2KCNA

Solution structure of the antifungal protein paf from penicillium chrysogenum
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antifungal protein
publication title Functional aspects of the solution structure and dynamics of PAF--a highly-stable antifungal protein from Penicillium chrysogenum
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Antifungal protein
total genus 4
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kcnA00
2KCNA 2NBFA 1AFPA 2MHVA 2NB0A
chains in the Genus database with same CATH superfamily
5A2QL 1NSNS 3H3VC 2VNUD 3D0FA 5C0XG 1OTCA 1LO5D 3I2ZA 4KKSA 4IJLA 1Y1VG 4DK6C 2L4NA 1QUQA 2XRSD 5DEHA 2NN6G 3ITPA 4I7ZC 1A6XA 3TP6A 4E6IA 3BVZA 1RTOA 3CF5A 4DV0L 2LFNA 5C44H 1TKWB 4BA2I 1LTLA 1PDQA 3J80i 1VQAA 4NKLA 2PZTA 3JAMi 5CORA 2NZHA 2E2JB 2F0DA 2N3SA 3NP8A 3NSWA 4ILWA 1YVCA 4I7AA 4DV1Q 1EIHA 1PLFA 2PNHA 5JVG3 1Y8NB 5EBCA 2O5IC 1WOCA 1XJVA 3V05A 2VUMB 4DFAA 2EY1A 4AH6A 5IT9c 1PH6A 5KEEA 1EZ6A 1EIFA 1X56A 4K2LA 1Y1WB 4KHVA 5IP9H 1E1TA 4A93B 1HQRD 1STGA 4F7XA 1JE5A 1TWCH 4A3KH 3KLSA 3FKIB 1ESRA 2O4XA 3H15A 1WYDA 3M7NA 4CJ0B 5IYCH 5I4DA 4KHPL 1AZPA 4G7OC 4L8JA 2F4IA 5GAGC 3I4NH 1I6HB 3G6EA 3HKSA 1GJXA 4BBRH 1IBKL 1UE5A 2KHIA 1WTOA 4B3MQ 2FMMA 3S16B 3PUWA 5G3LD 4UDUC 5IIFA 5LMUQ 1HZAA 3AFQA 1KABA 4QY7A 3J7AF 3CHBD 3CW2C 1F2LA 3IKJA 2ALYB 4DR3Q 2E2IH 4DV7L 1TS4A 2WP8J 3HZXA 1DOLA 4JG2A 1RIPA 3A8IE 3J7A5 1IKLA 1QVCA 1I94Q 4A3GB 1MHWC 3I8ZA 3OSOA 1QVGA 1QNUA 4RA8A 4PMBA 1X3QA 4K0KQ 5J3BA 1M4VA 3OTOQ 2CCZA 4XQNA 4BY7H 4CKEA 3STBC 4FO2A 3UI2A 2EYJA 1XPRA 3M4YA 2KBNA 1FGUA 4BS9A 5EJWA 5C4JB 3K5OA 2Z6BA 4ZK9B 5G3LF 3HOWH 5LMUL 1E0BA 3I56A 1VQ4A 1VDZA 3D31A 3QWNA 1CQVA 3MTSA 4IPGA 2L12A 3OW7A 4PNYA 4IUPA 1VF5C 3PO3G 1LT4D 1QOHA 1LYLA 1YNNC 3N6RA 3SVMA 4DK1A 1RKNA 4IPDA 1SNCA 1I94L 1UE7A 5CC4A 4UP8A 2N78A 1L1OA 1NR2A 3SEBA 1U0LA 2K75A 1ET9A 4K0KL 3H0GB 4ALPA 4ZLTF 2OF1A 1RF2D 4IZ8A 3HOZG 1LTBD 1JB7A 1AP0A 1Y1VB 3F2UA 2F0TA 4BA1I 1PZJD 2E5LQ 4LW1A 