2KCNA

Solution structure of the antifungal protein paf from penicillium chrysogenum
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional aspects of the solution structure and dynamics of PAF--a highly-stable antifungal protein from Penicillium chrysogenum
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Antifungal protein
molecule keywords Antifungal protein
total genus 4
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kcnA00
2NBFA 1AFPA 2NB0A 2MHVA 2KCNA
chains in the Genus database with same CATH superfamily
4NDXA 2JA7H 1C4QA 2RCFA 1K0RA 3PUZA 1EEFD 1H95A 2AQ2B 2E5LQ 1MSGA 2M2LA 3D4DA 3HOWB 3K58A 4LNQA 1XXGA 4WJWA 1D1KA 3FRPB 4DV1Q 1X3FA 1H9SA 4ODGA 4LF8L 3UDXA 1SJED 1PH4A 5EGTA 5IT9E 1NR2A 4OO1I 1EY9A 1LT4D 3E0EA 1PH5A 4A93H 1IXRA 5HGTA 3ONAB 4DAMA 4IPGA 4GNXA 4IALA 1E1TA 1JQYD 4X3KA 3KUPA 2G9HD 2DNEA 3CAMA 5KYLA 2UUAL 3DUZA 2DUDA 3IRBA 4LFCL 3M4OB 2SDFA 4YHHL 3HOVB 1WI5A 4HIMA 4ZCKA 5EAYA 4K6DA 1A2TA 1N36Q 3SVMA 1K9MC 3STBC 1D1IA 4DV6L 2CVRA 3PO3B 4RGTA 3HOZG 3DEPA 4LF9L 2XNAC 3H09A 2F0OA 2ZXOA 3VR4A 5FO9B 3JAML 2R93B 1OXXK 2UXDQ 4JI8Q 4JOIA 1GUWA 4AYBE 3ULPA 1SYBA 1CZGA 4KHVA 4JI7L 1YEZA 4RG1A 3PQIA 5C5MA 4KHPQ 1Q12A 4HCSA 4OIJA 2B8GA 2CH4A 1D2BA 4XT1B 1EY5A 1F2MA 3GTJH 2RDGA 4HJ8A 1ASYA 3CCVA 3CCRA 1BOSA 2R92G 2I0QA 1PVOA 4BY7B 2NWGA 1QUQA 1UEAB 3A74A 1DXMA 4LF4L 1Y1WG 1BNZA 2R92B 4DR7Q 2PQAB 3K81C 5DNFA 3T16A 2RBMA 3K5LA 2VZAA 2F0WA 1HH2P 2OCEA 5FJ8G 3PIOA 1CKOA 2PPBC 3A8IE 2F0QA 2I5LX 3Q22A 3CU7A 1O80A 2EYMA 3K5OA 3T4AC 1VQMA 2F03A 2VUMB 3J7AF 4BBRG 3Q24A 1TWCH 1VQ5A 2LY7A 3HOWH 1EYGA 5EBDA 3KLRA 1EWIA 2BCOA 3D4RA 4FVMA 4A3FG 1VS0A 1Y69U 2VL6A 1S72A 2F0SA 3NENA 3S16H 1ZKOA 1WTVA 2A69D 1X65A 3ICEA 1HNXL 4JVZA 4WJ4A 1PH9A 5M3FG 4KI0A 1V9PA 3HS0C 4IFDH 4JI2L 5IP7H 1EEID 5K5PA 1QB5D 5EPLA 3BVZA 4PZ7A 3A56A 1XNQQ 3RN2A 4ZKCB 1YI2A 4NW2A 3I73A 5IYCG 3ERSX 2JA8G 4A3JG 1WCMG 2NVQB 4LK1C 4DV1L 4OELB 3CW2C 3PF5A 2A74C 3A5ZB 2WKDA 4L5SA 5IGEA 3L0OA 3E9HA 3QIAA 3VYRA 2WKCA 2IX0A 4AYBG 3IFTA 3I91A 3CCJA 1B9MA 1HTLD 2JA5G 4BY1H 3RR5A 1J5EQ 3X3MA 1ASZA 4OXPA 5LL6X 2AWOA 4BA2I 1HHVA 1A3VA 5EQ0A 1VF5C 4C3IH 2L5TA 1SNMA 2J4XA 5BR8L 2NVXB 2A68C 1MIUA 2WACA 2B39A 4KKSA 1QUQB 3CPWA 3PF4A 3A7AB 1OXTA 1ILQA 3PSIA 2HHHL 2B3GA 4JI6Q 4DV7Q 1MHWC 2A68D 2E2HB 4CBVA 3A0JA 1M1KC 3R93A 4CKBA 2Z6KC 1PV4A 2HDLA 1WFQA 3GTJB 3FVQA 2ENBA 3BDOA 5DM63 3QOLA 2TMPA 2HIVA 4POFA 4JBJA 3NK9A 1IYUA 2VNUD 4HEDA 3H94A 3MFYA 4P71A 4ZLTF 4GOPA 1DOMA 5JEAG 1M90C 4DR2L 2NUCA 5IP9H 4BA1I 5LL6S 2F0JA 4OWTB 4A3EB 3VR2A 4KMUC 2MO0A 1ET6A 3LGJA 3A5UA 2K50A 3S15B 3M4OH 4ZQ3A 4MZ9A 4YWMA 2O5JC 2N78A 3P20A 4QGUA 1I3QH 4KK7A 1F9RA 2KOLA 1HNZL 1JWUD 3NWSA 1EZ8A 2UXDL 1NY4A 1UE1A 2B2WC 4XTCS 2KHIA 2Y0SB 1DYQA 4KY5A 4JV5Q 1JCKB 5CV5A 1BF4A 2A6ED 4NMZA 2GA4B 4K14A 2F0TA 2UXBL 4DR6Q 4KD4A 3SDZA 1GVPA 5JJLA 3CD6A 4DAYB 4DV5L 2DJGC 1XMOL 4G7HC 3TZDA 2ZJPA 1A8VA 4JI8L 1LM0A 1RCVD 3EBEA 1K8MA 1KRTA 4G7OC 4LF7Q 1E3PA 3J7A5 4QQBX 3ERQA 1VQ9A 3J80E 1IBKL 2KEDA 4JI5L 3HOXG 3FPUB 4FXDA 1CM9A 3JC66 5C3EG 3KF8A 3E3XA 4FP5D 1R4QB 1XMQL 3HKZB 1EWHA 2F0HA 4ULLA 3SEBA 4DR5Q 2F0MA 1B44D 2RHQB 3HKSA 4GNXB 5C0XG 4JI4Q 3TP8A 3ND9A 1B9NA 1UNSA 1KNAA 4LUZA 3FPPA 3OTOQ 2ZXPA 1ZYRC 4RHRA 4GN3B 1VQEA 5H1SE 4YCWA 1X56A 5M3FB 3CHBD 5IWAQ 3BYYB 1A3UA 2V1CC 4A3GG 1RD9D 2CH4W 2XN9C 5CV4A 3S24A 2N3SA 1AN8A 1SFOH 4NXMQ 2PYKA 1A15A 1UAPA 4HMJA 2QCPX 4JI2Q 3T13A 2N8NA 1K0SA 3KOJA 1SYGA 3LX0A 3J7YW 4K5WA 1TY2A 4TSSA 2UUCL 3NBHA 3U50C 2E2JB 3DWQA 3SXHA 1I6HB 2FMCA 4PV1C 2JA6H 2EE1A 5CR3A 5LMNQ 2YU9H 2YU9B 4YWLA 1ONLA 1JC7A 1D7QA 3OWFA 1PZKD 3I4OA 1YJ9A 4HAEA 2YYZA 4B3SQ 3SK8A 1Y1VG 3PO3G 1YNJC 5FO8B 3MXUA 1VQ4A 3SK5A 2K28A 3PO2G 3S14B 3VA7A 5AJ3Q 3F2BA 4FO2A 1IBKQ 1NE3A 1K3RA 4CDCC 1SXTA 4XQQA 1AW7A 4L8JA 2LKVA 4KKTA 3D4WA 2JA6G 2PQEA 1ILPA 3HG9A 3J81j 4J6HA 3K80C 4HMIA 2NTTA 4GLAC 3H3VC 2B2TC 1EOVA 1L0XB 3BZCA 3E6ZX 4F7XA 2JJQA 5BN4A 2SEBD 3JAMc 2CW0D 5D14A 2JE6I 4EGVA 1AE2A 2AUKA 4IFDI 3TS0A 4PNYA 1SSOA 4BY1B 3JAME 2HHHQ 3D6CA 1Z6HA 3FEWX 2MO1A 2F3WA 3CRLC 2VUMG 5IYBG 1Q7YC 5G3LD 2VW9A 4LFBL 1ICWA 3NUCA 1IKMA 5CYUA 4A3BH 1JMCA 1KHIA 2E2IH 4X6AH 5JJZA 4BXXG 3BS1A 4RKLA 5C0XH 2R93H 4DV5Q 1F9SA 1PHJA 5C4JH 2ALYB 2WB1B 2JEAI 1HZBA 3S15H 2PO4A 1U4RA 1VQJA 4KD3A 5GROA 4X65L 1STGA 3NP8A 1L1OB 1MJCA 1QNKA 2MP1A 2ES2A 1KLGD 4K8IA 1MSHA 2Y0SE 1PFNA 4DR3L 4Y7NB 4C3JB 2YV5A 2E76C 5ELCA 3T1YL 1BCPD 3H91A 4B3TL 1EUJA 3PUXA 2G5DA 3RZDB 3RZOB 1WTOA 1F9QA 5KIXA 4R4IA 4H13C 1RIPA 4MTKA 1LT6D 1HCZA 1MD2D 4WORA 1NCVA 3D6WA 4B3TQ 1JJGA 4DK3C 3FMCA 1STBA 4P75A 3W3AA 1IZ6A 3RLNA 5DAUA 2SOBA 4R4OA 1C0AA 4JI3L 2ZM6L 4JPBW 4L6TB 1IW7D 2K7VA 2B63G 3CC2A 3MZ5A 5M9OA 3S9WA 1C9OA 4BS9A 1N9WA 4GOPC 1PLFA 3N6RA 2E2IB 2A73B 2AKWB 1SAPA 3TRZA 1CUKA 2VB2X 1STEA 5LMNW 4KLKA 3UDGA 2D9UA 1UUPA 2QW7A 2ZJQA 2O2LD 1JWMD 1PH2A 4YY3L 2PW5A 2ZXRA 1AZQA 1T5XD 4AQYQ 3KLSA 5CV7A 3TS2A 1E2VA 4L5TA 4IUVA 4GKKL 1TS4A 5LMNL 1Q1BA 2PW7A 1CZWA 4QB4A 1B2TA 3C1EA 3W2DA 5J39A 1VMCA 4R4TA 1HUNA 1JJ2A 1BKBA 5FLXE 1DGSA 1I6HH 1EOTA 5FLXc 2Z0SA 4GLVB 1HJPA 2WIIB 4JI0Q 2CWAA 2TSSA 1GKHA 3OW2A 5IIFA 2D5DA 2PNRC 1TWGH 1KXLA 1RHPA 1SYEA 4BWGB 4DAYA 1N36L 3QO2A 1MGSA 4KHZA 1I4GA 4BY1G 3WOEA 2JA5H 4C2MH 4DN4M 4A3DH 3KDFA 1TY0A 1H9RA 1S5ED 5ISRA 4POGA 2F0GA 3FDTA 4KN4C 3OHXC 2AUJD 2HD3A 1X3PA 3K7UC 4PZ6A 5CGKA 3EROA 2QGQA 1FVIA 3HOYG 4N9PA 1KAAA 4WRDA 4IO9A 1IBLL 4UP7A 4HJ9A 1LACA 4IQZA 4YY3Q 1I94Q 2VQFL 4ZKBB 1E2ZA 1CSQA 3OYYA 3C3LA 4NXNQ 1XWEA 3OTOL 2EYHA 3X3NA 1EIFA 5DLQE 4A3FH 1V1PA 3HOXB 1IL8A 1W6JA 2PZUA 4RWSC 4LFAQ 1JORA 2KA7A 1ENFA 3EQLC 4BBRH 2EXDA 3S2DH 4JV5L 4DV3L 3BDLA 2IT1A 1NTGA 5IGBA 3VR6A 1GOZA 3K6OA 1T9HA 3PIPA 4LFCQ 4K2KA 1G2TA 5JOBA 3QWNA 2ZM6Q 2EYLA 2HIXA 2LS01 1S5DD 1YNXA 3H0GH 1L1OC 2JK8A 1VQBA 3EVQA 1K8GA 2F0LA 2XIWA 5C3XA 2BA0A 4DV4L 1HR0W 4B9XA 1DJRD 1AE3A 5JAVA 3L9AX 4LF5L 4RH6A 2P5ZX 3TN2A 5LMUQ 4Y7NH 5M3MB 4H44C 3AYHB 5CORA 3A55A 1O7YA 4DKAC 1VMPA 3GP7A 5IYDG 2KECA 2DGYA 2K05A 2EYJA 4Q5VA 3IKJA 1L0WA 5C6AA 1BVSA 3UE0A 2HQLA 2B2UC 1ESRA 1UWVA 5M5YB 3GTMB 3PMFA 3JAMi 1IYJB 2OXPA 3U4ZA 5HURA 1W2BA 1HNZQ 2NVYH 4J1MA 1F2ZA 3DWAA 4GKKQ 1SYCA 2RVLA 1IL2A 2GVAA 4R9WA 5D65A 1PRTB 2YTYA 2VUMH 2XGTA 2RA4A 4RA8A 1C7YA 3KK7A 4A3DB 1Q8IA 4ABNA 2A19A 1V1PB 4QMGA 4LF7L 1EL0A 4UP9A 2SNSA 4GOPB 3CCSA 4O0AA 3HOUH 1LTSD 1JICA 4F8MA 4OX9Q 1DZ1A 1CHQD 2Z4IA 2OQ0A 3S2HH 1J5EL 1IW7C 4AQYL 1CFMA 1A0IA 5ELDA 5EKKA 1B53A 1Y14B 5M5XH 1Q86C 1L1OA 2K5WA 1EQVA 2F0IA 4KN7C 2KJXA 2IHFA 3QB3A 1KDBA 1BQQT 1SYFA 4YCUA 3H3VH 1W3SA 1I4XA 3AMUA 2KENA 4GLXA 5I2XA 2L12A 3PO3H 1MJEA 2UXCQ 1QILA 1TWHH 1ENCA 4O42A 3UE1A 2ASBA 5AFWA 2F4VQ 2FMMA 5CV8A 5CV9A 1HUMA 1PFSA 4K2LA 2B2VA 1NJIC 1LUZA 2NVTB 1E0BA 4HIDA 4A3LG 3SK6A 4KHPL 1K8AC 5C0XJ 4CDFC 1N34Q 2K6AA 5IY0A 2LFNA 4EQ5A 3GTLB 4HSPA 5KNDA 4LWCA 4AIMA 3UDIA 2K5DA 1E24A 1ML0D 4HTHA 1HNWQ 5LHY1 3R2TA 4A3GH 1I5FA 3H6MA 4TKOB 1EY8A 4BBSG 3EA6A 4DV7L 5E7NA 2M00A 1GJXA 4XYOA 4LF8Q 1CKNB 1DOKA 4N8X1 3BG3A 2OQKA 1LLRD 1LTRD 3NBIA 1V1OA 1PTOH 3MTSA 4JI1L 1X3QA 4RKBA 1NAPA 1KIXA 4JW0A 2RF4A 1TKWB 3KFUA 5EPJA 1Q3LA 1V43A 2EJGC 1GD7A 3M4PA 1II3A 5C4XB 1U9RA 3S17H 2I5HA 2DNCA 1SMXA 4N8FA 2HQEA 1HXYD 3EN2A 2DY7A 4DR4Q 4A3CH 5CBEE 3E5SA 4FF3A 3GTKB 1TWHB 5JJIA 4Y52H 4C3JH 3OWEB 1XTDA 2H5XA 4C1NI 3I4MB 3NBHB 5C44H 2E8GA 2NTSA 1HTPA 2L1BA 1Q81C 2F0KA 1CTMA 3TMEA 2EVBA 2JA8B 1I50H 2ID0A 2L15A 3GTGB 4B3ML 1SDFA 1WTWA 3H0GG 4C3IB 1C48A 2R7ZG 3GTLH 1VQGA 1HZ9A 2WAQE 3UI2A 2DJFC 3GO5A 3TSSA 2NZHA 2IY5B 3WOFA 2A1AA 1NMGA 3P1HA 3HOZB 4JI1Q 1YVCA 1ZEQX 4M8AA 5I9PA 4DUZL 3GD7A 1X54A 2CWPA 4J15A 1SBBB 1SN8A 1SMYC 4X62L 5IGGA 3N52A 2JXMB 2Q8IB 2IPKD 4X66L 4R8IA 1PH8A 3HOVG 2KCTA 5E4XA 5IGCA 4UP8A 1QVFA 4YWKA 4IPCA 2R61A 2WINB 3BVMA 5JEAH 3CQZB 1O7ZA 4IPDA 1KQSA 4H0LC 1QVGA 1HPCA 1JE5A 1ZYRD 3I72A 4C3HH 3M4QA 1B3QA 4GS3A 4LF6L 5FLXL 4KTAA 3TP6A 3VYTA 2RDFA 2EIFA 1YNND 4KV6A 4JI4L 1AFPA 1TS3A 