA1 I;  1CZG A;  3GTM B;  4A93 H;  3FPU B;  4V19 0;  3D8G A;  3D3R A;  3JAM E;  1YEZ A;  4DR4 L;  1RCV D;  2ZTD A;  1EIY B;  3M4Y A;  2L55 A;  3HRZ C;  4LAA A;  4G57 A;  5IY0 A;  4J6H A;  1LT6 D;  1PZJ D;  4JV5 L;  4EX5 A;  3I4N H;  1ICF B;  2D2C C;  2NBF A;  3NEM A;  4AYB G;  3S1M B;  3LWU A;  4OEM B;  3B6Y A;  1L0W A;  5EKI A;  1ET6 A;  4XQQ A;  2C5C A;  2IJ0 A;  3EVQ A;  2J4X A;  1S5D D;  2JXM B;  4QF4 A;  3N52 A;  3HOZ G;  3NUC A;  3L3O C;  4J8Q A;  1X3G A;  3L9A X;  2K04 A;  4R1J A;  3S1Q B;  1HCZ A;  4KJO A;  1H9J A;  4JC0 A;  2EJF C;  3DUZ A;  4JI4 L;  3MXP A;  3OMG A;  3GDE A;  1EWH A;  4L6T B;  1DOK A;  1X3Q A;  1D5X C;  1HA5 A;  2KHS A;  4ZKC B;  1EU4 A;  4BBR G;  1C8C A;  1GUS A;  1HPC A;  5E4W C;  2K52 A;  1V1P B;  3FRP B;  4QUC A;  1VDZ A;  1E1T A;  3J81 L;  5HGQ A;  1DZ1 A;  1EY9 A;  2B2W A;  1LLR D;  2C35 B;  2XTI A;  1TY0 A;  3V2T A;  1FNV A;  3HOW H;  2N8N A;  1PYW D;  3ULL A;  2JJQ A;  2V4D A;  4HID A;  2R93 G;  4DR7 Q;  3RD4 A;  2AMC B;  1TQO A;  1BQQ T;  5JJL A;  1TS5 A;  1J6Q A;  4KMU C;  4HJA A;  5JOB A;  2A1A A;  5COR A;  3HOU H;  1KQS A;  1XPR A;  1K8M A;  3T1H L;  4DV3 L;  1JJC B;  2HDM A;  5KYI A;  1WTP A;  3GO5 A;  2NVQ B;  2Q8R E;  4GLV B;  3AFQ A;  2JA5 H;  1EYD A;  4HIK A;  3PF5 A;  2AQ1 B;  1MHW C;  3GTG H;  3FEW X;  1HNZ L;  4CJ2 C;  1EWI A;  2HCI A;  3T1H Q;  2H1E A;  3RZD H;  3KF6 A;  3OPO A;  1R4P B;  2CWP A;  3NTI A;  3FP9 A;  4DFA A;  3GV6 A;  2M9V A;  1JB7 A;  4GLX A;  1ASZ A;  4A3B B;  1Q8I A;  3PIP A;  4OON A;  4BBR H;  1RIP A;  5G3L F;  4XQN A;  3PO2 H;  1TS3 A;  4YHH L;  1X65 A;  1N33 Q;  3SEB A;  4KJN A;  4IO9 A;  2A8V A;  1PH4 A;  4LF5 L;  3TRZ A;  2PQA A;  3MHB A;  4QIW B;  2ZT9 C;  3FDT A;  3S1N H;  1JJ2 A;  4K2L A;  3RZD B;  1SE3 A;  2HDL A;  3BDC A;  1AE2 A;  4BBS H;  4QCL A;  2NZ1 D;  4DK6 C;  2EE1 A;  2DJG C;  1Q1B A;  1YNJ C;  2B2Y A;  1IBK Q;  1KC8 C;  4CJ1 B;  4KN4 C;  5KEE A;  1VQB A;  5I2Y A;  4EVO A;  1G6P A;  1OXT A;  2OTL A;  4J15 A;  2JA6 G;  1IBK L;  4R8I A;  1HQR D;  4B3M Q;  4R4O A;  5K36 H;  2LFN A;  5J22 A;  1GVP A;  4GOP B;  2ICI A;  1NR2 A;  1V1P A;  2PYK A;  1PTO C;  2L0C A;  3ND8 A;  3PCO B;  5C6A A;  2NTT A;  4C3J G;  3HP3 A;  1JC7 A;  2DGY A;  3D4W A;  5I9P A;  1WOC A;  4ILW A;  4LF6 L;  5E4X A;  5C4X H;  4A3D H;  4PNY A;  4JPB W;  2N78 A;  3FHW A;  3A5Z B;  4BS9 A;  4CBV A;  1OO9 B;  4DPG A;  3WDN A;  3J80 i;  1LTG D;  5EBD A;  2JEB I;  3LGJ A;  5CBE E;  4LF6 Q;  2A74 C;  2A6H C;  3ZJY C;  1R4Q B;  2L5T A;  3F2U A;  5I2X A;  2XIW A;  5I6W A;  2BE5 D;  2PW7 A;  3NTK A;  1I94 L;  3KF8 B;  2NVX