3SXHA 3HOUG 3CKIB 4XDXA 2HHHQ 3EVQA 1SNPA 1SYFA 1U4MA 3U50C 2UXDL 4DK3C 2YTXA 3A8JE 3H6MA 4B3SL 4MNOA 4F8MA 2EE1A 2UXCQ 1KNEA 1G2SA 1HZBA 3SK8A 1E1OA 5E3FA 4DGZA 1OXXK 3RLNA 2B2TA 5I6YA 3CP0A 4YWMA 1D7QA 1LM0A 2TSSA 4POGA 1S5CD 1YHBA 5BR8L 2UUCQ 4R8IA 1SYEA 3CC4A 2PW7A 3M3YB 1GKHA 1ASYA 3AMUA 3I4MG 1D5MC 2HHHL 1X32A 2D0PA 3PUVA 4JI0L 5BN5A 5C3EH 3CD6A 1FVIA 1DONA 1V43A 2L55A 4A75A 2F0HA 2WB1E 1WVLA 4GNXC 3K5NA 2HCCA 1YEZA 4IFDH 2DJGC 5JJZA 1TWFB 2ZTEA 1CT1D 3T16A 1ICFB 4YCWA 1H9RA 2A8VA 1K8MA 1KHIA 2PPBC 1QNKA 1EQQA 2JA7H 4UHVA 4GKJQ 4R4CA 2UUCL 4LFCQ 3M4PA 1P8LA 1W6KA 4H0LC 4P74A 3NBHB 1VQKA 1PV4A 1SR3A 5IY0A 4G4KA 1VQPA 2CQOA 2JK8A 4OIKA 2VQFL 3VR4A 3CC7A 1TS2A 1ICWA 2E76C 2F4VL 5C4XG 1SROA 1I4PA 4N9TA 4AIMA 1P16A 2R92H 2RDFA 1EU3A 4G7HC 1Y69U 4JI6Q 5IP9G 4C2MB 2AQ1B 1IYJB 1TWGH 1QUQB 4NP5A 4HEDA 1RHPA 1H9SA 1ML0D 4X3KA 3O13A 1HA5A 4ODGA 2X69A 1CK1A 3EJIA 2LMCB 1U4LA 2K01A 3T53B 4R4OA 3PO3B 1STYA 2H5XA 3RZOH 4G7ZC 2LXJA 1QZGA 1SE2A 3DUZA 4Y7NB 3PUYA 3U9OA 1R9TB 3GTMB 2K5VA 2Q2IA 4QIWE 3W5OA 2UU9Q 3I4NG 1C0AA 1H9JA 4DV5Q 4ULLA 1SEBD 3QOJA 2E2JH 1DOKA 4QF4A 2HT1A 3U9SA 1DZ1A 3HOZB 3DMUA 3IRBA 2Y0SE 5FLMG 3TRZA 3L3OC 2ZM6L 3N52A 3HOUB 2VQEL 1TXYA 1F9RA 2ZTDA 1Y1WH 4A93H 1IW7D 4L6TB 1PH2A 4DAYA 4DR6Q 2MO1A 1LT3D 3RD4A 1PTOB 1FGBD 4DR2Q 4JV5Q 2EPBA 2RQXA 3FKIH 1W2BA 1UE6A 4F88A 3BZDB 1CZGA 2B63G 2ID0A 3FVQA 1VQOA 3TN2A 1IL8A 3CCMA 1I6HH 1VQCA 3BYYB 3SHLA 1F2YA 1A2TA 3OPOA 3ZYYX 4K14A 2FMCA 3S16H 4UY8C 2DN8A 2QDLA 2I5MX 3I4MB 1IYVA 5IP7G 1BBXC 4JOIA 3U4ZA 1PH4A 1A2UA 2RA4A 4A76A 2PO4A 2P5ZX 4O0AA 1XMQL 4EVOA 5CBAE 4A3GH 3LWEA 3ERSX 4OELB 1I6VC 2UUAQ 1FR3A 2XVSA 1S4ZA 2SNMA 3J81i 3SK6A 3T56B 1HNWQ 3GTGB 4KD3A 4IUTA 3KUPA 3PIO3 5C4JH 2QF7A 1OXUA 4R4QA 2D9UA 3TMEA 4A3JG 5KYIA 4N8X1 2PW5A 1HCZA 5JJLA 1N34Q 1ENCA 2O5JC 4C56C 3OMGA 5IYDG 1V1QA 3OIQA 2R7ZG 4OO1G 3TZUA 2KECA 1L1OB 1S3OA 4J6HA 4KJOA 3EBEA 5C4XB 5EBDA 1LTGD 4X3TA 4ZYSA 1PTOD 2G5DA 2KCMA 1SXTA 1ASZA 2A6EC 3H0GH 2NUCA 