1QVCA 4G7ZC 1B70B 4A3DG 2IWHA 3K59A 1TQOA 1PH7A 2B29A 1SROA 4Z9CB 2F4IA 3O13A 4A3IH 1OXUA 2IL8A 1PH6A 2JSOA 2E2JH 5ELNA 1D5MC 1Y8OB 3SHLA 3HZXA 4IN3A 3CF5A 2Z1CA 1Y1WB 1R9TB 4MNOA 3M7NA 4PQXA 4QIWB 1BBUA 4DV6Q 3MWYW 1TS5A 3S1NB 3U58A 1EIYB 2KHSA 4IFDJ 1BCPF 2MUYA 1B4OA 5JEAJ 2I46A 4JG2A 4N9TA 3RZDH 4JI6L 3QOJA 3M3YB 4A3JB 2JYOA 3ZYYX 4A3JH 4C3HG 4NPSA 1JB7A 1I94L 3U4VA 2JA8H 4JI7Q 3HOYB 1QZHA 1EY0A 4NXNL 2XWBB 1SE3A 3RMHA 1ET9A 1E2WA 2MQHA 3OMGA 4RGOS 4HIKA 3OMCA 5C4ZA 2EJMA 1HRJA 4DK0A 1XMOQ 3ITPA 2PMZE 2KCMA 2Z8LA 2F0FA 3MXNA 1UE7A 3OPOA 1H9JA 3J80i 1PA6A 1MKHA 1EYAA 3F2UA 1TWFH 2ICIA 4JI5Q 2AHOB 3M4YA 1K8OA 1VQHA 3HOWG 4YHHQ 2I07B 4M1UB 5JVH3 4RHSA 3EFXD 1ZXTA 2XVSA 3AB9A 5JVG3 2B63B 1U5KA 2NZ1D 1PH1A 1VQLA 1Z9FA 1CI3M 1JJCB 1HZCA 4A3MG 4DV0Q 2X69A 2PI2A 1TIID 2A8VA 3QR8A 1RDPD 3CQZH 4OEMB 2K52A 2Q2IA 1BR9A 2R7ZH 3M9BA 1FGBD 1PYBA 2PZWA 3J7ZC 3HFZB 2JEBI 2QA4A 3A8JE 4EQPA 2EY2A 4OWWB 3CXCA 1PXUA 3ULJA 4C3JG 2JA9A 2EYFA 1EQQA 1Q8KA 2A6EC 1MBYA 1CK1A 4F87A 1XMQQ 2WAQB 3BDCA 5FO7B 5C5LA 4RGNA 1AP0A 1WD0A 2MGSA 4JK1C 1EU4A 2XWJB 1HZAA 3KBGA 1VQKA 2F0NA 4ID6A 2A6HC 4I65A 2VQEL 5EPKA 3DHQA 1SNDA 1QCBD 3S1RB 4LF4Q 3S1RH 4LW1A 3NQTA 2RHSB 1XNRL 4A3KG 1X55A 1FNVA 4BXXH 2LSSA 3Q6SA 3TBIB 3HOZH 1F9PA 2EY1A 4A3BG 1YHQA 3Q23A 3NTKA 2JP1A 3MXNB 4DUYL 4BBSH 4PMCA 1P8LA 4IPHA 5G3LF 2K75A 3S1MB 2IJ0A 2HDMA 4FXKC 5K36H 4A3BB 1M8AA 3SR1A 1FNWA 3BU2A 3R8BA 1UE5A 4GKJQ 1YNNC 1F2YA 2L9HA 1CKNA 4DR2Q 1HNXQ 4OL7A 1TWCB 4NP5A 3T51B 2B2YA 5NUCA 1EFWA 2MFIA 4YIJA 1M4VA 2MJ8A 3KJPA 5I4DA 2UU9L 5EBCA 2MPMA 2F0PA 3IL8A 4HJAA 3TEHB 4HJ5A 1WOCA 4IUUA 3I3CA 4AH6A 3ZJYC 3GTQH 1LV9A 1KNEA 1PYWD 3PO2H 4V0BA 3GTOH 3IFDA 2YTXA 1I4QA 3AQQA 5C0XI 4X3SA 4PZ8A 1Y1VB 2NVQH 1OTCA 3PGZA 2ZT9C 4B08A 4ZK9B 1O7IA 4RCNA 4A3KB 1RKNA 3LWEA 1A3TA 1KTKA 1QJOA 2B2UA 4Q0FA 1BCPB 4F88A 3K7AH 1PFMA 3CCEA 2K03A 1I50B 3D8GA 3NTHA 1CSPA 1IHZA 4OHJA 2Q2TA 1SE2A 4RAUC 3J81L 4DR7L 3E0JA 3CCLA 2OT2A 4DR1Q 4A4IA 5I6YA 3I4NH 3HOUG 3GTKH 1VQCA 1PTOF 1KAWA 3DM3A 3T53B 2VQFQ 5GADC 1BDOA 4BBSB 5KNCA 2NB0A 4A93B 3T1HL 4UDUC 1IBMQ 2BDOA 3V96A 2WB1G 4LUVA 4ZUIA 2UXCL 4IUQA 4IUNA 5M5WB 2K33A 1HQMC 3PUYA 3AFPA 4KY6A 1BBXC 3FKIG 5FOBB 2VS1A 5C3EH 3MAQA 3HOXH 4OIKA 3K0XA 4DXFA 2NBFA 4ALPA 2ATWA 1EIGA 1WTXA 5IYDH 1PRTC 1HR0L 5D3DA 3GTQB 4GNXC 4DNTB 3UDFA 1WD1A 1QZGA 3HP3A 2KCNA 2R7ZB 3GTPB 3STBD 4DUYQ 2L4NA 5GQOA 1N34L 1RL2A 3SE0A 3I8ZA 4R8NA 4FDBA 2LMCB 4X65Q 2EDGA 5HGQA 2VQEQ 3CCQA 3K0YA 4WFN3 4GN4B 1Q46A 1Y8PB 3RZOH 1HNWL 2R6GA 3B6YA 2PQAA 1CQVA 1TWFB 1E1OA 1KRSA 2NN6G 2N88A 4S3SA 1JE4A 3I56A 1PMRA 3A54A 1R4PB 1DM0B 2KHJA 2E75C 4QF4A 3CCUA 1CT1D 1U0LA 1V1QA 1NUCA 1GUSA 1DONA 1X3EA 1RJTA 1XTCD 3TP7A 4DR5L 1D8LA 2IX3A 3HOYH 4H02A 3H15A 5E4WC 2IX1A 3VYSA 1DCZA 1VQOA 1LT3D 4KJOA 3BZDB 2MHVA 3LWUA 5M5XB 5GAHC 1U4PA 1PTOB 4XXEA 4JBMA 1XNRQ 4DAVA 3P75A 1XYIA 5C4XH 1SFOB 2QKIC 4FYDA 3TQYA 3RNUA 1PFBA 3KJOA 4JBKA 3GTOB 4A3IB 5A2QE 3E9IA 3GTPH 2E5LL 3PCOB 3PV0A 1Z7TA 1G6PA 1HQRD 4HCEA 1WYDA 3PUVA 2BA1A 1HA5A 1LTLA 3A8KE 3G6EA 4K6LA 1Q82C 4OONA 2KQ3A 4IUPA 1TT2A 1PYSB 4ZYSA 2PI2E 1YJNA 4EQNA 2F4VL 1NSNS 2ICEC 1VQIA 2QDLA 1OXSC 3KYHC 1EZ6A 1BXTA 1ESFA 1VQNA 5A35A 5DEHA 3S14H 1IBLQ 1YZ6A 3VR3A 2X6GA 4LF9Q 2A5HA 3A7LA 3CMAA 1JB3A 1A62A 4QCLA 1S4ZA 4KKUA 3MFGA 3CC7A 2M9VA 1WCMH 4L5QA 4UHVA 1WCMB 4MTNA 1TWGB 5IYCH 4DFAA 1WVLA 2V4DA 3D31A 4JI0L 1K83H 3OIPA 1X6OA 2I5MX 5M5YH 5IP7G 3VYUA 1HFNA 5IOCA 5L37A 2C9OA 5M3FH 4IJHA 1K3BC 3GQBA 4GN5A 4C1NK 1DD2A 3J7AV 2EZVA 3W1GA 1FR3A 2QILA 1S3OA 1KDAA 1I4PA 4LUOA 3HRZC 1N33L 2EJFC 1EU3A 2XRSD 2D62A 4LJZC 2AQ3B 2KEEA 1LYLA 3Q0AA 1F77A 2B63H 2WAQG 4EQOA 4O1NA 3SGIA 1PRTD 1VF7A 1G51A 4OO1H 5FJ8H 4JBWA 1AEXA 1QG7A 1S5CD 3DXJC 5DM73 4DV4Q 1XPOA 2OWOA 3HKZG 1I4HA 3CPFA 1AZPA 2K1BA 1LTTD 1WJJA 4J8QA 3MXGA 5C3EB 5EKIA 1FL0A 1SYDA 4DV3Q 2BH2A 1CA5A 1STYA 1IBML 1U4LA 2BDNA 3CC4A 2R92H 2EXZA 3MEFA 4DA2A 2JQOA 4TRDA 3MA2B 1G291 1E22A 2NN6I 1QWYA 1PTOD 2F3IA 1IYVA 1SRUA 2R7FA 3TZUA 3MVVA 3HKZE 2K5QA 3DLLA 1GXDC 1O7LA 1SE8A 2MNAA 5CBAE 1B7YB 1FGUA 3IAYA 3GTMH 1LABA 1Q90A 1UE6A 5FK9C 1PTOC 5FKAC 3DMUA 5F2DA 2R93G 2LXJA 1SNOA 3RN5A 5ELFA 2NVTH 3L7ZC 4HSVA 5T1GA 3AEVA 3KF8B 3KDFB 1HA6A 3GDEA 4I7AA 5JJKA 3NSWA 1IKLA 5IYBH 4B3MQ 2RSOA 4QL5A 1S5FD 3KBXA 3MXPA 3LNNA 1QE6A 3MC0B 1TR5A 4FXGC 4L5RC 2AWNA 3S16B 2VB3X 2EYOA 4QUFA 1G6ZA 1FJGL 4A3EG 2QEXA 1PZID 5J22A 3K7AB 2B2VC 1VQ6A 4FF4A 3QG1A 1EYDA 2Z6BA 1YHAA 2CKZB 3F1ZA 4A75A 3G6JB 1SE4A 2FJ2A 3S17B 5JPNC 1CA6A 2B2TA 1RODA 4DPGA 1PZJD 4A76A 2F52A 2PMZB 3NQIA 4A93G 4DU9A 2F0EA 2Z6KA 4DR3Q 4JCVE 3S1QB 2EY5A 2J7ZA 1TVXA 1X9NA 4B3RQ 5M3MG 2OF1A 3AU7A 4MIUA 2VXWA 5FLMH 5D3IB 1XJVA 2HUGA 4C3HB 1WTPA 1Y1VH 3L3OC 2K14A 3OOCA 2E2DC 5E3FA 4IOAA 4H7BA 1T5EA 1VQAA 4NXML 3K57A 1OO9B 3G4SA 2H1EA 4NKLA 3DM1A 1LO5D 3PIP3 1ENAA 4APVA 3ER0A 5AJ3L 5IODA 4G4KA 4XQNA 4DUZQ 1XPUA 2RDHA 5J3BA 1H9SB 4DK1A 4ILWA 1Z47A 1JOKA 3TDQA 1N32Q 4P74A 1GUGA 3I4NB 3ND8A 5BR8Q 3KLSX 4C2MB 3NELA 1GHKA 3GV3A 3VDYA 1TU2B 1QOHA 5CMDA 3C1FA 3I2ZA 1K73C 1BCPC 2CHBD 3K5MA 2UXBQ 1LTAD 3NEMA 1F2LA 1E7ZA 2Q2UA 1CQFA 3VR5A 1SEBD 2WB1E 3J81c 1I6VC 1STHA 1I3QB 2UUAQ 2R3ZA 2IW3A 1U4MA 3FKIH 2WFWA 3NTIA 1BUVT 3MHBA 4IJLA 1G2SA 2XSCA 1P16A 4CDEC 4R4CA 1EY6A 1YHBA 1A6XA 4MHEA 4A3FB 3H0GB 4PMWA 2CQAA 1K28A 4BBRB 1FD7D 1X3GA 4K0KL 2JA6B 2L55A 4V190 4X64L 3HGBA 4IUTA 2CW0C 5C44B 3M7GA 5C4JB 3I4NG 2F0DA 3CKIB 3BYTB 3NHHA 1EIHA 3W5OA 1HR0Q 4P72A 1YNJD 4BY7G 3I90A 4HR7B 4B9WA 2RKSA 2O5IC 4QIWE 2Q2HA 3S1QH 5COYA 1KC8C 4E6IA 2JA7B 4JYAL 1XX8A 1JWSD 2WP8J 5HY6A 3H3VI 2F0VA 2ZJRA 3OW7A 1SNPA 3S1MH 2CCZA 1GHJA 5FLMG 3T1HQ 4RFBA 4DAPA 4KJNA 5M3MH 3KLWA 1HFGA 5LMUL 2LXKA 1VDZA 4A3GB 3M3YH 5ELOA 2B2YC 2Q8TA 5IP9G 5BN5A 4A3MB 4CKEA 4LF6Q 2AQ1B 1S5BD 2RSNA 1PH3A 5KEEA 2Z4HA 1OXVA 1JOOA 1QNUA 1EWCA 3J80c 1VCIA 1GUNA 1MI2A 3U9OA 5A2QL 5IT9L 4NB3A 4ME5A 4RGMA 3TP5A 4A3EH 3CP0A 2NZOA 2QF7A 4DR4L 1I4RA 2FFKB 5K36G 5GAGC 3I55A 1SNCA 4EX5A 3M85A 4K8JA 3OSOA 2ZTCA 3OIQA 4OX9L 1KLUD 2F1MA 3GTGH 1LTBD 3NPPA 3K5NA 1ICFB 5J1ZA 1UEBA 2G9DA 4A3KH 3RD4A 4R4QA 2QEJC 5ELEA 4C3IG 1KABA 5TSSA 2FINB 3J81E 3PO2B 4PMBA 1J6QA 4P2CB 1TWAB 3W1BA 4LF5Q 4JYAQ 1NNXA 1TS2A 4XYQA 4CJ2C 3EJIA 1L2FA 5EKLA 3I4MG 3VA5A 1JOQA 4DV0L 3HEJA 5C3WA 1GO3E 3I7FA 2RCNA 4XQJA 4L63B 3URYA 3R3OA 2EY6A 1WTQA 1CHPD 2BE5C 2NYZD 3F8TA 2WV6D 1GUTA 4QJFA 4IFDG 3FKIB 3R2IA 2NVXH 2C5CA 5I9OA 4A3MH 5C4HA 1B8AA 1JR0D 4P73A 2K04A 5ELBA 2B8FA 3RUZA 5KGUA 2L0CA 4OO1G 1YJWA 1J9OA 1NBWA 1B1ZA 2AMCB 4X3TA 1STAA 4DF7A 4JOIC 2EOTA 3J80L 4DR1L 4ZRZA 4UPAA 3Q8DA 3SK4A 1NMFA 1D5XC 1YIJA 4TQUS 4IOCA 1G8ZD 2PCFB 2X6LA 4UAIA 1WTHA 1YITA 3T1YQ 4CDDC 4JI3Q 2N49A 3P7JA 4K5VA 1Y1WH 1R9TH 1V8QA 2OTJA 3BJUA 3S2HB 3CRKC 4ME3A 4TVAB 4K0KQ 2L11A 4XIGS 1A63A 4X3UA 1KD1C 2IHEA 4B3RL 2KBNA 2EPBA 1A2UA 3I70A 4DGZA 2OTLA 3BZKA 1LTGD 2KVMA 1XNQL 5IGDA 2A6HD 1S40A 3I4MH 1TXYA 2HCIA 3DEOA 3G7LA 4DR6L 1KDCA 4K5XA 5IGFA 3QJYA 1SNQA 1N33Q 3RLFA 5KYIA 2JA5B 3WDNA 1LTID 4AYBB 1STNA 2VY3A 4FNFA 5IT9c 4X62Q 4OWXB 4HIOA 2K32A 3D3RA 5IE8A 1Y8NB 5KRUA 4GKJL 2XRQD 4QY7A 2OEOA 2UUBQ 4DK6C 3K8AA 1VQ8A 2CQOA 1FNUA 2EQSA 4OGQC 2R7DA 4RCOA 1LT5D 3I4LA 2Q8RE 2B2WA 1EFID 4C56C 1SR3A 4U68A 2K5VA 4A3IG 1B3AA 4CHTB 3WWVA 3KF6A 2O4XA 4ZAIA 5C4XG 2KCCA 1EY4A 3PUWA 4X66Q 4FF2A 3EIVA 4QUCA 5KNBA 2K5NA 5JPMC 4I7ZC 4DNRB 2NVYB 4HN7A 2EYPA 5I2YA 2N55A 5M5WH 2DN8A 1J8IA 3FP9A 5GAEC 3GV6A 5CV6A 4U673 2GVBA 1NR4A 4KY7A 1RTOA 2D2CC 1VQ7A 1PRTF 3PIO3 1SMYD 4CKCA 3D0FA 1CKMA 1EQTA 3G48A 5BN3A 1JT8A 1H9KA 1GUOA 4YCVA 3TREA 4DV2L 2A69C 3HOVH 2PZTA 3DWPA 2QDBA 2JN4A 5E1FA 4GZYC 4LFBQ 1VQPA 2BOSA 3V2TA 2NN6H 4PG3A 2SNMA 3FHWA 4G57A 2J0TD 5CC4A 3AFQA 2JA7G 2H4OA 4ZUJA 3HOUB 3V05A 1AH9A 1PDQA 3L2PA 1FJGQ 1BO0A 4BY7H 2UUBL 2BE5D 4FF1A 5IWAL 3NXWA 1D5ZC 2CFMA 1VQDA 2BH8A 4MN3A 3NE5B 1TWAH 3U9SA 1N8RC 2YTVA 1EQRA 1C8CA 2E2HH 1GM5A 4X64Q 3NWTA 1SLJA 5C44G 1H9MA 4HJ7A 2XTIA 1XPRA 2GN5A 1DOLA 3T56B 4IURA 4A3CG 1X32A 3BVGA 3C2PA 2UUCQ 3G71A 2K4KA 3KF6B 1YBYA 2KUMA 4O2DA 1BBWA 3ULLA 2RQXA 2ZTDA 4XDXA 1KL9A 4EVOA 1G91A 1D6EC 1SJHD 4JC0A 4DNIA 2D0OA 3MEHA 2Z9HA 4LMQD 1B50A 1FYCA 2Y0SG 3C46A 2HT1A 1W6KA 2DY8A 2E74C 3CCMA 4UY8C 3CMEA 1VQFA 4WJ3M 1O78A 3F2CA 1K83B 4DV2Q 2F0UA 1Q1EA 3F2DA 2ZTEA 2K01A 4B3SL 2D0PA 1EYCA 2F3VA 5EJWA 1L0YB 4XT3B 4LFAL 4RMFA 1N32L 1EY7A 2FHTA 2PNHA 4DXGA 4CJ1B 1WTRA 4LAAA 1RF2D 2FXQA 4CJ0B 2UU9Q 2C35B 2K5HA 4CGYB 4IZ8A 3RLOA 3S2DB 5I6WA 3J81i 4A3LH 1RTNA 3S1NH 5T1IA 2HCCA 4R1JA