B;  1OXX K;  4ABN A;  5I4D A;  3D4R A;  2DJF C;  4A3D B;  2LSS A;  3D6C A;  3PO3 B;  4G7O C;  2B2W C;  4DUY L;  1I94 Q;  2CVR A;  1SE2 A;  5M3M B;  1M90 C;  1ENF A;  2NVY B;  1HTP A;  4YWM A;  1AW7 A;  4HMI A;  1XWE A;  1O7I A;  4A3M G;  2K05 A;  1VQN A;  1K28 A;  3TP8 A;  1BF4 A;  1HA6 A;  2K32 A;  4C3J B;  5GAH C;  3TEH B;  1Y1V H;  2XSC A;  4DAV A;  4HJ8 A;  3FMC A;  1STN A;  4PV1 C;  1IHZ A;  2PMZ E;  2R3Z A;  1IL2 A;  1LV9 A;  4A3M B;  4DR3 Q;  2KHI A;  2IHE A;  2KEC A;  3I70 A;  2Z9H A;  3ND9 A;  5LMN Q;  4BY7 H;  5IGF A;  3KDF B;  3QO2 A;  3J7A F;  1YHQ A;  2YV5 A;  3TP6 A;  5IOD A;  5K5P A;  4OX9 Q;  2JA6 B;  1K3B C;  3K81 C;  4OO1 I;  4DR3 L;  1N34 L;  1HR0 L;  4LMQ D;  4AYB B;  5M5Y B;  2NZO A;  2Z6K A;  3P1H A;  3GP7 A;  1CQF A;  2NTS A;  1TY2 A;  3EQL C;  2OTJ A;  5IP9 G;  1SYD A;  2ZJP A;  3OHX C;  4PZ6 A;  4LUO A;  4JG2 A;  4BY7 B;  2VQE Q;  3OYY A;  5IYC H;  4ZUJ A;  2FMM A;  4XXE A;  3I56 A;  2A5H A;  2JP1 A;  3MA2 B;  1B2T A;  1HZA A;  5G3L D;  2HHH L;  5KIX A;  2AQ2 B;  1S5F D;  4KD4 A;  3H3V H;  1E2W A;  3HKS A;  5D3I B;  4GOP C;  3C3L A;  2WAQ E;  2UUA L;  2PZW A;  5EKL A;  1KLU D;  2ALY B;  2Q8T A;  4RKL A;  4DR1 L;  2EYO A;  1FD7 D;  3WOF A;  1EIF A;  1SMY D;  1D5M C;  4HR7 B;  2IL8 A;  3J81 c;  4FP5 D;  1NE3 A;  4DA2 A;  5H1S E;  1J5E L;  4DV6 L;  3SDZ A;  1Q86 C;  2SOB A;  4LFA L;  1KD1 C;  2LMC B;  1VQC A;  4DR5 L;  3ONA B;  3HEJ A;  2OF1 A;  1F77 A;  5DAU A;  1DJR D;  4UDU C;  1O7Z A;  2L9H A;  1KAA A;  1SFO B;  1S5C D;  2CW0 D;  4K8J A;  1CSP A;  4NKL A;  4C1N K;  3MTS A;  4Z9C B;  4L5R C;  1F9R A;  5LHY 1;  3K6O A;  2A6E C;  2ZXR A;  2E2I B;  4A3J G;  1L1O C;  2PI2 A;  2R92 H;  2AHO B;  2XWJ B;  4CKB A;  3GV3 A;  2Y0S G;  1GHK A;  2TSS A;  2I0Q A;  2GN5 A;  2K01 A;  5BR8 Q;  2ES2 A;  1JT8 A;  2UXB L;  4K6D A;  3M3Y H;  3A8K E;  4GN4 B;  2EYL A;  5DNF A;  2N3S A;  3VA7 A;  1ZXT A;  4GKK L;  1PVO A;  4PG3 A;  1S5E D;  2JA5 B;  3L2P A;  3MVV A;  5CR3 A;  3OTO Q;  1IYU A;  1G29 1;  2QDB A;  5IGD A;  3GTG B;  2UXB Q;  3CRK C;  2EZV A;  4IN3 A;  2R92 B;  1EY0 A;  1NMF A;  3SR1 A;  2B29 A;  1SYE A;  1MJE A;  3A8J E;  4S3S A;  1B7Y B;  5E7N A;  2Z6B A;  4JI1 Q;  3PO2 B;  2F0U A;  1MIU A;  2F0G A;  4P2C B;  1TWC H;  1B1Z A;  3ERS X;  3CCE A;  2EYJ A;  4DV0 L;  4BBS G;  5GQO A;  1JWM D;  1LTB D;  1IBM Q;  1M1K C;  3T56 B;  1WTR A;  2CH4 A;  4DUZ Q;  2WP8 J;  4GNX B;  1JCK B;  4DAP A;  1I4P A;  5AJ3 L;  1YJN A;  3VYS A;  3BJU A;  3V96 A;  4X62 Q;  4M8A A;  2KVM A;  2JA5 G;  3TSS A;  4LFC Q;  4A3L G;  1HH2 P;  5EBC A;  1X55 A;  3OW7 A;  4GLA C;  