5CGKA 1ZYRD 3KDFA 4FF4A 3HKZE 1PFBA 3QOLA 3GP7A 1I3QB 4GNXA 1N32L 1CSQA 1TWCB 1UEBA 1Y1VH 4P75A 4DR1Q 4LF7Q 5ELCA 4JI7Q 3M9BA 4QMGA 2NN6H 1WD0A 3H91A 1PZID 1FJGQ 1EYDA 4TRDA 4CDCC 3E3XA 3QB3A 1VQGA 1BCPB 1N34L 5IGDA 4GOPC 2F0KA 1D5ZC 1SFOB 3I4NB 3F8TA 1Z7TA 3OW2A 2XGTA 1G8ZD 1SE8A 1YBYA 4C3HG 5C4HA 3AYHB 3LGJA 4RAUC 3J81j 4X3SA 1PTOF 4KI0A 2IY5B 2HDLA 2K5DA 5CR3A 1T5EA 1VQNA 2JA7G 2KCNA 1DGSA 1IBLQ 4KKTA 5JEAJ 3UDXA 3PO2H 5GROA 3M4OB 3HOXG 2HDMA 3A54A 1Q86C 1X3GA 3P20A 4KTAA 4JI4L 1KQSA 2DJFC 3D6CA 4PMWA 1HA6A 2B39A 3M3YH 2LSSA 1U4PA 4GLXA 3CMEA 1HHVA 3H94A 4KN7C 4G57A 1GVPA 1FJGL 1FNWA 1H95A 2D5DA 2VL6A 3E9IA 4RKLA 3J80E 1LV9A 3D4WA 2GVAA 3MEFA 5FK9C 1K83B 1WTHA 3JAME 4IOCA 2B63B 4A3LG 2F0GA 3D3RA 4OHJA 2EJMA 3QIAA 1LTAD 4R4IA 1QWYA 2AKWB 3CCUA 4DV4Q 1LABA 1TWFH 2K33A 3KLSX 1S40A 2F0EA 3PQIA 2C9OA 4FYDA 2IJ0A 3TBIB 5LL6S 4JI1Q 4HJ8A 2K7VA 3LX0A 3ERQA 4M1UB 2CFMA 5EAYA 4X3UA 2A69D 5JOBA 5C4ZA 1HR0W 4MIUA 4R4TA 4DV2L 2XSCA 5GAHC 3OWFA 3NHHA 5FLXL 2F1MA 2LXKA 1V9PA 3T1HQ 2V4DA 2VB2X 3FPPA 2EYOA 1NJIC 1LUZA 1IKMA 4OIJA 5H1SE 4J1MA 2UUBQ 3FPUB 3RLOA 2HQEA 1BCPD 4UAIA 4RGTA 1KXLA 2DNEA 4B3RL 2F0QA 4IPCA 1M8AA 2AWNA 1H9SB 3HG9A 3PGZA 4DV3L 2NTTA 3MZ5A 1Y1WG 4C2MH 4JI8Q 1KTKA 1HJPA 3BYTB 3TS0A 2B3GA 4ZRZA 4LFAQ 4A3JB 4QQBX 2KCTA 4JI5Q 1GUTA 3ND9A 1I4RA 3PO3H 4X62Q 2R7ZB 1WJJA 4WORA 5HURA 4Y7NH 3M85A 1X3PA 1R9TH 1PVOA 3UDFA 1KAAA 3T1HL 1NY4A 4TSSA 2I46A 1SBBB 2DGYA 4WRDA 1WTWA 1GUGA 3R2IA 2CVRA 2DY8A 2UUBL 3KJOA 4NPSA 1UWVA 3TZDA 5FOBB 1BCPF 1E24A 3T1YL 1HZ9A 2WKDA 2ICEC 2WIIB 4B3TQ 3FHWA 3HOZH 1PFMA 3SR1A 3H09A 3OIPA 1E3PA 4DUZL 2A73B 4QB4A 4DAYB 5CYUA 1EOTA 1VQIA 4KKUA 3RZDB 3TEHB 1HTPA 2EOTA 1PA6A 1PTOH 3OMCA 5EGTA 4A3BH 4B08A 4FF1A 1JORA 4X62L 4X66L 1KNAA 1FD7D 1SYGA 2B2UC 2QW7A 4C3HB 1JWSD 2CH4W 1DM0B 2CWPA 4ZUJA 5A35A 1ESFA 3BU2A 4L5SA 1Z47A 1IZ6A 3GTKB 3UE1A 4ME5A 5T1GA 3S1RB 3S14H 2JA7B 5FJ8G 3F2BA 2K04A 3QG1A 3BZCA 4CGYB 3HOXB 2ZXOA 1U9RA 3DM3A 2F3WA 1XXGA 3K5LA 