chains in the Genus database with same CATH topology
4NDXA 1C4QA 3PUZA 1EEFD 2AQ2B 1MSGA 2M2LA 3D4DA 3HOWB 3K58A 1XXGA 4WJWA 1D1KA 3FRPB 1H9SA 4ODGA 1SJED 5EGTA 5IT9E 1NR2A 4OO1I 1EY9A 1LT4D 5HGTA 3ONAB 4IALA 1JQYD 4X3KA 3KUPA 2G9HD 2DNEA 5KYLA 3DUZA 3M4OB 2SDFA 3HOVB 4K6DA 1A2TA 3SVMA 1D1IA 2CVRA 3PO3B 4RGTA 3DEPA 2XNAC 3H09A 2F0OA 2ZXOA 3VR4A 5FO9B 3JAML 2R93B 1OXXK 1GUWA 1SYBA 1CZGA 4KHVA 5C5MA 1Q12A 4HCSA 4OIJA 2B8GA 1D2BA 4XT1B 1EY5A 1F2MA 2RDGA 1BOSA 4BY7B 2NWGA 1UEAB 1DXMA 1BNZA 2R92B 5DNFA 3T16A 2RBMA 3K5LA 2F0WA 2PPBC 3A8IE 2F0QA 3Q22A 3CU7A 1O80A 2EYMA 3K5OA 3T4AC 2F03A 2VUMB 3J7AF 3Q24A 2LY7A 5EBDA 3KLRA 2BCOA 3D4RA 4FVMA 1Y69U 2F0SA 1ZKOA 1WTVA 2A69D 4KI0A 3HS0C 4IFDH 1EEID 5K5PA 1QB5D 5EPLA 3BVZA 3A56A 4ZKCB 4NW2A 3I73A 2NVQB 4LK1C 2A74C 2WKDA 5IGEA 3QIAA 3VYRA 2WKCA 2IX0A 3IFTA 3I91A 1B9MA 1HTLD 3X3MA 5LL6X 2AWOA 4BA2I 1HHVA 1A3VA 5EQ0A 1VF5C 2L5TA 1SNMA 2J4XA 2NVXB 2A68C 2WACA 2B39A 4KKSA 3A7AB 1OXTA 1ILQA 2A68D 2E2HB 4CBVA 3R93A 4CKBA 2HDLA 3GTJB 3FVQA 2ENBA 3BDOA 5DM63 3QOLA 2TMPA 3NK9A 1IYUA 2VNUD 4HEDA 3H94A 3MFYA 4ZLTF 1DOMA 5JEAG 2NUCA 4BA1I 5LL6S 2F0JA 4A3EB 3VR2A 4KMUC 1ET6A 3S15B 4ZQ3A 2O5JC 3P20A 4KK7A 1F9RA 2KOLA 1JWUD 3NWSA 1EZ8A 2B2WC 4XTCS 2Y0SB 1DYQA 4KY5A 1JCKB 5CV5A 1BF4A 2A6ED 4NMZA 2GA4B 4K14A 2F0TA 4KD4A 3SDZA 4G7HC 3TZDA 1RCVD 1K8MA 4G7OC 3ERQA 3J80E 2KEDA 4FXDA 3FPUB 1CM9A 3KF8A 4FP5D 1R4QB 3HKZB 1EWHA 3SEBA 2F0HA 4ULLA 2F0MA 1B44D 5C0XG 3TP8A 3ND9A 1B9NA 1UNSA 1KNAA 3FPPA 2ZXPA 1ZYRC 4RHRA 5M3FB 3CHBD 3BYYB 1A3UA 1RD9D 2XN9C 5CV4A 1AN8A 2PYKA 1A15A 1UAPA 2QCPX 4HMJA 3T13A 1SYGA 3LX0A 3J7YW 4K5WA 1TY2A 4TSSA 3NBHA 2E2JB 3DWQA 3SXHA 1I6HB 2FMCA 4PV1C 2EE1A 5CR3A 2YU9B 1ONLA 1JC7A 3OWFA 1PZKD 4HAEA 2YYZA 3SK8A 5FO8B 1YNJC 3MXUA 3SK5A 2K28A 3S14B 3VA7A 4FO2A 1SXTA 4XQQA 1AW7A 4L8JA 2LKVA 4KKTA 3D4WA 2PQEA 1ILPA 3HG9A 4J6HA 4HMIA 2NTTA 3H3VC 2B2TC 1L0XB 3E6ZX 4F7XA 5BN4A 2SEBD 2CW0D 5D14A 2JE6I 4EGVA 2AUKA 4IFDI 4PNYA 1SSOA 4BY1B 3JAME 3D6CA 1Z6HA 3FEWX 2F3WA 3CRLC 5G3LD 1ICWA 3NUCA 1IKMA 5CYUA 5JJZA 3BS1A 4RKLA 5C0XH 1F9SA 2WB1B 2JEAI 2PO4A 1U4RA 4KD3A 1STGA 3NP8A 1QNKA 2MP1A 1KLGD 4K8IA 1MSHA 1PFNA 4Y7NB 4C3JB 2E76C 5ELCA 1BCPD 3H91A 3PUXA 3RZOB 3RZDB 1WTOA 1F9QA 5KIXA 4H13C 1LT6D 1HCZA 1MD2D 4WORA 1NCVA 3D6WA 3FMCA 1STBA 3W3AA 5DAUA 2SOBA 4L6TB 1IW7D 2K7VA 3MZ5A 5M9OA 3S9WA 4BS9A 1PLFA 3N6RA 2E2IB 2A73B 1SAPA 2VB2X 1STEA 2D9UA 1UUPA 2O2LD 1JWMD 2PW5A 2ZXRA 1AZQA 1T5XD 3KLSA 5CV7A 1E2VA 4IUVA 1TS4A 1Q1BA 2PW7A 1CZWA 4QB4A 1B2TA 3C1EA 3W2DA 5J39A 1VMCA 1HUNA 5FLXE 1EOTA 2WIIB 2TSSA 5IIFA 2D5DA 2PNRC 1RHPA 1SYEA 4BWGB 4DAYA 3QO2A 1MGSA 4KHZA 1I4GA 3WOEA 4DN4M 1TY0A 1H9RA 1S5ED 5ISRA 2F0GA 3FDTA 4KN4C 3OHXC 2AUJD 1X3PA 5CGKA 3EROA 4N9PA 1KAAA 4WRDA 1LACA 4IQZA 4ZKBB 1E2ZA 3C3LA 1XWEA 2EYHA 3X3NA 1V1PA 3HOXB 1IL8A 1W6JA 2PZUA 4RWSC 1JORA 2KA7A 1ENFA 3EQLC 3BDLA 2IT1A 5IGBA 3VR6A 1GOZA 3K6OA 4K2KA 1G2TA 5JOBA 3QWNA 2EYLA 2LS01 1S5DD 3EVQA 2F0LA 5C3XA 2XIWA 2BA0A 4B9XA 1DJRD 5JAVA 3L9AX 4RH6A 3TN2A 5M3MB 4H44C 5CORA 3A55A 1O7YA 1VMPA 3GP7A 2KECA 2K05A 2EYJA 4Q5VA 3IKJA 5C6AA 2B2UC 1ESRA 5M5YB 3GTMB 3PMFA 2OXPA 5HURA 4J1MA 1F2ZA 3DWAA 1SYCA 2RVLA 4R9WA 5D65A 1PRTB 2RA4A 4RA8A 3KK7A 4A3DB 1Q8IA 4ABNA 1V1PB 4QMGA 1EL0A 2SNSA 1LTSD 1JICA 4F8MA 1DZ1A 1CHQD 2Z4IA 1IW7C 1CFMA 5ELDA 5EKKA 1B53A 2K5WA 1EQVA 2F0IA 4KN7C 2KJXA 3QB3A 1KDBA 1BQQT 1SYFA 1I4XA 3AMUA 5I2XA 2L12A 1QILA 1ENCA 4O42A 5AFWA 2FMMA 5CV8A 5CV9A 1HUMA 4K2LA 2B2VA 2NVTB 1E0BA 3SK6A 5C0XJ 2K6AA 2LFNA 3GTLB 4HSPA 5KNDA 2K5DA 1ML0D 4HTHA 5LHY1 3R2TA 3H6MA 4TKOB 1EY8A 3EA6A 2M00A 1GJXA 4XYOA 1DOKA 3BG3A 1LLRD 1LTRD 3NBIA 1V1OA 1PTOH 3MTSA 1X3QA 4RKBA 1NAPA 1TKWB 5EPJA 1V43A 1Q3LA 2EJGC 5C4XB 1II3A 1U9RA 2DNCA 2HQEA 1HXYD 2DY7A 3GTKB 5CBEE 3E5SA 4FF3A 1TWHB 3OWEB 4C1NI 3I4MB 2NTSA 1HTPA 2L1BA 2F0KA 1CTMA 3TMEA 2EVBA 2JA8B 2ID0A 3GTGB 1SDFA 1WTWA 4C3IB 1C48A 3UI2A 3GO5A 3TSSA 3WOFA 3P1HA 3HOZB 1ZEQX 4M8AA 5I9PA 3GD7A 1SBBB 1SMYC 5IGGA 3N52A 2JXMB 2Q8IB 2IPKD 4R8IA 5E4XA 5IGCA 2R61A 2WINB 3BVMA 5JEAH 3CQZB 1O7ZA 4H0LC 1HPCA 1ZYRD 3I72A 5FLXL 4KTAA 3TP6A 3VYTA 2RDFA 1YNND 4KV6A 1AFPA 1TS3A 4G7ZC 2IWHA 3K59A 1TQOA 4Z9CB 2F4IA 3O13A 1OXUA 2IL8A 2JSOA 1D5MC 1Y8OB 3SHLA 3HZXA 4IN3A 2Z1CA 1Y1WB 1R9TB 3M7NA 4PQXA 4QIWB 3MWYW 1TS5A 3S1NB 2KHSA 4IFDJ 1BCPF 2MUYA 1B4OA 5JEAJ 2I46A 4N9TA 3QOJA 3M3YB 4A3JB 2JYOA 3ZYYX 4C3HG 3HOYB 1EY0A 2XWBB 1SE3A 3RMHA 1ET9A 1E2WA 3OMGA 4RGOS 3OMCA 5C4ZA 2EJMA 1HRJA 4DK0A 3ITPA 2Z8LA 3MXNA 2F0FA 3OPOA 1H9JA 1EYAA 3F2UA 2ICIA 1K8OA 3M4YA 2I07B 4M1UB 5JVH3 4RHSA 3EFXD 1ZXTA 2XVSA 3AB9A 5JVG3 2B63B 2NZ1D 1CI3M 2X69A 1TIID 1RDPD 1BR9A 1FGBD 2PZWA 2JEBI 3A8JE 4EQPA 2EY2A 1PXUA 4C3JG 2EYFA 2A6EC 1MBYA 1CK1A 4F87A 2WAQB 3BDCA 5FO7B 5C5LA 4RGNA 1AP0A 1WD0A 2MGSA 4JK1C 1EU4A 2XWJB 3KBGA 2F0NA 4ID6A 2A6HC 4I65A 5EPKA 3DHQA 1SNDA 1QCBD 3S1RB 3NQTA 1FNVA 3TBIB 3Q6SA 1F9PA 2EY1A 3Q23A 3NTKA 2JP1A 4PMCA 5G3LF 3S1MB 2IJ0A 2HDMA 4FXKC 5K36H 4A3BB 1M8AA 3SR1A 1FNWA 3R8BA 1YNNC 1F2YA 2L9HA 4OL7A 1TWCB 4NP5A 3T51B 2B2YA 5NUCA 4YIJA 1M4VA 2MJ8A 5I4DA 5EBCA 2MPMA 2F0PA 3IL8A 4IUUA 3I3CA 1LV9A 1KNEA 1PYWD 4V0BA 3IFDA 1I4QA 5C0XI 4X3SA 1Y1VB 2ZT9C 4B08A 4ZK9B 4RCNA 4A3KB 1RKNA 3LWEA 1A3TA 1KTKA 1QJOA 2B2UA 4Q0FA 1BCPB 4F88A 1PFMA 2K03A 1I50B 3D8GA 3NTHA 1IHZA 4OHJA 3J81L 1SE2A 4RAUC 3E0JA 2OT2A 5I6YA 1PTOF 3T53B 1BDOA 4BBSB 5KNCA 2NB0A 4A93B 4UDUC 2BDOA 3V96A 4ZUIA 4IUQA 4IUNA 5M5WB 2K33A 1HQMC 3PUYA 4KY6A 1BBXC 5FOBB 3MAQA 4OIKA 4DXFA 2NBFA 1EIGA 1WTXA 1PRTC 5D3DA 3GTQB 4DNTB 1WD1A 3HP3A 2KCNA 2R7ZB 3GTPB 2L4NA 3SE0A 3I8ZA 4R8NA 2LMCB 2EDGA 3K0YA 4WFN3 1Y8PB 2R6GA 1CQVA 1TWFB 2NN6G 2N88A 4S3SA 1JE4A 1PMRA 3A54A 1R4PB 1DM0B 2E75C 4QF4A 1CT1D 1NUCA 1GUSA 1DONA 1RJTA 1XTCD 3TP7A 2IX3A 5E4WC 2IX1A 3VYSA 1DCZA 1LT3D 4KJOA 3BZDB 2MHVA 3LWUA 5M5XB 1U4PA 1PTOB 4XXEA 4DAVA 3P75A 1XYIA 1SFOB 2QKIC 4FYDA 1PFBA 3GTOB 4A3IB 5A2QE 3PV0A 1Z7TA 1HQRD 4HCEA 3PUVA 2BA1A 1HA5A 3A8KE 4K6LA 2KQ3A 4IUPA 1TT2A 4ZYSA 4EQNA 1NSNS 2ICEC 1OXSC 1EZ6A 1BXTA 1ESFA 5A35A 5DEHA 3VR3A 2X6GA 2A5HA 3A7LA 1JB3A 4QCLA 1S4ZA 4KKUA 3MFGA 2M9VA 1WCMB 1TWGB 4DFAA 1WVLA 2V4DA 3D31A 3OIPA 3VYUA 1HFNA 5IOCA 2C9OA 3GQBA 4C1NK 1DD2A 3J7AV 2EZVA 1FR3A 2QILA 1KDAA 1I4PA 3HRZC 2EJFC 1EU3A 2XRSD 2D62A 4LJZC 2AQ3B 2KEEA 3Q0AA 1F77A 4EQOA 4O1NA 1PRTD 1VF7A 4OO1H 4JBWA 1AEXA 1QG7A 1S5CD 3DXJC 5DM73 1I4HA 1AZPA 2K1BA 1LTTD 4J8QA 3MXGA 5C3EB 5EKIA 1SYDA 1CA5A 1STYA 1U4LA 2BDNA 2EXZA 4DA2A 4TRDA 3MA2B 1G291 2NN6I 1QWYA 1PTOD 1IYVA 3TZUA 3MVVA 2K5QA 1GXDC 1O7LA 5CBAE 3IAYA 1LABA 1Q90A 5FK9C 1PTOC 5FKAC 3DMUA 5F2DA 1SNOA 5ELFA 3L7ZC 4HSVA 5T1GA 1HA6A 3NSWA 1IKLA 2RSOA 1S5FD 3KBXA 3MXPA 3LNNA 1QE6A 3MC0B 1TR5A 4FXGC 2AWNA 3S16B 2VB3X 2EYOA 4QUFA 1G6ZA 1PZID 5J22A 3K7AB 2B2VC 4FF4A 3QG1A 1EYDA 3G6JB 1SE4A 2FJ2A 3S17B 1CA6A 5JPNC 2B2TA 1RODA 1PZJD 2PMZB 3NQIA 4DU9A 2F0EA 3S1QB 2EY5A 2J7ZA 1TVXA 2OF1A 3AU7A 4MIUA 2VXWA 5D3IB 2HUGA 4C3HB 1WTPA 3L3OC 5E3FA 3OOCA 2E2DC 4H7BA 1T5EA 3K57A 1OO9B 2H1EA 4NKLA 3DM1A 1LO5D 3PIP3 1ENAA 5IODA 4G4KA 4XQNA 2RDHA 1H9SB 4DK1A 4ILWA 1Z47A 1JOKA 3TDQA 1GUGA 3I4NB 3ND8A 3KLSX 4C2MB 1GHKA 3GV3A 1TU2B 1QOHA 5CMDA 3C1FA 1BCPC 2CHBD 3K5MA 1LTAD 1F2LA 1CQFA 3VR5A 1SEBD 1I6VC 1STHA 1I3QB 2R3ZA 2IW3A 1U4MA 3NTIA 1BUVT 3MHBA 1G2SA 2XSCA 1EY6A 1A6XA 4MHEA 4A3FB 3H0GB 4PMWA 2CQAA 4BBRB 1FD7D 2JA6B 2L55A 