2Q8I B;  4ALP A;  3A56 A;  5JEA J;  1PH5 A;  3T1Y L;  4X62 L;  3OW2 A;  2EY2 A;  3CU7 A;  2V1C C;  2YU9 H;  1YNJ D;  1IXR A;  5LMN W;  4ZYS A;  3IKJ A;  2DNC A;  2DUD A;  4NXN Q;  1QIL A;  4DN4 M;  3C1F A;  3TS2 A;  5CGK A;  1XTD A;  1T9H A;  2R61 A;  5JJI A;  3A0J A;  3CME A;  1LUZ A;  2TMP A;  4RFB A;  4DK0 A;  1MSH A;  1BOS A;  1KDB A;  5IWA L;  2QA4 A;  3JAM c;  3TP5 A;  2WII B;  3ITP A;  1ENC A;  1UE6 A;  1AH9 A;  1EIH A;  2JA9 A;  4A3B G;  5IWA Q;  1IYJ B;  2F0H A;  3LNN A;  4X64 Q;  3HOZ B;  4EQP A;  4UP8 A;  3K80 C;  3MZ5 A;  1WJJ A;  4HJ5 A;  3HOW G;  1D5Z C;  1E7Z A;  2EVB A;  3M7N A;  1E24 A;  2ATW A;  2NVX H;  4B3R Q;  3MEH A;  1GUW A;  4EQN A;  4A3K B;  1KDC A;  2HIV A;  2MUY A;  3W3A A;  4DAM A;  4FF3 A;  2JA8 G;  1PH9 A;  1G51 A;  3F8T A;  3J80 E;  3P7J A;  3MFG A;  2LS0 1;  4H02 A;  4K0K L;  1JIC A;  1TWA H;  4NMZ A;  3BVG A;  1YHA A;  3AQQ A;  3R93 A;  4MZ9 A;  1B8A A;  3F2D A;  2K5Q A;  4BXX G;  1I5F A;  3CF5 A;  4JI6 Q;  3HKZ E;  1PZI D;  2KBN A;  1VQ6 A;  1Z7T A;  4IUU A;  4DKA C;  4DNR B;  2PNH A;  1X32 A;  2E76 C;  1PH1 A;  4DV5 Q;  1UE5 A;  1YHB A;  4L5T A;  5C4H A;  5I6Y A;  4NXM L;  1TKW B;  4C2M B;  4YCW A;  3RN2 A;  1PH7 A;  1V1O A;  1L0Y B;  1QG7 A;  1HQM C;  1K83 B;  1K0R A;  1NUC A;  2SDF A;  4QMG A;  2E5L L;  2OQ0 A;  4JI0 L;  4OL7 A;  5IGE A;  3EA6 A;  3X3M A;  4DK3 C;  4RGN A;  1KLG D;  2G5D A;  1NNX A;  5IYD H;  3G6E A;  4C3H H;  1XX8 A;  2RF4 A;  1TR5 A;  2B63 H;  1CSQ A;  2CFM A;  1WFQ A;  5C5L A;  1HZ9 A;  1VQF A;  2E5L Q;  1GUT A;  2PMZ B;  3E3X A;  1SXT A;  1MD2 D;  3S2D B;  4JI5 L;  1OXU A;  2VXW A;  1WCM G;  1BO0 A;  4ID6 A;  2R93 B;  1YNN C;  2M00 A;  1VQJ A;  1FGU A;  1IW7 D;  1VQ8 A;  1E1O A;  2OEO A;  3S16 B;  4QL5 A;  3H3V I;  5M3F B;  2CQO A;  1XXG A;  1KDA A;  4KY7 A;  1GUN A;  4C3H B;  1CKN B;  4IZ8 A;  5DEH A;  3U9O A;  4DAY B;  1WTH A;  3K0Y A;  1NY4 A;  2ENB A;  5TSS A;  3T53 B;  1EEF D;  2UUC L;  4RCN A;  2PI2 E;  3VR2 A; 
#chains in the Genus database with same CATH homology
 3PUW A;  2FJ2 A;  3WOE A;  1PTO F;  4HSP A;  5IGB A;  2K1B A;  1FGB D;  5D65 A;  4F7X A;  4N9P A;  5ELC A;  4K8I A;  2F0F A;  4KI0 A;  1PRT C;  3Q6S A;  1TWH B;  5C5M A;  2SEB D;  5C0X G;  1PZK D;  1MI2 A;  5M5X B;  3RMH A;  1G2T A;  3V05 A;  1H9M A;  4U67 3;  1VF7 A;  1PRT B;  1AFP A;  3H3V C;  3IAY A;  3IFD A;  4Y7N B;  3T4A C;  1ICW A;  3CQZ B;  2MPM A;  3HG9 A;  4HN7 A;  2K03 A;  2KUM A;  3N6R A;  3H91 A;  4X3S A;  2F1M A;  4RGT A;  2Z1C A;  3TME A;  1KAB A;  1OXS C;  3NBH A;  5JVG 3;  3HGB A;  1TS2 A;  3FPP A;  1PTO B;  1CHP D;  