2XNAC 3I4MH 2K14A 2IX1A 2EJGC 2H4OA 2NVXB 1KLGD 1STEA 3H0GG 1GUSA 4OL7A 3T13A 1TWGB 3EROA 5EKKA 4K5XA 5EKIA 5TSSA 2HUGA 1NMGA 1UE1A 3C1EA 3MVVA 3WDNA 1JE4A 5D3IB 3GTGH 1SMYC 2A68C 2BDNA 2ENBA 3RZOB 3GTJB 3VR3A 2BA0A 1CKNB 1GUNA 2NVQB 5HGTA 2Y0SG 3R3OA 3B6YA 4PZ8A 1CHPD 3K58A 1SE4A 4DAVA 1VQ8A 4FVMA 1EQTA 3STBD 3CRLC 1SNMA 1YI2A 2QCPX 2R3ZA 3A7LA 1TWHB 2YV5A 1Q82C 5NUCA 2KOLA 1CUKA 5C4XH 3PO2G 3KJPA 3KDFB 2SOBA 3AQQA 2F3IA 2NWGA 1WFQA 2Z4IA 4GNXB 1M1KC 4LFBQ 2MNAA 2JA8G 1JC7A 1SNQA 5CV9A 4CBVA 1K9MC 2KQ3A 1I3QH 1WTQA 1WTPA 1YNND 1PRTC 1O7LA 3TP5A 3V96A 2DUDA 2ZJQA 2QA4A 1RODA 4IN3A 1JWMD 4PQXA 2SEBD 1YJNA 3NWSA 1STAA 4H13C 5ELEA 1NR4A 1SFOH 2YTVA 1PH8A 4DV1L 2JEBI 3DM1A 4JPBW 1J8IA 5I2YA 1BDOA 1XNRQ 1JT8A 1EWCA 1EYGA 1STBA 4DKAC 1MKHA 1HPCA 1VQBA 4ZUIA 3M4OH 5FLMH 1XNQQ 2KUMA 4ZQ3A 3NQTA 1WTVA 3BS1A 4S3SA 4HIOA 2B8GA 3BZKA 1LT5D 3H3VH 4O2DA 1BBWA 2AMCB 4GZYC 1L0YB 1BKBA 4F87A 3MXNA 1I4GA 2WV6D 1JOKA 2KEEA 3D8GA 4YHHQ 2C5CA 2AUJD 3PV0A 3CQZH 3HOVG 1G91A 2B63H 1K83H 2NVTB 1EZ8A 5M3FG 2PZWA 3LNNA 4AYBE 2GN5A 1MIUA 5IGCA 4B3ML 4C3IG 5JAVA 1A62A 2B2YA 2Z0SA 1TWAB 1QCBD 4BXXH 4KV6A 1PH1A 3HKZG 3A74A 1KIXA 4DR3L 3CPFA 3Q8DA 1XNQL 2VY3A 2K32A 5IP7H 1HXYD 3M7GA 3IFTA 4HJAA 3NUCA 3I7FA 1JB3A 4I65A 4GS3A 3J7ZC 1YJ9A 4LF8Q 3ONAB 4A3DG 1EWHA 2A5HA 1KD1C 4YCVA 3OTOL 4JBWA 4FDBA 2I0QA 5IODA 4QIWB 1F9SA 4FXKC 1XX8A 1EU4A 1A3UA 1Q1EA 1AE3A 2M9VA 3MHBA 4B9WA 1BXTA 4EQNA 3K7UC 4JBMA 5E1FA 5KIXA 5FLXc 2FFKB 1MJEA 1I4HA 2Y0SB 3I4LA 4HIKA 4RGOS 4QJFA 4A3JH 3KF8A 2Q2TA 4A3BG 4IFDI 2PI2A 4GN3B 1OO9B 3WWVA 3ULLA 1Q12A 4DV6Q 5IYDH 2R7ZH 4OO1H 3A55A 4KHZA 1QJOA 4N8FA 4ZCKA 3MEHA 4LF8L 1T9HA 4DR5Q 4LUOA 3OWEB 3E5SA 2RDGA 1SJED 4EQOA 3PIOA 3PO2B 4MTKA 4C1NI 4CKCA 3J81E 2JA8B 1PH9A 1VQMA 2K5WA 1R4QB 3W2DA 4IALA 2E5LL 1B9MA 3PCOB 2XWJB 1EYAA 3ICEA 1YITA 4LJZC 3RZDH 4IUUA 4B9XA 2UXCL 4XQQA 1SYCA 2K5NA 3HOYH 1J5EQ 4DV6L 2EY6A 3GO5A 4N9PA 4XT1B 1VQLA 5GQOA 3DHQA 4C3HH 4DXGA 4FXGC 3NBIA 4K8JA 2IWHA 4NXNQ 