4V190 3HGBA 4IUTA 2CW0C 5C44B 3M7GA 5C4JB 2F0DA 3CKIB 3BYTB 3NHHA 1EIHA 1YNJD 3I90A 4HR7B 4B9WA 2RKSA 2O5IC 5COYA 4E6IA 2JA7B 1XX8A 1JWSD 2WP8J 2F0VA 3OW7A 1SNPA 1GHJA 4RFBA 4DAPA 4KJNA 1HFGA 1VDZA 4A3GB 2B2YC 2Q8TA 5BN5A 4A3MB 4CKEA 2AQ1B 1S5BD 2RSNA 5KEEA 2Z4HA 1OXVA 1JOOA 1QNUA 1EWCA 1VCIA 1GUNA 1MI2A 3U9OA 5A2QL 5IT9L 4ME5A 4RGMA 3TP5A 2QF7A 1I4RA 2FFKB 5K36G 1SNCA 3M85A 4K8JA 3OSOA 3OIQA 1KLUD 2F1MA 1LTBD 3NPPA 3K5NA 5J1ZA 2G9DA 3RD4A 2QEJC 5ELEA 4C3IG 1KABA 5TSSA 2FINB 3J81E 3PO2B 4PMBA 4P2CB 1TWAB 4XYQA 1TS2A 4CJ2C 3EJIA 5EKLA 3VA5A 1JOQA 3HEJA 5C3WA 4XQJA 4L63B 3URYA 3R3OA 2EY6A 1WTQA 1CHPD 2BE5C 2NYZD 2WV6D 1GUTA 4IFDG 3FKIB 3R2IA 2C5CA 5I9OA 5C4HA 1JR0D 5ELBA 3RUZA 2K04A 4OO1G 2B8FA 5KGUA 2L0CA 1J9OA 1B1ZA 4X3TA 1STAA 4DF7A 2EOTA 3J80L 4ZRZA 3SK4A 1D5XC 4TQUS 1G8ZD 2PCFB 2X6LA 4UAIA 3P7JA 4K5VA 1V8QA 3S2HB 3CRKC 2L11A 4XIGS 4X3UA 2EPBA 1A2UA 3I70A 4DGZA 1LTGD 2KVMA 5IGDA 2A6HD 3G7LA 2HCIA 3DEOA 1KDCA 4K5XA 5IGFA 3QJYA 1SNQA 3RLFA 5KYIA 2JA5B 3WDNA 1LTID 4AYBB 1STNA 4FNFA 2K32A 3D3RA 5KRUA 1Y8NB 2XRQD 2OEOA 1FNUA 4RCOA 4OGQC 1LT5D 3I4LA 2Q8RE 2B2WA 1EFID 4C56C 4U68A 1B3AA 4CHTB 2O4XA 4ZAIA 2KCCA 1EY4A 3PUWA 4FF2A 4QUCA 5KNBA 5JPMC 4I7ZC 4DNRB 2NVYB 5I2YA 4HN7A 2EYPA 2N55A 2DN8A 1J8IA 3GV6A 5CV6A 4U673 1NR4A 4KY7A 1RTOA 2D2CC 1PRTF 3PIO3 1SMYD 4CKCA 1EQTA 5BN3A 1H9KA 1GUOA 2A69C 2PZTA 3DWPA 2QDBA 5E1FA 4GZYC 2BOSA 3V2TA 2NN6H 2SNMA 4G57A 2J0TD 5CC4A 2H4OA 4ZUJA 3HOUB 3V05A 1PDQA 1BO0A 2BE5D 4FF1A 3NXWA 1D5ZC 4MN3A 3NE5B 3U9SA 1C8CA 3NWTA 1H9MA 1DOLA 3T56B 4IURA 1X32A 3BVGA 3C2PA 2KUMA 2RQXA 4XDXA 4EVOA 1G91A 1D6EC 1SJHD 3MEHA 4LMQD 1B50A 1FYCA 3C46A 1W6KA 2DY8A 2E74C 1O78A 1K83B 2F0UA 1Q1EA 2K01A 1EYCA 2F3VA 5EJWA 1L0YB 4XT3B 1EY7A 2FHTA 4DXGA 1WTRA 4CJ1B 4LAAA 1RF2D 4CJ0B 4CGYB 4IZ8A 3S2DB 5I6WA 1RTNA 5T1IA 2HCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBF A;  1AFP A;  2NB0 A;  2MHV A;  2KCN A; 
#chains in the Genus database with same CATH topology
 4NDX A;  2JA7 H;  1C4Q A;  2RCF A;  1K0R A;  3PUZ A;  1EEF D;  1H95 A;  2AQ2 B;  2E5L Q;  1MSG A;  2M2L A;  3D4D A;  3HOW B;  3K58 A;  4LNQ A;  1XXG A;  4WJW A;  1D1K A;  3FRP B;  4DV1 Q;  1X3F A;  1H9S A;  4ODG A;  4LF8 L;  3UDX A;  1SJE D;  1PH4 A;  5EGT A;  5IT9 E;  1NR2 A;  4OO1 I;  1EY9 A;  1LT4 D;  3E0E A;  1PH5 A;  4A93 H;  1IXR A;  5HGT A;  3ONA B;  4DAM A;  4IPG A;  4GNX A;  4IAL A;  1E1T A;  1JQY D;  4X3K A;  3KUP A;  2G9H D;  2DNE A;  3CAM A;  5KYL A;  2UUA L;  3DUZ A;  2DUD A;  3IRB A;  4LFC L;  3M4O B;  2SDF A;  4YHH L;  3HOV B;  1WI5 A;  4HIM A;  4ZCK A;  5EAY A;  4K6D A;  1A2T A;  1N36 Q;  3SVM A;  1K9M C;  3STB C;  1D1I A;  4DV6 L;  2CVR A;  3PO3 B;  4RGT A;  3HOZ G;  3DEP A;  4LF9 L;  2XNA C;  3H09 A;  2F0O A;  2ZXO A;  3VR4 A;  5FO9 B;  3JAM L;  2R93 B;  1OXX K;  2UXD Q;  4JI8 Q;  4JOI A;  1GUW A;  4AYB E;  3ULP A;  1SYB A;  1CZG A;  4KHV A;  4JI7 L;  1YEZ A;  4RG1 A;  3PQI A;  5C5M A;  4KHP Q;  1Q12 A;  4HCS A;  4OIJ A;  2B8G A;  2CH4 A;  1D2B A;  4XT1 B;  1EY5 A;  1F2M A;  3GTJ H;  2RDG A;  4HJ8 A;  1ASY A;  3CCV A;  3CCR A;  1BOS A;  2R92 G;  2I0Q A;  1PVO A;  4BY7 B;  2NWG A;  1QUQ A;  1UEA B;  3A74 A;  1DXM A;  4LF4 L;  1Y1W G;  1BNZ A;  2R92 B;  4DR7 Q;  2PQA B;  3K81 C;  5DNF A;  3T16 A;  2RBM A;  3K5L A;  2VZA A;  2F0W A;  1HH2 P;  2OCE A;  5FJ8 G;  3PIO A;  1CKO A;  2PPB C;  3A8I E;  2F0Q A;  2I5L X;  3Q22 A;  3CU7 A;  1O80 A;  2EYM A;  3K5O A;  3T4A C;  1VQM A;  2F03 A;  2VUM B;  3J7A F;  4BBR G;  3Q24 A;  1TWC H;  1VQ5 A;  2LY7 A;  3HOW H;  1EYG A;  5EBD A;  3KLR A;  1EWI A;  2BCO A;  3D4R A;  4FVM A;  4A3F G;  1VS0 A;  1Y69 U;  2VL6 A;  1S72 A;  2F0S A;  3NEN A;  3S16 H;  1ZKO A;  1WTV A;  2A69 D;  1X65 A;  3ICE A;  1HNX L;  4JVZ A;  4WJ4 A;  1PH9 A;  5M3F G;  4KI0 A;  1V9P A;  3HS0 C;  4IFD H;  4JI2 L;  5IP7 H;  1EEI D;  5K5P A;  1QB5 D;  5EPL A;  3BVZ A;  4PZ7 A;  3A56 A;  1XNQ Q;  3RN2 A;  4ZKC B;  1YI2 A;  4NW2 A;  3I73 A;  5IYC G;  3ERS X;  2JA8 G;  4A3J G;  1WCM G;  2NVQ B;  4LK1 C;  4DV1 L;  4OEL B;  3CW2 C;  3PF5 A;  2A74 C;  3A5Z B;  2WKD A;  4L5S A;  5IGE A;  3L0O A;  3E9H A;  3QIA A;  3VYR A;  2WKC A;  2IX0 A;  4AYB G;  3IFT A;  3I91 A;  3CCJ A;  1B9M A;  1HTL D;  2JA5 G;  4BY1 H;  3RR5 A;  1J5E Q;  3X3M A;  1ASZ A;  4OXP A;  5LL6 X;  2AWO A;  4BA2 I;  1HHV A;  1A3V A;  5EQ0 A;  1VF5 C;  4C3I H;  2L5T A;  1SNM A;  2J4X A;  5BR8 L;  2NVX B;  2A68 C;  1MIU A;  2WAC A;  2B39 A;  4KKS A;  1QUQ B;  3CPW A;  3PF4 A;  3A7A B;  1OXT A;  1ILQ A;  3PSI A;  2HHH L;  2B3G A;  4JI6 Q;  4DV7 Q;  1MHW C;  2A68 D;  2E2H B;  4CBV A;  3A0J A;  1M1K C;  3R93 A;  4CKB A;  2Z6K C;  1PV4 A;  2HDL A;  1WFQ A;  3GTJ B;  3FVQ A;  2ENB A;  3BDO A;  5DM6 3;  3QOL A;  2TMP A;  2HIV A;  4POF A;  4JBJ A;  3NK9 A;  1IYU A;  2VNU D;  4HED A;  3H94 A;  3MFY A;  4P71 A;  4ZLT F;  4GOP A;  1DOM A;  5JEA G;  1M90 C;  4DR2 L;  2NUC A;  5IP9 H;  4BA1 I;  5LL6 S;  2F0J A;  4OWT B;  4A3E B;  3VR2 A;  4KMU C;  2MO0 A;  1ET6 A;  3LGJ A;  3A5U A;  2K50 A;  3S15 B;  3M4O H;  4ZQ3 A;  4MZ9 A;  4YWM A;  2O5J C;  2N78 A;  3P20 A;  4QGU A;  1I3Q H;  4KK7 A;  1F9R A;  2KOL A;  1HNZ L;  1JWU D;  3NWS A;  1EZ8 A;  2UXD L;  1NY4 A;  1UE1 A;  2B2W C;  4XTC S;  2KHI A;  2Y0S B;  1DYQ A;  4KY5 A;  4JV5 Q;  1JCK B;  5CV5 A;  1BF4 A;  2A6E D;  4NMZ A;  2GA4 B;  4K14 A;  2F0T A;  2UXB L;  4DR6 Q;  4KD4 A;  3SDZ A;  1GVP A;  5JJL A;  3CD6 A;  4DAY B;  4DV5 L;  2DJG C;  1XMO L;  4G7H C;  3TZD A;  2ZJP A;  1A8V A;  4JI8 L;  1LM0 A;  1RCV D;  3EBE A;  1K8M A;  1KRT A;  4G7O C;  4LF7 Q;  1E3P A;  3J7A 5;  4QQB X;  3ERQ A;  1VQ9 A;  3J80 E;  1IBK L;  2KED A;  4JI5 L;  3HOX G;  3FPU B;  4FXD A;  1CM9 A;  3JC6 6;  5C3E G;  3KF8 A;  3E3X A;  4FP5 D;  1R4Q B;  1XMQ L;  3HKZ B;  1EWH A;  2F0H A;  4ULL A;  3SEB A;  4DR5 Q;  2F0M A;  1B44 D;  2RHQ B;  3HKS A;  4GNX B;  5C0X G;  4JI4 Q;  3TP8 A;  3ND9 A;  1B9N A;  1UNS A;  1KNA A;  4LUZ A;  3FPP A;  3OTO Q;  2ZXP A;  1ZYR C;  4RHR A;  4GN3 B;  1VQE A;  5H1S E;  4YCW A;  1X56 A;  5M3F B;  3CHB D;  5IWA Q;  3BYY B;  1A3U A;  2V1C C;  4A3G G;  1RD9 D;  2CH4 W;  2XN9 C;  5CV4 A;  3S24 A;  2N3S A;  1AN8 A;  1SFO H;  4NXM Q;  2PYK A;  1A15 A;  1UAP A;  4HMJ A;  2QCP X;  4JI2 Q;  3T13 A;  2N8N A;  1K0S A;  3KOJ A;  1SYG A;  3LX0 A;  3J7Y W;  4K5W A;  1TY2 A;  4TSS A;  2UUC L;  3NBH A;  3U50 C;  2E2J B;  3DWQ A;  3SXH A;  1I6H B;  2FMC A;  4PV1 C;  2JA6 H;  2EE1 A;  5CR3 A;  5LMN Q;  2YU9 H;  2YU9 B;  4YWL A;  1ONL A;  1JC7 A;  1D7Q A;  3OWF A;  1PZK D;  3I4O A;  1YJ9 A;  4HAE A;  2YYZ A;  4B3S Q;  3SK8 A;  1Y1V G;  3PO3 G;  1YNJ C;  5FO8 B;  3MXU A;  1VQ4 A;  3SK5 A;  2K28 A;  3PO2 G;  3S14 B;  3VA7 A;  5AJ3 Q;  3F2B A;  4FO2 A;  1IBK Q;  1NE3 A;  1K3R A;  4CDC C;  1SXT A;  4XQQ A;  1AW7 A;  4L8J A;  2LKV A;  4KKT A;  3D4W A;  2JA6 G;  2PQE A;  1ILP A;  3HG9 A;  3J81 j;  4J6H A;  3K80 C;  4HMI A;  2NTT A;  4GLA C;  3H3V C;  2B2T C;  1EOV A;  1L0X B;  3BZC A;  3E6Z X;  4F7X A;  2JJQ A;  5BN4 A;  2SEB D;  3JAM c;  2CW0 D;  5D14 A;  2JE6 I;  4EGV A;  1AE2 A;  2AUK A;  4IFD I;  3TS0 A;  4PNY A;  1SSO A;  4BY1 B;  3JAM E;  2HHH Q;  3D6C A;  1Z6H A;  3FEW X;  2MO1 A;  2F3W A;  3CRL C;  2VUM G;  5IYB G;  1Q7Y C;  5G3L D;  2VW9 A;  4LFB L;  1ICW A;  3NUC A;  1IKM A;  5CYU A;  4A3B H;  1JMC A;  1KHI A;  2E2I H;  4X6A H;  5JJZ A;  4BXX G;  3BS1 A;  4RKL A;  5C0X H;  2R93 H;  4DV5 Q;  1F9S A;  1PHJ A;  5C4J H;  2ALY B;  2WB1 B;  2JEA I;  1HZB A;  3S15 H;  2PO4 A;  1U4R A;  1VQJ A;  4KD3 A;  5GRO A;  4X65 L;  1STG A;  3NP8 A;  1L1O B;  1MJC A;  1QNK A;  2MP1 A;  2ES2 A;  1KLG D;  4K8I A;  1MSH A;  2Y0S E;  1PFN A;  4DR3 L;  4Y7N B;  4C3J B;  2YV5 A;  2E76 C;  5ELC A;  3T1Y L;  1BCP D;  3H91 A;  4B3T L;  1EUJ A;  3PUX A;  2G5D A;  3RZD B;  3RZO B;  1WTO A;  1F9Q A;  5KIX A;  4R4I A;  4H13 C;  1RIP A;  4MTK A;  1LT6 D;  1HCZ A;  1MD2 D;  4WOR A;  1NCV A;  3D6W A;  4B3T Q;  1JJG A;  4DK3 C;  3FMC A;  1STB A;  4P75 A;  3W3A A;  1IZ6 A;  3RLN A;  5DAU A;  2SOB A;  4R4O A;  1C0A A;  4JI3 L;  2ZM6 L;  4JPB W;  4L6T B;  1IW7 D;  2K7V A;  2B63 G;  3CC2 A;  3MZ5 A;  5M9O A;  3S9W A;  1C9O A;  4BS9 A;  1N9W A;  4GOP C;  1PLF A;  3N6R A;  2E2I B;  2A73 B;  2AKW B;  1SAP A;  3TRZ A;  1CUK A;  2VB2 X;  1STE A;  5LMN W;  4KLK A;  3UDG A;  2D9U A;  1UUP A;  2QW7 A;  2ZJQ A;  2O2L D;  1JWM D;  1PH2 A;  4YY3 L;  2PW5 A;  2ZXR A;  1AZQ A;  1T5X D;  4AQY Q;  3KLS A;  5CV7 A;  3TS2 A;  1E2V A;  4L5T A;  4IUV A;  4GKK L;  1TS4 A;  5LMN L;  1Q1B A;  2PW7 A;  1CZW A;  4QB4 A;  1B2T A;  3C1E A;  3W2D A;  5J39 A;  1VMC A;  4R4T A;  1HUN A;  1JJ2 A;  1BKB A;  5FLX E;  1DGS A;  1I6H H;  1EOT A;  5FLX c;  2Z0S A;  4GLV B;  1HJP A;  2WII B;  4JI0 Q;  2CWA A;  2TSS A;  1GKH A;  3OW2 A;  5IIF A;  2D5D A;  2PNR C;  1TWG H;  1KXL A;  1RHP A;  1SYE A;  4BWG B;  4DAY A;  1N36 L;  3QO2 A;  1MGS A;  4KHZ A;  1I4G A;  4BY1 G;  3WOE A;  2JA5 H;  4C2M H;  4DN4 M;  4A3D H;  3KDF A;  1TY0 A;  1H9R A;  1S5E D;  5ISR A;  4POG A;  2F0G A;  3FDT A;  4KN4 C;  3OHX C;  2AUJ D;  2HD3 A;  1X3P A;  3K7U C;  4PZ6 A;  5CGK A;  3ERO A;  2QGQ A;  1FVI A;  3HOY G;  4N9P A;  1KAA A;  4WRD A;  4IO9 A;  1IBL L;  4UP7 A;  4HJ9 A;  1LAC A;  4IQZ A;  4YY3 Q;  1I94 Q;  2VQF L;  4ZKB B;  1E2Z A;  1CSQ A;  3OYY A;  3C3L A;  4NXN Q;  1XWE A;  3OTO L;  2EYH A;  3X3N A;  1EIF A;  5DLQ E;  4A3F H;  1V1P A;  3HOX B;  1IL8 A;  1W6J A;  2PZU A;  4RWS C;  4LFA Q;  1JOR A;  2KA7 A;  1ENF A;  3EQL C;  4BBR H;  2EXD A;  3S2D H;  4JV5 L;  4DV3 L;  3BDL A;  2IT1 A;  1NTG A;  5IGB A;  3VR6 A;  1GOZ A;  3K6O A;  1T9H A;  3PIP A;  4LFC Q;  4K2K A;  1G2T A;  5JOB A;  3QWN A;  2ZM6 Q;  2EYL A;  2HIX A;  2LS0 1;  1S5D D;  1YNX A;  3H0G H;  1L1O C;  2JK8 A;  1VQB A;  3EVQ A;  1K8G A;  2F0L A;  2XIW A;  5C3X A;  2BA0 A;  4DV4 L;  1HR0 W;  4B9X A;  1DJR D;  1AE3 A;  5JAV A;  3L9A X;  4LF5 L;  4RH6 A;  2P5Z X;  3TN2 A;  5LMU Q;  4Y7N H;  5M3M B;  4H44 C;  3AYH B;  5COR A;  3A55 A;  1O7Y A;  4DKA C;  1VMP A;  3GP7 A;  5IYD G;  2KEC A;  2DGY A;  2K05 A;  2EYJ A;  4Q5V A;  3IKJ A;  1L0W A;  5C6A A;  1BVS A;  3UE0 A;  2HQL A;  2B2U C;  1ESR A;  1UWV A;  5M5Y B;  3GTM B;  3PMF A;  3JAM i;  1IYJ B;  2OXP A;  3U4Z A;  5HUR A;  1W2B A;  1HNZ Q;  2NVY H;  4J1M A;  1F2Z A;  3DWA A;  4GKK Q;  1SYC A;  2RVL A;  1IL2 A;  2GVA A;  4R9W A;  5D65 A;  1PRT B;  2YTY A;  2VUM H;  2XGT A;  2RA4 A;  4RA8 A;  1C7Y A;  3KK7 A;  4A3D B;  1Q8I A;  4ABN A;  2A19 A;  1V1P B;  4QMG A;  4LF7 L;  1EL0 A;  4UP9 A;  2SNS A;  4GOP B;  3CCS A;  4O0A A;  3HOU H;  1LTS D;  1JIC A;  4F8M A;  4OX9 Q;  1DZ1 A;  1CHQ D;  2Z4I A;  2OQ0 A;  3S2H H;  1J5E L;  1IW7 C;  4AQY L;  1CFM A;  1A0I A;  5ELD A;  5EKK A;  1B53 A;  1Y14 B;  5M5X H;  1Q86 C;  1L1O A;  2K5W A;  1EQV A;  2F0I A;  4KN7 C;  2KJX A;  2IHF A;  3QB3 A;  1KDB A;  1BQQ T;  1SYF A;  4YCU A;  3H3V H;  1W3S A;  1I4X A;  3AMU A;  2KEN A;  4GLX A;  5I2X A;  2L12 A;  3PO3 H;  1MJE A;  2UXC Q;  1QIL A;  1TWH H;  1ENC A;  4O42 A;  3UE1 A;  2ASB A;  5AFW A;  2F4V Q;  2FMM A;  5CV8 A;  5CV9 A;  1HUM A;  1PFS A;  4K2L A;  2B2V A;  1NJI C;  1LUZ A;  2NVT B;  1E0B A;  4HID A;  4A3L G;  3SK6 A;  4KHP L;  1K8A C;  5C0X J;  4CDF C;  1N34 Q;  2K6A A;  5IY0 A;  2LFN A;  4EQ5 A;  3GTL B;  4HSP A;  5KND A;  4LWC A;  4AIM A;  3UDI A;  2K5D A;  1E24 A;  1ML0 D;  4HTH A;  1HNW Q;  5LHY 1;  3R2T A;  4A3G H;  1I5F A;  3H6M A;  4TKO B;  1EY8 A;  4BBS G;  3EA6 A;  4DV7 L;  5E7N A;  2M00 A;  1GJX A;  4XYO A;  4LF8 Q;  1CKN B;  1DOK A;  4N8X 1;  3BG3 A;  2OQK A;  1LLR D;  1LTR D;  3NBI A;  1V1O A;  1PTO H;  3MTS A;  4JI1 L;  1X3Q A;  4RKB A;  1NAP A;  1KIX A;  4JW0 A;  2RF4 A;  1TKW B;  3KFU A;  5EPJ A;  1Q3L A;  1V43 A;  2EJG C;  1GD7 A;  3M4P A;  1II3 A;  5C4X B;  1U9R A;  3S17 H;  2I5H A;  2DNC A;  1SMX A;  4N8F A;  2HQE A;  1HXY D;  3EN2 A;  2DY7 A;  4DR4 Q;  4A3C H;  5CBE E;  3E5S A;  4FF3 A;  3GTK B;  1TWH B;  5JJI A;  4Y52 H;  4C3J H;  3OWE B;  1XTD A;  2H5X A;  4C1N I;  3I4M B;  3NBH B;  5C44 H;  2E8G A;  2NTS A;  1HTP A;  2L1B A;  1Q81 C;  2F0K A;  1CTM A;  3TME A;  2EVB A;  2JA8 B;  1I50 H;  2ID0 A;  2L15 A;  3GTG B;  4B3M L;  1SDF A;  1WTW A;  3H0G G;  4C3I B;  1C48 A;  2R7Z G;  3GTL H;  1VQG A;  1HZ9 A;  2WAQ E;  3UI2 A;  2DJF C;  3GO5 A;  3TSS A;  2NZH A;  2IY5 B;  3WOF A;  2A1A A;  1NMG A;  3P1H A;  3HOZ B;  4JI1 Q;  1YVC A;  1ZEQ X;  4M8A A;  5I9P A;  4DUZ L;  3GD7 A;  1X54 A;  2CWP A;  4J15 A;  1SBB B;  1SN8 A;  1SMY C;  4X62 L;  5IGG A;  3N52 A;  2JXM B;  2Q8I B;  2IPK D;  4X66 L;  4R8I A;  1PH8 A;  3HOV G;  2KCT A;  5E4X A;  5IGC A;  4UP8 A;  1QVF A;  4YWK A;  4IPC A;  2R61 A;  2WIN B;  3BVM A;  5JEA H;  3CQZ B;  1O7Z A;  4IPD A;  1KQS A;  4H0L C;  1QVG A;  1HPC A;  1JE5 A;  1ZYR D;  3I72 A;  4C3H H;  3M4Q A;  1B3Q A;  4GS3 A;  4LF6 L;  5FLX L;  4KTA A;  3TP6 A;  3VYT A;  2RDF A;  2EIF A;  1YNN D;  4KV6 A;  4JI4 L;  1AFP A;  1TS3 A;  1QVC A;  4G7Z C;  1B70 B;  4A3D G;  2IWH A;  3K59 A;  1TQO A;  1PH7 A;  2B29 A;  1SRO A;  4Z9C B;  2F4I A;  3O13 A;  4A3I H;  1OXU A;  2IL8 A;  1PH6 A;  2JSO A;  2E2J H;  5ELN A;  1D5M C;  1Y8O B;  3SHL A;  3HZX A;  4IN3 A;  3CF5 A;  2Z1C A;  1Y1W B;  1R9T B;  4MNO A;  3M7N A;  4PQX A;  4QIW B;  1BBU A;  4DV6 Q;  3MWY W;  1TS5 A;  3S1N B;  3U58 A;  1EIY B;  2KHS A;  4IFD J;  1BCP F;  2MUY A;  1B4O A;  5JEA J;  2I46 A;  4JG2 A;  4N9T A;  3RZD H;  4JI6 L;  3QOJ A;  3M3Y B;  4A3J B;  2JYO A;  3ZYY X;  4A3J H;  4C3H G;  4NPS A;  1JB7 A;  1I94 L;  3U4V A;  2JA8 H;  4JI7 Q;  3HOY B;  1QZH A;  1EY0 A;  4NXN L;  2XWB B;  1SE3 A;  3RMH A;  1ET9 A;  1E2W A;  2MQH A;  3OMG A;  4RGO S;  4HIK A;  3OMC A;  5C4Z A;  2EJM A;  1HRJ A;  4DK0 A;  1XMO Q;  3ITP A;  2PMZ E;  2KCM A;  2Z8L A;  2F0F A;  3MXN A;  1UE7 A;  3OPO A;  1H9J A;  3J80 i;  1PA6 A;  1MKH A;  1EYA A;  3F2U A;  1TWF H;  2ICI A;  4JI5 Q;  2AHO B;  3M4Y A;  1K8O A;  1VQH A;  3HOW G;  4YHH Q;  2I07 B;  4M1U B;  5JVH 3;  4RHS A;  3EFX D;  1ZXT A;  2XVS A;  3AB9 A;  5JVG 3;  2B63 B;  1U5K A;  2NZ1 D;  1PH1 A;  1VQL A;  1Z9F A;  1CI3 M;  1JJC B;  1HZC A;  4A3M G;  4DV0 Q;  2X69 A;  2PI2 A;  1TII D;  2A8V A;  3QR8 A;  1RDP D;  3CQZ H;  4OEM B;  2K52 A;  2Q2I A;  1BR9 A;  2R7Z H;  3M9B A;  1FGB D;  1PYB A;  2PZW A;  3J7Z C;  3HFZ B;  2JEB I;  2QA4 A;  3A8J E;  4EQP A;  2EY2 A;  4OWW B;  3CXC A;  1PXU A;  3ULJ A;  4C3J G;  2JA9 A;  2EYF A;  1EQQ A;  1Q8K A;  2A6E C;  1MBY A;  1CK1 A;  4F87 A;  1XMQ Q;  2WAQ B;  3BDC A;  5FO7 B;  5C5L A;  4RGN A;  1AP0 A;  1WD0 A;  2MGS A;  4JK1 C;  1EU4 A;  2XWJ B;  1HZA A;  3KBG A;  1VQK A;  2F0N A;  4ID6 A;  2A6H C;  4I65 A;  2VQE L;  5EPK A;  3DHQ A;  1SND A;  1QCB D;  3S1R B;  4LF4 Q;  3S1R H;  4LW1 A;  3NQT A;  2RHS B;  1XNR L;  4A3K G;  1X55 A;  1FNV A;  4BXX H;  2LSS A;  3Q6S A;  3TBI B;  3HOZ H;  1F9P A;  2EY1 A;  4A3B G;  1YHQ A;  3Q23 A;  3NTK A;  2JP1 A;  3MXN B;  4DUY L;  4BBS H;  4PMC A;  1P8L A;  4IPH A;  5G3L F;  2K75 A;  3S1M B;  2IJ0 A;  2HDM A;  4FXK C;  5K36 H;  4A3B B;  1M8A A;  3SR1 A;  1FNW A;  3BU2 A;  3R8B A;  1UE5 A;  4GKJ Q;  1YNN C;  1F2Y A;  2L9H A;  1CKN A;  4DR2 Q;  1HNX Q;  4OL7 A;  1TWC B;  4NP5 A;  3T51 B;  2B2Y A;  5NUC A;  1EFW A;  2MFI A;  4YIJ A;  1M4V A;  2MJ8 A;  3KJP A;  5I4D A;  2UU9 L;  5EBC A;  2MPM A;  2F0P A;  3IL8 A;  4HJA A;  3TEH B;  4HJ5 A;  1WOC A;  4IUU A;  3I3C A;  4AH6 A;  3ZJY C;  3GTQ H;  1LV9 A;  1KNE A;  1PYW D;  3PO2 H;  4V0B A;  3GTO H;  3IFD A;  2YTX A;  1I4Q A;  3AQQ A;  5C0X I;  4X3S A;  4PZ8 A;  1Y1V B;  2NVQ H;  1OTC A;  3PGZ A;  2ZT9 C;  4B08 A;  4ZK9 B;  1O7I A;  4RCN A;  4A3K B;  1RKN A;  3LWE A;  1A3T A;  1KTK A;  1QJO A;  2B2U A;  4Q0F A;  1BCP B;  4F88 A;  3K7A H;  