1I4Q A;  3NWT A;  3GTO B;  2WV6 D;  1YNN D;  4KK7 A;  1UUP A;  1V8Q A;  1UAP A;  2RDG A;  4HTH A;  1ESF A;  3E6Z X;  3RLF A;  2EJG C;  4XDX A;  2F0J A;  4DXF A;  2MP1 A;  4UAI A;  3J80 L;  3GTJ B;  2Z8L A;  3A54 A;  1RD9 D;  1EEI D;  4MHE A;  4DGZ A;  4KHV A;  2RQX A;  2B2Y C;  1PRT D;  1STE A;  4KD3 A;  3AU7 A;  4L63 B;  1ILP A;  3CRL C;  5ELB A;  5FO8 B;  3H0G B;  4XT3 B;  1H9K A;  2E75 C;  1JR0 D;  3ZYY X;  2Z4H A;  1EY4 A;  1AEX A;  1AZQ A;  3SK4 A;  3GTQ B;  1T5E A;  2R6G A;  4DK1 A;  5FKA C;  1MGS A;  4IUQ A;  1Q12 A;  2GA4 B;  4B9W A;  4Q5V A;  4HCS A;  2B2V A;  4KTA A;  3IL8 A;  2XRQ D;  3IFT A;  1E2V A;  3KLS A;  1SNM A;  1TWA B;  5IT9 E;  4C3I B;  1Y8N B;  4WOR A;  1WTV A;  4G7H C;  4WFN 3;  3QJY A;  2L4N A;  3VA5 A;  4EGV A;  4K5X A;  2JEA I;  1M4V A;  4HED A;  1FNU A;  3MXG A;  5A35 A;  1EY5 A;  3E5S A;  3HOU B;  1DOM A;  4ULL A;  3C2P A;  3L7Z C;  2B2V C;  4IUN A;  3LWE A;  1H9S B;  4B08 A;  4K5W A;  4KN7 C;  2NWG A;  3K5N A;  2IX3 A;  2RA4 A;  3E0J A;  4RCO A;  3H09 A;  3I91 A;  2Y0S B;  1Q3L A;  2DY7 A;  3S1R B;  4FO2 A;  4A3J B;  1A15 A;  2G9H D;  1TWG B;  3BVM A;  1Q90 A;  2PW5 A;  4KKU A;  3M85 A;  1F9Q A;  2A68 D;  1IKL A;  3QIA A;  2OT2 A;  2J0T D;  2E74 C;  2KJX A;  2O2L D;  1JQY D;  3DHQ A;  1EIG A;  5FOB B;  5IGC A;  2RDF A;  1IW7 C;  2C9O A;  3HOV B;  3Q23 A;  3NWS A;  4FXG C;  3C46 A;  2NYZ D;  1Z47 A;  5FK9 C;  3J7A V;  1CQV A;  4WJW A;  4RHR A;  1I3Q B;  2DNE A;  4MIU A;  2F0I A;  4M1U B;  2F3V A;  2F0M A;  5D14 A;  3NHH A;  1QNK A;  1ESR A;  4R8N A;  2Z4I A;  5JEA H;  4R9W A;  1WTW A;  2A73 B;  4EQO A;  1BCP F;  1SJE D;  4U68 A;  1L0X B;  5T1G A;  1S5B D;  3I72 A;  3SK6 A;  2KOL A;  1WTX A;  4F87 A;  3KUP A;  4FF4 A;  1H9S A;  2VUM B;  1SJH D;  5F2D A;  3O13 A;  3OIQ A;  4RWS C;  1Y1W B;  4IQZ A;  3QB3 A;  3TN2 A;  2F0N A;  3KF8 A;  4A3G B;  2A69 D;  1SYG A;  4WRD A;  1CFM A;  1TS4 A;  1AZP A;  2NN6 H;  2X6L A;  1HFN A;  2D9U A;  5M9O A;  2KQ3 A;  1W6K A;  5M5W B;  1CT1 D;  2ID0 A;  4O1N A;  4OGQ C;  2MJ8 A;  1GJX A;  4KKS A;  2B2U A;  5IIF A;  2O5I C;  1G8Z D;  1LTA D;  2NN6 G;  1EQT A;  1X3P A;  5EPL A;  3URY A;  1HXY D;  2F3W A;  4GZY C;  3I4L A;  1SE4 A;  3HS0 C;  2BOS A;  3CHB D;  3H6M A;  4ZRZ A;  2DY8 A;  1DD2 A;  1RTO A;  1BCP B;  1QJO A;  4H0L C;  2HCC A;  1BUV T;  1CA6 A;  1WCM B;  1RTN A;  1IYV A;  3J7Y W;  1EZ6 A;  2IT1 A;  1DXM A;  2NVT B;  1WD0 A;  1HRJ A;  1EY7 A;  1QWY A;  3D4D A;  1WVL A;  1B9N A;  3KLR A;  1QCB D;  4PMC A;  3KK7 A;  5FO9 B;  4XYQ A;  4LJZ C;  2E2H B;  1C4Q A;  1PXU A;  2JA7 B;  5CV6 A;  3ERO A;  1NAP