1PFM A;  3CCE A;  2K03 A;  1I50 B;  3D8G A;  3NTH A;  1CSP A;  1IHZ A;  4OHJ A;  2Q2T A;  1SE2 A;  4RAU C;  3J81 L;  4DR7 L;  3E0J A;  3CCL A;  2OT2 A;  4DR1 Q;  4A4I A;  5I6Y A;  3I4N H;  3HOU G;  3GTK H;  1VQC A;  1PTO F;  1KAW A;  3DM3 A;  3T53 B;  2VQF Q;  5GAD C;  1BDO A;  4BBS B;  5KNC A;  2NB0 A;  4A93 B;  3T1H L;  4UDU C;  1IBM Q;  2BDO A;  3V96 A;  2WB1 G;  4LUV A;  4ZUI A;  2UXC L;  4IUQ A;  4IUN A;  5M5W B;  2K33 A;  1HQM C;  3PUY A;  3AFP A;  4KY6 A;  1BBX C;  3FKI G;  5FOB B;  2VS1 A;  5C3E H;  3MAQ A;  3HOX H;  4OIK A;  3K0X A;  4DXF A;  2NBF A;  4ALP A;  2ATW A;  1EIG A;  1WTX A;  5IYD H;  1PRT C;  1HR0 L;  5D3D A;  3GTQ B;  4GNX C;  4DNT B;  3UDF A;  1WD1 A;  1QZG A;  3HP3 A;  2KCN A;  2R7Z B;  3GTP B;  3STB D;  4DUY Q;  2L4N A;  5GQO A;  1N34 L;  1RL2 A;  3SE0 A;  3I8Z A;  4R8N A;  4FDB A;  2LMC B;  4X65 Q;  2EDG A;  5HGQ A;  2VQE Q;  3CCQ A;  3K0Y A;  4WFN 3;  4GN4 B;  1Q46 A;  1Y8P B;  3RZO H;  1HNW L;  2R6G A;  3B6Y A;  2PQA A;  1CQV A;  1TWF B;  1E1O A;  1KRS A;  2NN6 G;  2N88 A;  4S3S A;  1JE4 A;  3I56 A;  1PMR A;  3A54 A;  1R4P B;  1DM0 B;  2KHJ A;  2E75 C;  4QF4 A;  3CCU A;  1CT1 D;  1U0L A;  1V1Q A;  1NUC A;  1GUS A;  1DON A;  1X3E A;  1RJT A;  1XTC D;  3TP7 A;  4DR5 L;  1D8L A;  2IX3 A;  3HOY H;  4H02 A;  3H15 A;  5E4W C;  2IX1 A;  3VYS A;  1DCZ A;  1VQO A;  1LT3 D;  4KJO A;  3BZD B;  2MHV A;  3LWU A;  5M5X B;  5GAH C;  1U4P A;  1PTO B;  4XXE A;  4JBM A;  1XNR Q;  4DAV A;  3P75 A;  1XYI A;  5C4X H;  1SFO B;  2QKI C;  4FYD A;  3TQY A;  3RNU A;  1PFB A;  3KJO A;  4JBK A;  3GTO B;  4A3I B;  5A2Q E;  3E9I A;  3GTP H;  2E5L L;  3PCO B;  3PV0 A;  1Z7T A;  1G6P A;  1HQR D;  4HCE A;  1WYD A;  3PUV A;  2BA1 A;  1HA5 A;  1LTL A;  3A8K E;  3G6E A;  4K6L A;  1Q82 C;  4OON A;  2KQ3 A;  4IUP A;  1TT2 A;  1PYS B;  4ZYS A;  2PI2 E;  1YJN A;  4EQN A;  2F4V L;  1NSN S;  2ICE C;  1VQI A;  2QDL A;  1OXS C;  3KYH C;  1EZ6 A;  1BXT A;  1ESF A;  1VQN A;  5A35 A;  5DEH A;  3S14 H;  1IBL Q;  1YZ6 A;  3VR3 A;  2X6G A;  4LF9 Q;  2A5H A;  3A7L A;  3CMA A;  1JB3 A;  1A62 A;  4QCL A;  1S4Z A;  4KKU A;  3MFG A;  3CC7 A;  2M9V A;  1WCM H;  4L5Q A;  4UHV A;  1WCM B;  4MTN A;  1TWG B;  5IYC H;  4DFA A;  1WVL A;  2V4D A;  3D31 A;  4JI0 L;  1K83 H;  3OIP A;  1X6O A;  2I5M X;  5M5Y H;  5IP7 G;  3VYU A;  1HFN A;  5IOC A;  5L37 A;  2C9O A;  5M3F H;  4IJH A;  1K3B C;  3GQB A;  4GN5 A;  4C1N K;  1DD2 A;  3J7A V;  2EZV A;  3W1G A;  1FR3 A;  2QIL A;  1S3O A;  1KDA A;  1I4P A;  4LUO A;  3HRZ C;  1N33 L;  2EJF C;  1EU3 A;  2XRS D;  2D62 A;  4LJZ C;  2AQ3 B;  2KEE A;  1LYL A;  3Q0A A;  1F77 A;  2B63 H;  2WAQ G;  4EQO A;  4O1N A;  3SGI A;  1PRT D;  1VF7 A;  1G51 A;  4OO1 H;  5FJ8 H;  4JBW A;  1AEX A;  1QG7 A;  1S5C D;  3DXJ C;  5DM7 3;  4DV4 Q;  1XPO A;  2OWO A;  3HKZ G;  1I4H A;  3CPF A;  1AZP A;  2K1B A;  1LTT D;  1WJJ A;  4J8Q A;  3MXG A;  5C3E B;  5EKI A;  1FL0 A;  1SYD A;  4DV3 Q;  2BH2 A;  1CA5 A;  1STY A;  1IBM L;  1U4L A;  2BDN A;  3CC4 A;  2R92 H;  2EXZ A;  3MEF A;  4DA2 A;  2JQO A;  4TRD A;  3MA2 B;  1G29 1;  1E22 A;  2NN6 I;  1QWY A;  1PTO D;  2F3I A;  1IYV A;  1SRU A;  2R7F A;  3TZU A;  3MVV A;  3HKZ E;  2K5Q A;  3DLL A;  1GXD C;  1O7L A;  1SE8 A;  2MNA A;  5CBA E;  1B7Y B;  1FGU A;  3IAY A;  3GTM H;  1LAB A;  1Q90 A;  1UE6 A;  5FK9 C;  1PTO C;  5FKA C;  3DMU A;  5F2D A;  2R93 G;  2LXJ A;  1SNO A;  3RN5 A;  5ELF A;  2NVT H;  3L7Z C;  4HSV A;  5T1G A;  3AEV A;  3KF8 B;  3KDF B;  1HA6 A;  3GDE A;  4I7A A;  5JJK A;  3NSW A;  1IKL A;  5IYB H;  4B3M Q;  2RSO A;  4QL5 A;  1S5F D;  3KBX A;  3MXP A;  3LNN A;  1QE6 A;  3MC0 B;  1TR5 A;  4FXG C;  4L5R C;  2AWN A;  3S16 B;  2VB3 X;  2EYO A;  4QUF A;  1G6Z A;  1FJG L;  4A3E G;  2QEX A;  1PZI D;  5J22 A;  3K7A B;  2B2V C;  1VQ6 A;  4FF4 A;  3QG1 A;  1EYD A;  2Z6B A;  1YHA A;  2CKZ B;  3F1Z A;  4A75 A;  3G6J B;  1SE4 A;  2FJ2 A;  3S17 B;  5JPN C;  1CA6 A;  2B2T A;  1ROD A;  4DPG A;  1PZJ D;  4A76 A;  2F52 A;  2PMZ B;  3NQI A;  4A93 G;  4DU9 A;  2F0E A;  2Z6K A;  4DR3 Q;  4JCV E;  3S1Q B;  2EY5 A;  2J7Z A;  1TVX A;  1X9N A;  4B3R Q;  5M3M G;  2OF1 A;  3AU7 A;  4MIU A;  2VXW A;  5FLM H;  5D3I B;  1XJV A;  2HUG A;  4C3H B;  1WTP A;  1Y1V H;  3L3O C;  2K14 A;  3OOC A;  2E2D C;  5E3F A;  4IOA A;  4H7B A;  1T5E A;  1VQA A;  4NXM L;  3K57 A;  1OO9 B;  3G4S A;  2H1E A;  4NKL A;  3DM1 A;  1LO5 D;  3PIP 3;  1ENA A;  4APV A;  3ER0 A;  5AJ3 L;  5IOD A;  4G4K A;  4XQN A;  4DUZ Q;  1XPU A;  2RDH A;  5J3B A;  1H9S B;  4DK1 A;  4ILW A;  1Z47 A;  1JOK A;  3TDQ A;  1N32 Q;  4P74 A;  1GUG A;  3I4N B;  3ND8 A;  5BR8 Q;  3KLS X;  4C2M B;  3NEL A;  1GHK A;  3GV3 A;  3VDY A;  1TU2 B;  1QOH A;  5CMD A;  3C1F A;  3I2Z A;  1K73 C;  1BCP C;  2CHB D;  3K5M A;  2UXB Q;  1LTA D;  3NEM A;  1F2L A;  1E7Z A;  2Q2U A;  1CQF A;  3VR5 A;  1SEB D;  2WB1 E;  3J81 c;  1I6V C;  1STH A;  1I3Q B;  2UUA Q;  2R3Z A;  2IW3 A;  1U4M A;  3FKI H;  2WFW A;  3NTI A;  1BUV T;  3MHB A;  4IJL A;  1G2S A;  2XSC A;  1P16 A;  4CDE C;  4R4C A;  1EY6 A;  1YHB A;  1A6X A;  4MHE A;  4A3F B;  3H0G B;  4PMW A;  2CQA A;  1K28 A;  4BBR B;  1FD7 D;  1X3G A;  4K0K L;  2JA6 B;  2L55 A;  4V19 0;  4X64 L;  3HGB A;  4IUT A;  2CW0 C;  5C44 B;  3M7G A;  5C4J B;  3I4N G;  2F0D A;  3CKI B;  3BYT B;  3NHH A;  1EIH A;  3W5O A;  1HR0 Q;  4P72 A;  1YNJ D;  4BY7 G;  3I90 A;  4HR7 B;  4B9W A;  2RKS A;  2O5I C;  4QIW E;  2Q2H A;  3S1Q H;  5COY A;  1KC8 C;  4E6I A;  2JA7 B;  4JYA L;  1XX8 A;  1JWS D;  2WP8 J;  5HY6 A;  3H3V I;  2F0V A;  2ZJR A;  3OW7 A;  1SNP A;  3S1M H;  2CCZ A;  1GHJ A;  5FLM G;  3T1H Q;  4RFB A;  4DAP A;  4KJN A;  5M3M H;  3KLW A;  1HFG A;  5LMU L;  2LXK A;  1VDZ A;  4A3G B;  3M3Y H;  5ELO A;  2B2Y C;  2Q8T A;  5IP9 G;  5BN5 A;  4A3M B;  4CKE A;  4LF6 Q;  2AQ1 B;  1S5B D;  2RSN A;  1PH3 A;  5KEE A;  2Z4H A;  1OXV A;  1JOO A;  1QNU A;  1EWC A;  3J80 c;  1VCI A;  1GUN A;  1MI2 A;  3U9O A;  5A2Q L;  5IT9 L;  4NB3 A;  4ME5 A;  4RGM A;  3TP5 A;  4A3E H;  3CP0 A;  2NZO A;  2QF7 A;  4DR4 L;  1I4R A;  2FFK B;  5K36 G;  5GAG C;  3I55 A;  1SNC A;  4EX5 A;  3M85 A;  4K8J A;  3OSO A;  2ZTC A;  3OIQ A;  4OX9 L;  1KLU D;  2F1M A;  3GTG H;  1LTB D;  3NPP A;  3K5N A;  1ICF B;  5J1Z A;  1UEB A;  2G9D A;  4A3K H;  3RD4 A;  4R4Q A;  2QEJ C;  5ELE A;  4C3I G;  1KAB A;  5TSS A;  2FIN B;  3J81 E;  3PO2 B;  4PMB A;  1J6Q A;  4P2C B;  1TWA B;  3W1B A;  4LF5 Q;  4JYA Q;  1NNX A;  1TS2 A;  4XYQ A;  4CJ2 C;  3EJI A;  1L2F A;  5EKL A;  3I4M G;  3VA5 A;  1JOQ A;  4DV0 L;  3HEJ A;  5C3W A;  1GO3 E;  3I7F A;  2RCN A;  4XQJ A;  4L63 B;  3URY A;  3R3O A;  2EY6 A;  1WTQ A;  1CHP D;  2BE5 C;  2NYZ D;  3F8T A;  2WV6 D;  1GUT A;  4QJF A;  4IFD G;  3FKI B;  3R2I A;  2NVX H;  2C5C A;  5I9O A;  4A3M H;  5C4H A;  1B8A A;  1JR0 D;  4P73 A;  2K04 A;  5ELB A;  2B8F A;  3RUZ A;  5KGU A;  2L0C A;  4OO1 G;  1YJW A;  1J9O A;  1NBW A;  1B1Z A;  2AMC B;  4X3T A;  1STA A;  4DF7 A;  4JOI C;  2EOT A;  3J80 L;  4DR1 L;  4ZRZ A;  4UPA A;  3Q8D A;  3SK4 A;  1NMF A;  1D5X C;  1YIJ A;  4TQU S;  4IOC A;  1G8Z D;  2PCF B;  2X6L A;  4UAI A;  1WTH A;  1YIT A;  3T1Y Q;  4CDD C;  4JI3 Q;  2N49 A;  3P7J A;  4K5V A;  1Y1W H;  1R9T H;  1V8Q A;  2OTJ A;  3BJU A;  3S2H B;  3CRK C;  4ME3 A;  4TVA B;  4K0K Q;  2L11 A;  4XIG S;  1A63 A;  4X3U A;  1KD1 C;  2IHE A;  4B3R L;  2KBN A;  2EPB A;  1A2U A;  3I70 A;  4DGZ A;  2OTL A;  3BZK A;  1LTG D;  2KVM A;  1XNQ L;  5IGD A;  2A6H D;  1S40 A;  3I4M H;  1TXY A;  2HCI A;  3DEO A;  3G7L A;  4DR6 L;  1KDC A;  4K5X A;  5IGF A;  3QJY A;  1SNQ A;  1N33 Q;  3RLF A;  5KYI A;  2JA5 B;  3WDN A;  1LTI D;  4AYB B;  1STN A;  2VY3 A;  4FNF A;  5IT9 c;  4X62 Q;  4OWX B;  4HIO A;  2K32 A;  3D3R A;  5IE8 A;  1Y8N B;  5KRU A;  4GKJ L;  2XRQ D;  4QY7 A;  2OEO A;  2UUB Q;  4DK6 C;  3K8A A;  1VQ8 A;  2CQO A;  1FNU A;  2EQS A;  4OGQ C;  2R7D A;  