A;  1BXT A;  1PDQ A;  3DM1 A;  3QOL A;  4QUF A;  4OIJ A;  2AWO A;  4NW2 A;  3BVZ A;  3K58 A;  3EJI A;  1PTO D;  3BS1 A;  2IPK D;  1F2M A;  1VCI A;  1LTR D;  3BYY B;  3TZU A;  5C3W A;  2RBM A;  1E2Z A;  1II3 A;  2ZXP A;  3HZX A;  3AMU A;  1HTL D;  4BA2 I;  2WKD A;  1HHV A;  4N9T A;  1RKN A;  1CHQ D;  1PFN A;  2EJM A;  4IAL A;  4XYO A;  1SNC A;  2G9D A;  2BE5 C;  3OMC A;  4RH6 A;  3JAM L;  2XWB B;  3M3Y B;  2K28 A;  3R2T A;  1B3A A;  1ILQ A;  2MHV A;  5BN5 A;  4K14 A;  4FNF A;  1LTS D;  1NSN S;  3RUZ A;  4X3U A;  1DON A;  4C56 C;  1A2U A;  3NP8 A;  2KCC A;  1W6J A;  2WKC A;  4QB4 A;  1QOH A;  4RHS A;  1Y8O B;  5HUR A;  2VNU D;  1D2B A;  4IUP A;  2F0P A;  2H4O A;  1I6V C;  2WAQ B;  4HMJ A;  2EY6 A;  1KNE A;  5FLX E;  2EXZ A;  4X3T A;  3PUY A;  3DXJ C;  4BBR B;  1TVX A;  2JSO A;  2XN9 C;  5ELF A;  5D3D A;  1O80 A;  5CV4 A;  1EWC A;  4X3K A;  1PFM A;  3HOY B;  3NE5 B;  5HGT A;  5C0X I;  1E0B A;  4BBS B;  3S17 B;  2K5W A;  2BA1 A;  3DEP A;  2KCN A;  4YIJ A;  3SK5 A;  4A3E B;  4KV6 A;  5C3X A;  2F0Q A;  1SNQ A;  4KHZ A;  5J1Z A;  5C4J B;  1FYC A;  1A2T A;  2QCP X;  3S2H B;  1SMY C;  2WB1 B;  2B2U C;  2X6G A;  2QIL A;  1XTC D;  1A6X A;  4XTC S;  2F0T A;  1AP0 A;  2N88 A;  3DWA A;  4LK1 C;  3MWY W;  2XVS A;  1TII D;  3NQT A;  1RDP D;  5AFW A;  1R9T B;  2B2T A;  5BN3 A;  4H7B A;  2EY5 A;  5KRU A;  3S14 B;  4OO1 H;  2YYZ A;  3G7L A;  1EYA A;  1JWU D;  3T16 A;  1G2S A;  1IL8 A;  5C44 B;  2IX0 A;  1SEB D;  2PNR C;  1GUO A;  1Z6H A;  1EZ8 A;  1SBB B;  5I9O A;  1CA5 A;  1F2L A;  1LAB A;  5LL6 S;  3K5O A;  2CW0 C;  1STA A;  3I4N B;  4OHJ A;  2B63 B;  3BDL A;  3FKI B;  4Q0F A;  2CHB D;  4DU9 A;  2RSN A;  1SSO A;  4C1N I;  3A55 A;  4CGY B;  3M7G A;  1A3V A;  2BCO A;  4A3F B;  2LKV A;  3PUV A;  3D31 A;  3SVM A;  2A6H D;  3OOC A;  4G4K A;  1VMC A;  4TKO B;  5EPK A;  2F4I A;  4OO1 G;  1EQV A;  3DEO A;  1GHJ A;  3VR3 A;  2E2D C;  2IWH A;  3PMF A;  4DAY A;  5E3F A;  5IT9 L;  5EJW A;  4NP5 A;  4RAU C;  3DMU A;  5JAV A;  4FXK C;  1EY8 A;  2VB3 X;  1WTQ A;  2DN8 A;  1FNW A;  3R3O A;  4B9X A;  1JWS D;  4XIG S;  1ZEQ X;  4L8J A;  4TSS A;  4ZK9 B;  1CM9 A;  2BDN A;  1TT2 A;  2PQE A;  4H13 C;  5KNB A;  3S15 B;  1PLF A;  5IOC A;  3GQB A;  1TWC B;  2JA8 B;  2KA7 A;  4IFD G;  1K8O A;  3NPP A;  5K36 G;  3A7A B;  1F9S A;  2E2J B;  5DM7 3;  2AUK A;  3DWP A;  2QKI C;  3SK8 A;  1JOR A;  2A69 C;  1ZKO A;  1B4O A;  2EYF A;  3P20 A;  1ENA A;  2LY7 A;  1Q1E A;  2O4X A;  2KED A;  2VB2 X;  3Q24 A;  2PZU A;  1ZYR D;  1U4R A;  1EL0 A;  2A6E D;  1O78 A;  4G7Z C;  1TU2 B;  1STG A;  3A8I E;  5CV5 A;  3QOJ A;  1UEA B;  2L12 A;  5C0X J;  4NDX A;  2CQA A;  2EYH A;  2B8G A;  2AUJ D;  4FF1 A;  4F8M A;  2F0L A;  3T13 A;  1BR9 A;  1SYF A;  1I50 B;  4XQJ A;  1O7L A;  1J9O A;  1BNZ A;  1SYC A;  2RSO A;  3K7A B;  2I07 B;  4V0B A;  1EFI D;  2YU9 B;  3G6J B;  3VR4 A;  5C4X B;  4K2K A;  1JOK A;  1HUM A;  5FO7 B;  2SNS A;  2FMC A;  1Y69 U;  3VR5 A;  4CJ0 B;  1LAC A;  3X3N A;  3C1E A;  2K6A A;  1D1K A;  1BCP C;  3I3C A;  2MGS A;  1GUG A;  3P75 A;  4IFD I;  2J7Z A;  4BY1 B;  3R8B A;  1I4R A;  4JBW A;  4DNT B;  3K57 A;  4A3I B;  1G6Z A;  2IW3 A;  4ODG A;  1DYQ A;  3H94 A;  5KGU A;  2F0S A;  1STH A;  1RF2 D;  2I46 A;  1LT3 D;  5EKK A;  3CKI B;  2F0V A;  2RKS A;  3VYU A;  2B39 A;  1CI3 M;  3GD7 A;  4CHT B;  2WAC A;  5ELE A;  2JE6 I;  1G91 A;  1ROD A;  1B9M A;  5A2Q E;  2EY1 A;  3PIO 3;  1HUN A;  3NSW A;  1S4Z A;  2F0O A;  4FXD A;  5JPM C;  3MXU A;  5EPJ A;  3TBI B;  2K7V A;  1LO5 D;  5JJZ A;  2EYP A;  5COY A;  2NN6 I;  3VR6 A;  5ELD A;  3M4O B;  1OXV A;  1VF5 C;  2HUG A;  4TRD A;  2PZT A;  1QE6 A;  2FFK B;  4OIK A;  1XYI A;  1I4H A;  3K5M A;  5EGT A;  3I4M B;  1RJT A;  4J1M A;  1FR3 A;  3NBI A;  4F88 A;  3NK9 A;  2RVL A;  1BCP D;  4PMW A;  4IUR A;  5JEA G;  1SNP A;  1TWF B;  1B50 A;  1U4M A;  1KTK A;  2KEE A;  2AQ3 B;  2PO4 A;  1EOT A;  4C3I G;  5DM6 3;  4XT1 B;  5CV7 A;  2B8F A;  3LX0 A;  4ZKB B;  2BDO A;  4PMB A;  2NUC A;  1SYB A;  1LTI D;  1PTO H;  3FVQ A;  2L11 A;  3TP7 A;  1MSG A;  3GTL B;  5IGG A;  1CK1 A;  4H44 C;  2XNA C;  3BZD B;  5T1I A;  4E6I A;  3KBX A;  2O5J C;  2XRS D;  1B53 A;  1DM0 B;  3BDO A;  1NCV A;  1RHP A;  2F0E A;  3Q22 A;  1SAP A;  3D6W A;  1JOQ A;  3HOX B;  4ZUI A;  1KNA A;  1U4P A;  4ME5 A;  1EY6 A;  3OIP A;  4FF2 A;  5C3E B;  2R7Z B;  3W2D A;  1LT5 D;  1O7Y A;  4RKB A;  5C4Z A;  1C48 A;  3KLS X;  2HQE A;  4MN3 A;  1I4G A;  2SNM A;  3EFX D;  1EU3 A;  3K59 A;  2ICE C;  3T51 B;  1PFB A;  4FYD A;  1T5X D;  2NB0 A;  2EOT A;  3VYR A;  2EPB A;  1U4L A;  1D1I A;  4IUV A;  1STB A;  5NUC A;  2D5D A;  2FHT A;  1CTM A;  2N55 A;  2F0W A;  5JVH 3;  3R2I A;  1JE4 A;  4HSV A;  1SDF A;  1F2Z A;  1F9P A;  2IX1 A;  4RGM A;  1M8A A;  4CKE A;  4ZAI A;  4TQU S;  5J39 A;  1GOZ A;  4IFD H;  2FIN B;  3HKZ B;  2EYM A;  2L1B A;  1CZW A;  4I7Z C;  5KYL A;  1WD1 A;  4ZQ3 A;  2A68 C;  4DF7 A;  1BBX C;  3MXN A;  3HOW B;  3OWE B;  2D62 A;  1V43 A;  1F2Y A;  4KKT A;  3U9S A;  2QEJ C;  1UNS A;  2ZXO A;  4HAE A;  3QG1 A;  1A3U A;  1WTO A;  1SND A;  1STY A;  2PCF B;  3SE0 A;  3MAQ A;  5FLX L;  2B2T C;  4DXG A;  1NR4 A;  3PV0 A;  5EQ0 A;  4I65 A;  2BA0 A;  1LT4 D;  1I6H B;  5E1F A;  4RA8 A;  