4RCO A;  1LT5 D;  3I4L A;  2Q8R E;  2B2W A;  1EFI D;  4C56 C;  1SR3 A;  4U68 A;  2K5V A;  4A3I G;  1B3A A;  4CHT B;  3WWV A;  3KF6 A;  2O4X A;  4ZAI A;  5C4X G;  2KCC A;  1EY4 A;  3PUW A;  4X66 Q;  4FF2 A;  3EIV A;  4QUC A;  5KNB A;  2K5N A;  5JPM C;  4I7Z C;  4DNR B;  2NVY B;  4HN7 A;  2EYP A;  5I2Y A;  2N55 A;  5M5W H;  2DN8 A;  1J8I A;  3FP9 A;  5GAE C;  3GV6 A;  5CV6 A;  4U67 3;  2GVB A;  1NR4 A;  4KY7 A;  1RTO A;  2D2C C;  1VQ7 A;  1PRT F;  3PIO 3;  1SMY D;  4CKC A;  3D0F A;  1CKM A;  1EQT A;  3G48 A;  5BN3 A;  1JT8 A;  1H9K A;  1GUO A;  4YCV A;  3TRE A;  4DV2 L;  2A69 C;  3HOV H;  2PZT A;  3DWP A;  2QDB A;  2JN4 A;  5E1F A;  4GZY C;  4LFB Q;  1VQP A;  2BOS A;  3V2T A;  2NN6 H;  4PG3 A;  2SNM A;  3FHW A;  4G57 A;  2J0T D;  5CC4 A;  3AFQ A;  2JA7 G;  2H4O A;  4ZUJ A;  3HOU B;  3V05 A;  1AH9 A;  1PDQ A;  3L2P A;  1FJG Q;  1BO0 A;  4BY7 H;  2UUB L;  2BE5 D;  4FF1 A;  5IWA L;  3NXW A;  1D5Z C;  2CFM A;  1VQD A;  2BH8 A;  4MN3 A;  3NE5 B;  1TWA H;  3U9S A;  1N8R C;  2YTV A;  1EQR A;  1C8C A;  2E2H H;  1GM5 A;  4X64 Q;  3NWT A;  1SLJ A;  5C44 G;  1H9M A;  4HJ7 A;  2XTI A;  1XPR A;  2GN5 A;  1DOL A;  3T56 B;  4IUR A;  4A3C G;  1X32 A;  3BVG A;  3C2P A;  2UUC Q;  3G71 A;  2K4K A;  3KF6 B;  1YBY A;  2KUM A;  4O2D A;  1BBW A;  3ULL A;  2RQX A;  2ZTD A;  4XDX A;  1KL9 A;  4EVO A;  1G91 A;  1D6E C;  1SJH D;  4JC0 A;  4DNI A;  2D0O A;  3MEH A;  2Z9H A;  4LMQ D;  1B50 A;  1FYC A;  2Y0S G;  3C46 A;  2HT1 A;  1W6K A;  2DY8 A;  2E74 C;  3CCM A;  4UY8 C;  3CME A;  1VQF A;  4WJ3 M;  1O78 A;  3F2C A;  1K83 B;  4DV2 Q;  2F0U A;  1Q1E A;  3F2D A;  2ZTE A;  2K01 A;  4B3S L;  2D0P A;  1EYC A;  2F3V A;  5EJW A;  1L0Y B;  4XT3 B;  4LFA L;  4RMF A;  1N32 L;  1EY7 A;  2FHT A;  2PNH A;  4DXG A;  4CJ1 B;  1WTR A;  4LAA A;  1RF2 D;  2FXQ A;  4CJ0 B;  2UU9 Q;  2C35 B;  2K5H A;  4CGY B;  4IZ8 A;  3RLO A;  3S2D B;  5I6W A;  3J81 i;  4A3L H;  1RTN A;  3S1N H;  5T1I A;  2HCC A;  4R1J A; 
#chains in the Genus database with same CATH homology
 4NDX A;  1C4Q A;  3PUZ A;  1EEF D;  2AQ2 B;  1MSG A;  2M2L A;  3D4D A;  3HOW B;  3K58 A;  1XXG A;  4WJW A;  1D1K A;  3FRP B;  1H9S A;  4ODG A;  1SJE D;  5EGT A;  5IT9 E;  1NR2 A;  4OO1 I;  1EY9 A;  1LT4 D;  5HGT A;  3ONA B;  4IAL A;  1JQY D;  4X3K A;  3KUP A;  2G9H D;  2DNE A;  5KYL A;  3DUZ A;  3M4O B;  2SDF A;  3HOV B;  4K6D A;  1A2T A;  3SVM A;  1D1I A;  2CVR A;  3PO3 B;  4RGT A;  3DEP A;  2XNA C;  3H09 A;  2F0O A;  2ZXO A;  3VR4 A;  5FO9 B;  3JAM L;  2R93 B;  1OXX K;  1GUW A;  1SYB A;  1CZG A;  4KHV A;  5C5M A;  1Q12 A;  4HCS A;  4OIJ A;  2B8G A;  1D2B A;  4XT1 B;  1EY5 A;  1F2M A;  2RDG A;  1BOS A;  4BY7 B;  2NWG A;  1UEA B;  1DXM A;  1BNZ A;  2R92 B;  5DNF A;  3T16 A;  2RBM A;  3K5L A;  2F0W A;  2PPB C;  3A8I E;  2F0Q A;  3Q22 A;  3CU7 A;  1O80 A;  2EYM A;  3K5O A;  3T4A C;  2F03 A;  2VUM B;  3J7A F;  3Q24 A;  2LY7 A;  5EBD A;  3KLR A;  2BCO A;  3D4R A;  4FVM A;  1Y69 U;  2F0S A;  1ZKO A;  1WTV A;  2A69 D;  4KI0 A;  3HS0 C;  4IFD H;  1EEI D;  5K5P A;  1QB5 D;  5EPL A;  3BVZ A;  3A56 A;  4ZKC B;  4NW2 A;  3I73 A;  2NVQ B;  4LK1 C;  2A74 C;  2WKD A;  5IGE A;  3QIA A;  3VYR A;  2WKC A;  2IX0 A;  3IFT A;  3I91 A;  1B9M A;  1HTL D;  3X3M A;  5LL6 X;  2AWO A;  4BA2 I;  1HHV A;  1A3V A;  5EQ0 A;  1VF5 C;  2L5T A;  1SNM A;  2J4X A;  2NVX B;  2A68 C;  2WAC A;  2B39 A;  4KKS A;  3A7A B;  1OXT A;  1ILQ A;  2A68 D;  2E2H B;  4CBV A;  3R93 A;  4CKB A;  2HDL A;  3GTJ B;  3FVQ A;  2ENB A;  3BDO A;  5DM6 3;  3QOL A;  2TMP A;  3NK9 A;  1IYU A;  2VNU D;  4HED A;  3H94 A;  3MFY A;  4ZLT F;  1DOM A;  5JEA G;  2NUC A;  4BA1 I;  5LL6 S;  2F0J A;  4A3E B;  3VR2 A;  4KMU C;  1ET6 A;  3S15 B;  4ZQ3 A;  2O5J C;  3P20 A;  4KK7 A;  1F9R A;  2KOL A;  1JWU D;  3NWS A;  1EZ8 A;  2B2W C;  4XTC S;  2Y0S B;  1DYQ A;  4KY5 A;  1JCK B;  5CV5 A;  1BF4 A;  2A6E D;  4NMZ A;  2GA4 B;  4K14 A;  2F0T A;  4KD4 A;  3SDZ A;  4G7H C;  3TZD A;  1RCV D;  1K8M A;  4G7O C;  3ERQ A;  3J80 E;  2KED A;  4FXD A;  3FPU B;  1CM9 A;  3KF8 A;  4FP5 D;  1R4Q B;  3HKZ B;  1EWH A;  3SEB A;  2F0H A;  4ULL A;  2F0M A;  1B44 D;  5C0X G;  3TP8 A;  3ND9 A;  1B9N A;  1UNS A;  1KNA A;  3FPP A;  2ZXP A;  1ZYR C;  4RHR A;  5M3F B;  3CHB D;  3BYY B;  1A3U A;  1RD9 D;  2XN9 C;  5CV4 A;  1AN8 A;  2PYK A;  1A15 A;  1UAP A;  2QCP X;  4HMJ A;  3T13 A;  1SYG A;  3LX0 A;  3J7Y W;  4K5W A;  1TY2 A;  4TSS A;  3NBH A;  2E2J B;  3DWQ A;  3SXH A;  1I6H B;  2FMC A;  4PV1 C;  2EE1 A;  5CR3 A;  2YU9 B;  1ONL A;  1JC7 A;  3OWF A;  1PZK D;  4HAE A;  2YYZ A;  3SK8 A;  5FO8 B;  1YNJ C;  3MXU A;  3SK5 A;  2K28 A;  3S14 B;  3VA7 A;  4FO2 A;  1SXT A;  4XQQ A;  1AW7 A;  4L8J A;  2LKV A;  4KKT A;  3D4W A;  2PQE A;  1ILP A;  3HG9 A;  4J6H A;  4HMI A;  2NTT A;  3H3V C;  2B2T C;  1L0X B;  3E6Z X;  4F7X A;  5BN4 A;  2SEB D;  2CW0 D;  5D14 A;  2JE6 I;  4EGV A;  2AUK A;  4IFD I;  4PNY A;  1SSO A;  4BY1 B;  3JAM E;  3D6C A;  1Z6H A;  3FEW X;  2F3W A;  3CRL C;  5G3L D;  1ICW A;  3NUC A;  1IKM A;  5CYU A;  5JJZ A;  3BS1 A;  4RKL A;  5C0X H;  1F9S A;  2WB1 B;  2JEA I;  2PO4 A;  1U4R A;  4KD3 A;  1STG A;  3NP8 A;  1QNK A;  2MP1 A;  1KLG D;  4K8I A;  1MSH A;  1PFN A;  4Y7N B;  4C3J B;  2E76 C;  5ELC A;  1BCP D;  3H91 A;  3PUX A;  3RZO B;  3RZD B;  1WTO A;  1F9Q A;  5KIX A;  4H13 C;  1LT6 D;  1HCZ A;  1MD2 D;  4WOR A;  1NCV A;  3D6W A;  3FMC A;  1STB A;  3W3A A;  5DAU A;  2SOB A;  4L6T B;  1IW7 D;  2K7V A;  3MZ5 A;  5M9O A;  3S9W A;  4BS9 A;  1PLF A;  3N6R A;  2E2I B;  2A73 B;  1SAP A;  2VB2 X;  1STE A;  2D9U A;  1UUP A;  2O2L D;  1JWM D;  2PW5 A;  2ZXR A;  1AZQ A;  1T5X D;  3KLS A;  5CV7 A;  1E2V A;  4IUV A;  1TS4 A;  1Q1B A;  2PW7 A;  1CZW A;  4QB4 A;  1B2T A;  3C1E A;  3W2D A;  5J39 A;  1VMC A;  1HUN A;  5FLX E;  1EOT A;  2WII B;  2TSS A;  5IIF A;  2D5D A;  2PNR C;  1RHP A;  1SYE A;  4BWG B;  4DAY A;  3QO2 A;  1MGS A;  4KHZ A;  1I4G A;  3WOE A;  4DN4 M;  1TY0 A;  1H9R A;  1S5E D;  5ISR A;  2F0G A;  3FDT A;  4KN4 C;  3OHX C;  2AUJ D;  1X3P A;  5CGK A;  3ERO A;  4N9P A;  1KAA A;  4WRD A;  1LAC A;  4IQZ A;  4ZKB B;  1E2Z A;  3C3L A;  1XWE A;  2EYH A;  3X3N A;  1V1P A;  3HOX B;  1IL8 A;  1W6J A;  2PZU A;  4RWS C;  1JOR A;  2KA7 A;  1ENF A;  3EQL C;  3BDL A;  2IT1 A;  5IGB A;  3VR6 A;  1GOZ A;  3K6O A;  4K2K A;  1G2T A;  5JOB A;  3QWN A;  2EYL A;  2LS0 1;  1S5D D;  3EVQ A;  2F0L A;  5C3X A;  2XIW A;  2BA0 A;  4B9X A;  1DJR D;  5JAV A;  3L9A X;  4RH6 A;  3TN2 A;  5M3M B;  4H44 C;  5COR A;  3A55 A;  1O7Y A;  1VMP A;  3GP7 A;  2KEC A;  2K05 A;  2EYJ A;  4Q5V A;  3IKJ A;  5C6A A;  2B2U C;  1ESR A;  5M5Y B;  3GTM B;  3PMF A;  2OXP A;  5HUR A;  4J1M A;  1F2Z A;  3DWA A;  1SYC A;  2RVL A;  4R9W A;  5D65 A;  1PRT B;  2RA4 A;  4RA8 A;  3KK7 A;  4A3D B;  1Q8I A;  4ABN A;  1V1P B;  4QMG A;  1EL0 A;  2SNS A;  1LTS D;  1JIC A;  4F8M A;  1DZ1 A;  1CHQ D;  2Z4I A;  1IW7 C;  1CFM A;  5ELD A;  5EKK A;  1B53 A;  2K5W A;  1EQV A;  2F0I A;  4KN7 C;  2KJX A;  3QB3 A;  1KDB A;  1BQQ T;  1SYF A;  1I4X A;  3AMU A;  5I2X A;  2L12 A;  1QIL A;  1ENC A;  4O42 A;  5AFW A;  2FMM A;  5CV8 A;  5CV9 A;  1HUM A;  4K2L A;  2B2V A;  2NVT B;  1E0B A;  3SK6 A;  5C0X J;  2K6A A;  2LFN A;  3GTL B;  4HSP A;  5KND A;  2K5D A;  1ML0 D;  4HTH A;  5LHY 1;  3R2T A;  3H6M A;  4TKO B;  1EY8 A;  3EA6 A;  2M00 A;  1GJX A;  4XYO A;  1DOK A;  3BG3 A;  1LLR D;  1LTR D;  3NBI A;  1V1O A;  1PTO H;  3MTS A;  1X3Q A;  4RKB A;  1NAP A;  1TKW B;  5EPJ A;  1V43 A;  1Q3L A;  2EJG C;  5C4X B;  1II3 A;  1U9R A;  2DNC A;  2HQE A;  1HXY D;  2DY7 A;  3GTK B;  5CBE E;  3E5S A;  4FF3 A;  1TWH B;  3OWE B;  4C1N I;  3I4M B;  2NTS A;  1HTP A;  2L1B A;  2F0K A;  1CTM A;  3TME A;  2EVB A;  2JA8 B;  2ID0 A;  3GTG B;  1SDF A;  1WTW A;  4C3I B;  1C48 A;  3UI2 A;  3GO5 A;  3TSS A;  3WOF A;  3P1H A;  3HOZ B;  1ZEQ X;  4M8A A;  5I9P