5JPN C;  4C3H G;  1EYC A;  1H9R A;  3GTK B;  3A7L A;  1DCZ A;  2AWN A;  3SHL A;  3NQI A;  3S1N B;  5A2Q L;  4BWG B;  3Q0A A;  5CMD A;  3NTH A;  1LTT D;  1Y8P B;  4FVM A;  2EDG A;  4RGO S;  3NXW A;  1A3T A;  1ONL A;  2F0K A;  3TDQ A;  3ERQ A;  3S9W A;  1ZYR C;  3BYT B;  2X69 A;  5CV9 A;  4JK1 C;  2K33 A;  3PIP 3;  3OSO A;  1JOO A;  3OWF A;  1MBY A;  5ISR A;  1VMP A;  2K5D A;  3MC0 B;  1BDO A;  3QWN A;  1HFG A;  2M2L A;  5KND A;  5CBA E;  1AN8 A;  5KNC A;  1U9R A;  1DOL A;  3TZD A;  4IUT A;  3DWQ A;  2RDH A;  1IKM A;  1B44 D;  4K5V A;  5C0X H;  3PUZ A;  3RZO B;  3K5L A;  1ML0 D;  1ET9 A;  4IFD J;  2OXP A;  3KBG A;  1SNO A;  3I73 A;  3J81 E;  4PQX A;  5CC4 A;  1GXD C;  4KY5 A;  5CYU A;  5CV8 A;  4O42 A;  3SXH A;  3I8Z A;  1PMR A;  3AB9 A;  3I90 A;  4K6L A;  4HCE A;  1PRT F;  3GTP B;  3BG3 A;  5BN4 A;  2QF7 A;  2PPB C;  3VYT A;  1JB3 A;  4A93 B;  2WIN B;  4ZLT F;  3MFY A;  4CKC A;  3UI2 A;  1Y1V B;  2F0D A;  1QB5 D;  3PUX A;  2F03 A;  1J8I A;  1D6E C;  1QNU A;  1I4X A;  2JYO A;  5LL6 X;  4KY6 A;  4BA1 I;  1CZG A;  3GTM B;  3FPU B;  4V19 0;  3D8G A;  3D3R A;  3JAM E;  1RCV D;  3M4Y A;  2L55 A;  3HRZ C;  4LAA A;  4G57 A;  4J6H A;  1LT6 D;  1PZJ D;  2D2C C;  2NBF A;  3S1M B;  3LWU A;  5EKI A;  1ET6 A;  4XQQ A;  2C5C A;  2IJ0 A;  3EVQ A;  2J4X A;  1S5D D;  2JXM B;  4QF4 A;  3N52 A;  3NUC A;  3L3O C;  4J8Q A;  3L9A X;  2K04 A;  3S1Q B;  1HCZ A;  4KJO A;  1H9J A;  2EJF C;  3DUZ A;  3MXP A;  3OMG A;  1EWH A;  4L6T B;  1DOK A;  1X3Q A;  1D5X C;  1HA5 A;  2KHS A;  4ZKC B;  1EU4 A;  1C8C A;  1GUS A;  1HPC A;  5E4W C;  1V1P B;  3FRP B;  4QUC A;  1VDZ A;  3J81 L;  1DZ1 A;  1EY9 A;  2B2W A;  1LLR D;  1TY0 A;  3V2T A;  1FNV A;  1PYW D;  2V4D A;  3RD4 A;  1TQO A;  1BQQ T;  1TS5 A;  4KMU C;  5JOB A;  5COR A;  1K8M A;  2HDM A;  5KYI A;  1WTP A;  3GO5 A;  2NVQ B;  2Q8R E;  1EYD A;  2AQ1 B;  3FEW X;  4CJ2 C;  2HCI A;  2H1E A;  3OPO A;  1R4P B;  3NTI A;  4DFA A;  3GV6 A;  2M9V A;  4A3B B;  1Q8I A;  5G3L F;  4XQN A;  1TS3 A;  3SEB A;  4KJN A;  3MHB A;  4QIW B;  2ZT9 C;  3FDT A;  4K2L A;  3RZD B;  1SE3 A;  2HDL A;  3BDC A;  4QCL A;  2NZ1 D;  2EE1 A;  1Q1B A;  1YNJ C;  2B2Y A;  4CJ1 B;  4KN4 C;  5KEE A;  5I2Y A;  4EVO A;  1OXT A;  4R8I A;  1HQR D;  5K36 H;  2LFN A;  5J22 A;  2ICI A;  1NR2 A;  1V1P A;  2PYK A;  1PTO C;  2L0C A;  3ND8 A;  5C6A A;  2NTT A;  4C3J G;  3HP3 A;  1JC7 A;  3D4W A;  5I9P A;  4ILW A;  5E4X A;  4PNY A;  4BS9 A;  4CBV A;  1OO9 B;  3WDN A;  1LTG D;  5EBD A;  2JEB I;  5CBE E;  2A74 C;  2A6H C;  1R4Q B;  2L5T A;  3F2U A;  5I2X A;  2XIW A;  5I6W A;  2BE5 D;  2PW7 A;  