A;  3GD7 A;  1SBB B;  1SMY C;  5IGG A;  3N52 A;  2JXM B;  2Q8I B;  2IPK D;  4R8I A;  5E4X A;  5IGC A;  2R61 A;  2WIN B;  3BVM A;  5JEA H;  3CQZ B;  1O7Z A;  4H0L C;  1HPC A;  1ZYR D;  3I72 A;  5FLX L;  4KTA A;  3TP6 A;  3VYT A;  2RDF A;  1YNN D;  4KV6 A;  1AFP A;  1TS3 A;  4G7Z C;  2IWH A;  3K59 A;  1TQO A;  4Z9C B;  2F4I A;  3O13 A;  1OXU A;  2IL8 A;  2JSO A;  1D5M C;  1Y8O B;  3SHL A;  3HZX A;  4IN3 A;  2Z1C A;  1Y1W B;  1R9T B;  3M7N A;  4PQX A;  4QIW B;  3MWY W;  1TS5 A;  3S1N B;  2KHS A;  4IFD J;  1BCP F;  2MUY A;  1B4O A;  5JEA J;  2I46 A;  4N9T A;  3QOJ A;  3M3Y B;  4A3J B;  2JYO A;  3ZYY X;  4C3H G;  3HOY B;  1EY0 A;  2XWB B;  1SE3 A;  3RMH A;  1ET9 A;  1E2W A;  3OMG A;  4RGO S;  3OMC A;  5C4Z A;  2EJM A;  1HRJ A;  4DK0 A;  3ITP A;  2Z8L A;  3MXN A;  2F0F A;  3OPO A;  1H9J A;  1EYA A;  3F2U A;  2ICI A;  1K8O A;  3M4Y A;  2I07 B;  4M1U B;  5JVH 3;  4RHS A;  3EFX D;  1ZXT A;  2XVS A;  3AB9 A;  5JVG 3;  2B63 B;  2NZ1 D;  1CI3 M;  2X69 A;  1TII D;  1RDP D;  1BR9 A;  1FGB D;  2PZW A;  2JEB I;  3A8J E;  4EQP A;  2EY2 A;  1PXU A;  4C3J G;  2EYF A;  2A6E C;  1MBY A;  1CK1 A;  4F87 A;  2WAQ B;  3BDC A;  5FO7 B;  5C5L A;  4RGN A;  1AP0 A;  1WD0 A;  2MGS A;  4JK1 C;  1EU4 A;  2XWJ B;  3KBG A;  2F0N A;  4ID6 A;  2A6H C;  4I65 A;  5EPK A;  3DHQ A;  1SND A;  1QCB D;  3S1R B;  3NQT A;  1FNV A;  3TBI B;  3Q6S A;  1F9P A;  2EY1 A;  3Q23 A;  3NTK A;  2JP1 A;  4PMC A;  5G3L F;  3S1M B;  2IJ0 A;  2HDM A;  4FXK C;  5K36 H;  4A3B B;  1M8A A;  3SR1 A;  1FNW A;  3R8B A;  1YNN C;  1F2Y A;  2L9H A;  4OL7 A;  1TWC B;  4NP5 A;  3T51 B;  2B2Y A;  5NUC A;  4YIJ A;  1M4V A;  2MJ8 A;  5I4D A;  5EBC A;  2MPM A;  2F0P A;  3IL8 A;  4IUU A;  3I3C A;  1LV9 A;  1KNE A;  1PYW D;  4V0B A;  3IFD A;  1I4Q A;  5C0X I;  4X3S A;  1Y1V B;  2ZT9 C;  4B08 A;  4ZK9 B;  4RCN A;  4A3K B;  1RKN A;  3LWE A;  1A3T A;  1KTK A;  1QJO A;  2B2U A;  4Q0F A;  1BCP B;  4F88 A;  1PFM A;  2K03 A;  1I50 B;  3D8G A;  3NTH A;  1IHZ A;  4OHJ A;  3J81 L;  1SE2 A;  4RAU C;  3E0J A;  2OT2 A;  5I6Y A;  1PTO F;  3T53 B;  1BDO A;  4BBS B;  5KNC A;  2NB0 A;  4A93 B;  4UDU C;  2BDO A;  3V96 A;  4ZUI A;  4IUQ A;  4IUN A;  5M5W B;  2K33 A;  1HQM C;  3PUY A;  4KY6 A;  1BBX C;  5FOB B;  3MAQ A;  4OIK A;  4DXF A;  2NBF A;  1EIG A;  1WTX A;  1PRT C;  5D3D A;  3GTQ B;  4DNT B;  1WD1 A;  3HP3 A;  2KCN A;  2R7Z B;  3GTP B;  2L4N A;  3SE0 A;  3I8Z A;  4R8N A;  2LMC B;  2EDG A;  3K0Y A;  4WFN 3;  1Y8P B;  2R6G A;  1CQV A;  1TWF B;  2NN6 G;  2N88 A;  4S3S A;  1JE4 A;  1PMR A;  3A54 A;  1R4P B;  1DM0 B;  2E75 C;  4QF4 A;  1CT1 D;  1NUC A;  1GUS A;  1DON A;  1RJT A;  1XTC D;  3TP7 A;  2IX3 A;  5E4W C;  2IX1 A;  3VYS A;  1DCZ A;  1LT3 D;  4KJO A;  3BZD B;  2MHV A;  3LWU A;  5M5X B;  1U4P A;  1PTO B;  4XXE A;  4DAV A;  3P75 A;  1XYI A;  1SFO B;  2QKI C;  4FYD A;  1PFB A;  3GTO B;  4A3I B;  5A2Q E;  3PV0 A;  1Z7T A;  1HQR D;  4HCE A;  3PUV A;  2BA1 A;  1HA5 A;  3A8K E;  4K6L A;  2KQ3 A;  4IUP A;  1TT2 A;  4ZYS A;  4EQN A;  1NSN S;  2ICE C;  1OXS C;  1EZ6 A;  1BXT A;  1ESF A;  5A35 A;  5DEH A;  3VR3 A;  2X6G A;  2A5H A;  3A7L A;  1JB3 A;  4QCL A;  1S4Z A;  4KKU A;  3MFG A;  2M9V A;  1WCM B;  1TWG B;  4DFA A;  1WVL A;  2V4D A;  3D31 A;  3OIP A;  3VYU A;  1HFN A;  5IOC A;  2C9O A;  3GQB A;  4C1N K;  1DD2 A;  3J7A V;  2EZV A;  1FR3 A;  2QIL A;  1KDA A;  1I4P A;  3HRZ C;  2EJF C;  1EU3 A;  2XRS D;  2D62 A;  4LJZ C;  2AQ3 B;  2KEE A;  3Q0A A;  1F77 A;  4EQO A;  4O1N A;  1PRT D;  1VF7 A;  4OO1 H;  4JBW A;  1AEX A;  1QG7 A;  1S5C D;  3DXJ C;  5DM7 3;  1I4H A;  1AZP A;  2K1B A;  1LTT D;  4J8Q A;  3MXG A;  5C3E B;  5EKI A;  1SYD A;  1CA5 A;  1STY A;  1U4L A;  2BDN A;  2EXZ A;  4DA2 A;  4TRD A;  3MA2 B;  1G29 1;  2NN6 I;  1QWY A;  1PTO D;  1IYV A;  3TZU A;  3MVV A;  2K5Q A;  1GXD C;  1O7L A;  5CBA E;  3IAY A;  1LAB A;  1Q90 A;  5FK9 C;  1PTO C;  5FKA C;  3DMU A;  5F2D A;  1SNO A;  5ELF A;  3L7Z C;  4HSV A;  5T1G A;  1HA6 A;  3NSW A;  1IKL A;  2RSO A;  1S5F D;  3KBX A;  3MXP A;  3LNN A;  1QE6 A;  3MC0 B;  1TR5 A;  4FXG C;  2AWN A;  3S16 B;  2VB3 X;  2EYO A;  4QUF A;  1G6Z A;  1PZI D;  5J22 A;  3K7A B;  2B2V C;  4FF4 A;  3QG1 A;  1EYD A;  3G6J B;  1SE4 A;  2FJ2 A;  3S17 B;  1CA6 A;  5JPN C;  2B2T A;  1ROD A;  1PZJ D;  2PMZ B;  3NQI A;  4DU9 A;  2F0E A;  3S1Q B;  2EY5 A;  2J7Z A;  1TVX A;  2OF1 A;  3AU7 A;  4MIU A;  2VXW A;  5D3I B;  2HUG A;  4C3H B;  1WTP A;  3L3O C;  5E3F A;  3OOC A;  2E2D C;  4H7B A;  1T5E A;  3K57 A;  1OO9 B;  2H1E A;  4NKL A;  3DM1 A;  1LO5 D;  3PIP 3;  1ENA A;  5IOD A;  4G4K A;  4XQN A;  2RDH A;  1H9S B;  4DK1 A;  4ILW A;  1Z47 A;  1JOK A;  3TDQ A;  1GUG A;  3I4N B;  3ND8 A;  3KLS X;  4C2M B;  1GHK A;  3GV3 A;  1TU2 B;  1QOH A;  5CMD A;  3C1F A;  1BCP C;  2CHB D;  3K5M A;  1LTA D;  1F2L A;  1CQF A;  3VR5 A;  1SEB D;  1I6V C;  1STH A;  1I3Q B;  2R3Z A;  2IW3 A;  1U4M A;  3NTI A;  1BUV T;  3MHB A;  1G2S A;  2XSC A;  1EY6 A;  1A6X A;  4MHE A;  4A3F B;  3H0G B;  4PMW A;  2CQA A;  4BBR B;  1FD7 D;  2JA6 B;  2L55 A;  4V19 0;  3HGB A;  4IUT A;  2CW0 C;  5C44 B;  3M7G A;  5C4J B;  2F0D A;  3CKI B;  3BYT B;  3NHH A;  1EIH A;  1YNJ D;  3I90 A;  4HR7 B;  4B9W A;  2RKS A;  2O5I C;  5COY A;  4E6I A;  2JA7 B;  1XX8 A;  1JWS D;  2WP8 J;  2F0V A;  3OW7 A;  1SNP A;  1GHJ A;  4RFB A;  4DAP A;  4KJN A;  1HFG A;  1VDZ A;  4A3G B;  2B2Y C;  2Q8T A;  5BN5 A;  4A3M B;  4CKE A;  2AQ1 B;  1S5B D;  2RSN A;  5KEE A;  2Z4H A;  1OXV A;  1JOO A;  1QNU A;  1EWC A;  1VCI A;  1GUN A;  1MI2 A;  3U9O A;  5A2Q L;  5IT9 L;  4ME5 A;  4RGM A;  3TP5 A;  2QF7 A;  1I4R A;  2FFK B;  5K36 G;  1SNC A;  3M85 A;  4K8J A;  3OSO A;  3OIQ A;  1KLU D;  2F1M A;  1LTB D;  3NPP A;  3K5N A;  5J1Z A;  2G9D A;  3RD4 A;  2QEJ C;  5ELE A;  4C3I G;  1KAB A;  5TSS A;  2FIN B;  3J81 E;  3PO2 B;  4PMB A;  4P2C B;  1TWA B;  4XYQ A;  1TS2 A;  4CJ2 C;  3EJI A;  5EKL A;  3VA5 A;  1JOQ A;  3HEJ A;  5C3W A;  4XQJ A;  4L63 B;  3URY A;  3R3O A;  2EY6 A;  1WTQ A;  1CHP D;  2BE5 C;  2NYZ D;  2WV6 D;  1GUT A;  4IFD G;  3FKI B;  3R2I A;  2C5C A;  5I9O A;  5C4H A;  1JR0 D;  5ELB A;  3RUZ A;  2K04 A;  4OO1 G;  2B8F A;  5KGU A;  2L0C A;  1J9O A;  1B1Z A;  4X3T A;  1STA A;  4DF7 A;  2EOT A;  3J80 L;  4ZRZ A;  3SK4 A;  1D5X C;  4TQU S;  1G8Z D;  2PCF B;  2X6L A;  4UAI A;  3P7J A;  4K5V A;  1V8Q A;  3S2H B;  3CRK C;  2L11 A;  4XIG S;  4X3U A;  2EPB A;  1A2U A;  3I70 A;  4DGZ A;  1LTG D;  2KVM A;  5IGD A;  2A6H D;  3G7L A;  2HCI A;  3DEO A;  1KDC A;  4K5X A;  5IGF A;  3QJY A;  1SNQ A;  3RLF A;  5KYI A;  2JA5 B;  3WDN A;  1LTI D;  4AYB B;  1STN A;  4FNF A;  2K32 A;  3D3R A;  5KRU A;  1Y8N B;  2XRQ D;  2OEO A;  1FNU A;  4RCO A;  4OGQ C;  1LT5 D;  3I4L A;  2Q8R E;  2B2W A;  1EFI D;  4C56 C;  4U68 A;  1B3A A;  4CHT B;  2O4X A;  4ZAI A;  2KCC A;  1EY4 A;  3PUW A;  4FF2 A;  4QUC A;  5KNB A;  5JPM C;  4I7Z C;  4DNR B;  2NVY B;  5I2Y A;  4HN7 A;  2EYP A;  2N55 A;  2DN8 A;  1J8I A;  3GV6 A;  5CV6 A;  4U67 3;  1NR4 A;  4KY7 A;  1RTO A;  2D2C C;  1PRT F;  3PIO 3;  1SMY D;  4CKC A;  1EQT A;  5BN3 A;  1H9K A;  1GUO A;  2A69 C;  2PZT A;  3DWP A;  2QDB A;  5E1F A;  4GZY C;  2BOS A;  3V2T A;  2NN6 H;  2SNM A;  4G57 A;  2J0T D;  5CC4 A;  2H4O A;  4ZUJ A;  3HOU B;  3V05 A;  1PDQ A;  1BO0 A;  2BE5 D;  4FF1 A;  3NXW A;  1D5Z C;  4MN3 A;  3NE5 B;  3U9S A;  1C8C A;  3NWT A;  1H9M A;  1DOL A;  3T56 B;  4IUR A;  1X32 A;  3BVG A;  3C2P A;  2KUM A;  2RQX A;  4XDX A;  4EVO A;  1G91 A;  1D6E C;  1SJH D;  3MEH A;  4LMQ D;  1B50 A;  1FYC A;  3C46 A;  1W6K A;  2DY8 A;  2E74 C;  1O78 A;  1K83 B;  2F0U A;  1Q1E A;  2K01 A;  1EYC A;  2F3V A;  5EJW A;  1L0Y B;  4XT3 B;  1EY7 A;  2FHT A;  4DXG A;  1WTR A;  4CJ1 B;  4LAA A;  1RF2 D;  4CJ0 B;  4CGY B;  4IZ8 A;  3S2D B;  5I6W A;  1RTN A;  5T1I A;  2HCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...