3NTK A;  2NVX B;  1OXX K;  4ABN A;  5I4D A;  3D4R A;  4A3D B;  3D6C A;  3PO3 B;  4G7O C;  2B2W C;  2CVR A;  1SE2 A;  5M3M B;  1ENF A;  2NVY B;  1HTP A;  1AW7 A;  4HMI A;  1XWE A;  2K05 A;  3TP8 A;  1BF4 A;  1HA6 A;  2K32 A;  4C3J B;  2XSC A;  4DAV A;  3FMC A;  1STN A;  4PV1 C;  1IHZ A;  2R3Z A;  1LV9 A;  4A3M B;  2KEC A;  3I70 A;  3ND9 A;  5IGF A;  3QO2 A;  3J7A F;  3TP6 A;  5IOD A;  5K5P A;  2JA6 B;  4OO1 I;  4LMQ D;  4AYB B;  5M5Y B;  3P1H A;  3GP7 A;  1CQF A;  2NTS A;  1TY2 A;  3EQL C;  1SYD A;  3OHX C;  4BY7 B;  4ZUJ A;  2FMM A;  4XXE A;  2A5H A;  2JP1 A;  3MA2 B;  1B2T A;  5G3L D;  5KIX A;  2AQ2 B;  1S5F D;  4KD4 A;  1E2W A;  5D3I B;  3C3L A;  2PZW A;  5EKL A;  1KLU D;  2Q8T A;  4RKL A;  2EYO A;  1FD7 D;  3WOF A;  1SMY D;  1D5M C;  4HR7 B;  2IL8 A;  4FP5 D;  4DA2 A;  3SDZ A;  2SOB A;  2LMC B;  3ONA B;  3HEJ A;  2OF1 A;  1F77 A;  5DAU A;  1DJR D;  4UDU C;  1O7Z A;  2L9H A;  1KAA A;  1SFO B;  1S5C D;  2CW0 D;  4K8J A;  4NKL A;  4C1N K;  3MTS A;  4Z9C B;  1F9R A;  5LHY 1;  3K6O A;  2A6E C;  2ZXR A;  2E2I B;  2XWJ B;  4CKB A;  3GV3 A;  1GHK A;  2TSS A;  2K01 A;  4K6D A;  3A8K E;  2EYL A;  5DNF A;  3VA7 A;  1ZXT A;  2JA5 B;  1S5E D;  3MVV A;  5CR3 A;  1IYU A;  1G29 1;  2QDB A;  5IGD A;  3GTG B;  3CRK C;  2EZV A;  4IN3 A;  2R92 B;  1EY0 A;  3SR1 A;  1SYE A;  3A8J E;  4S3S A;  3PO2 B;  2F0U A;  2F0G A;  4P2C B;  1B1Z A;  2EYJ A;  1JWM D;  1LTB D;  3T56 B;  1WTR A;  2WP8 J;  1JCK B;  4DAP A;  1I4P A;  3VYS A;  3V96 A;  4M8A A;  2KVM A;  3TSS A;  5EBC A;  3OW7 A;  2Q8I B;  3A56 A;  5JEA J;  2EY2 A;  3CU7 A;  1YNJ D;  4ZYS A;  3IKJ A;  2DNC A;  1QIL A;  4DN4 M;  3C1F A;  5CGK A;  2R61 A;  2TMP A;  4RFB A;  4DK0 A;  1MSH A;  1BOS A;  1KDB A;  3TP5 A;  2WII B;  3ITP A;  1ENC A;  1EIH A;  2F0H A;  3LNN A;  3HOZ B;  4EQP A;  3MZ5 A;  1D5Z C;  2EVB A;  3M7N A;  3MEH A;  1GUW A;  4EQN A;  4A3K B;  1KDC A;  2MUY A;  3W3A A;  4FF3 A;  3J80 E;  3P7J A;  3MFG A;  2LS0 1;  1JIC A;  4NMZ A;  3BVG A;  3R93 A;  2K5Q A;  1PZI D;  1Z7T A;  4IUU A;  4DNR B;  1X32 A;  2E76 C;  5C4H A;  5I6Y A;  1TKW B;  4C2M B;  1V1O A;  1L0Y B;  1QG7 A;  1HQM C;  1K83 B;  1NUC A;  2SDF A;  4QMG A;  4OL7 A;  5IGE A;  3EA6 A;  3X3M A;  4RGN A;  1KLG D;  1XX8 A;  1TR5 A;  5C5L A;  1GUT A;  2PMZ B;  1SXT A;  1MD2 D;  3S2D B;  1OXU A;  2VXW A;  1BO0 A;  4ID6 A;  2R93 B;  1YNN C;  2M00 A;  1IW7 D;  2OEO A;  3S16 B;  5M3F B;  1XXG A;  1KDA A;  4KY7 A;  1GUN A;  4C3H B;  4IZ8 A;  5DEH A;  3U9O A;  3K0Y A;  5TSS A;  3T53 B;  2ENB A;  1EEF D;  4RCN A;  3VR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...