3GTKH 2D62A 1EQVA 3UDGA 4Y52H 3P1HA 4HCEA 2KCCA 3I55A 3S1RH 3TS2A 3DWPA 5K36H 3NELA 3HOXH 1B2TA 4P71A 1V1OA 3CU7A 2B2WC 2JQOA 1XWEA 1GM5A 1BNZA 3D4DA 4R1JA 3I3CA 5DAUA 1SNDA 3I72A 2XWBB 1KRSA 3PF4A 4XQJA 2NVXH 3VA5A 2A19A 3HOVB 2NVYB 4A3LH 2BE5C 2CQAA 1B7YB 1E7ZA 2EZVA 3A0JA 5M3FB 3Q6SA 5JEAH 2A74C 3FP9A 1D1IA 4C3IB 2ZXPA 4OEMB 1TS3A 2EDGA 1N36Q 4NXNL 4OX9Q 2BCOA 4GKJL 1U4RA 2WAQE 3HKZB 1RCVD 4JI3Q 1A0IA 4LFCL 3GTJH 3DWQA 2NVQH 1UNSA 3WOEA 4RCNA 1VQFA 3VA7A 4A3DB 3OHXC 4GLAC 3CXCA 2VXWA 1J9OA 5DNFA 4XT3B 1TWHH 5ELOA 4JI6L 3HRZC 2D0OA 2NZ1D 2XRQD 1SLJA 2IL8A 2WFWA 3K80C 4NB3A 5COYA 1FNUA 2R61A 1OXTA 1XMOQ 1OXSC 3CRKC 4A3BB 2NTSA 4JI3L 1GHJA 2L5TA 3Q23A 2Q2UA 5C3WA 3S1NB 5IWAQ 3A8KE 2FHTA 4ID6A 4X64Q 2LKVA 1D6EC 2M2LA 3RNUA 1HR0Q 2UU9L 5KGUA 1K3BC 1KL9A 1HNZQ 1TIID 1Q1BA 1ILQA 2ZTCA 4DV5L 4YWLA 2A6ED 3VR6A 3WOFA 3FMCA 3S14B 1W6JA 2ZJPA 1JWUD 1CHQD 1KLUD 1OXVA 5FKAC 1M90C 4HN7A 4BXXG 4LMQD 5CV8A 2FJ2A 4XXEA 2BOSA 1WCMH 5LMNQ 2N8NA 1PYWD 4LUVA 3E0EA 2AWOA 5J1ZA 2IX3A 2Q8TA 4IO9A 4DR6L 1XMOL 3E6ZX 1NE3A 3J80c 2F52A 3NXWA 4DR2L 4JV5L 5IGFA 3MXNB 3JAMc 1JCKB 1TS5A 3A5ZB 2F0MA 1HUNA 4LUZA 4ABNA 4X64L 2EYFA 2F0LA 1HNZL 4QL5A 5C0XI 3A7AB 3VDYA 4LF6Q 2NVTH 2EYMA 2OCEA 2ZXRA 5C6AA 1NAPA 3K8AA 1GUOA 3T51B 1XPOA 2NN6I 2JE6I 2NZOA 1AFPA 5FJ8H 5I6WA 4KD4A 1RTNA 3PSIA 1DD2A 1TWAH 5LMNL 4GLVB 1F77A 1CKNA 1EY4A 3KLRA 3W1GA 1UUPA 2Z8LA 4DF7A 4HJ5A 2F03A 2XIWA 2E74C 4JVZA 1EY8A 2L11A 2JA5H 3KF6A 2Z4HA 1Q3LA 3D6WA 2UUAL 3S15B 2PMZE 5EQ0A 1Q46A 2YTYA 1HNWL 2RBMA 4C3JG 1K28A 1IBMQ 3KBGA 1DJRD 3IL8A 4RWSC 3CCQA 4OONA 3S9WA 4P72A 4LAAA 3W1BA 4O42A 3T4AC 1H9KA 3KF8B 5A2QE 1VMCA 1O7ZA 2A6HC 3HOYG 3ULJA 3CMAA 3GV3A 1JICA 3TP8A 5AJ3Q 5M3MG 4HIMA 1B8AA 1EOVA 2FINB 3V2TA 1QE6A 4NMZA 5J22A 4RHSA 5K36G 4AQYQ 3IAYA 4FNFA 4DR7Q 1K8AC 1AN8A 5BN3A 2K50A 2K28A 4J15A 3BDLA 1PYBA 3GTQB 2JA8H 4DR1L 4LF7L 1TU2B 4KY7A 4JI7L 1SNOA 3GTLB 4LF4Q 3KFUA 3DWAA 4DK0A 5ELNA 3K81C 4XYQA 5JPMC 5CV6A 3CQZB 4O1NA 1CFMA 3GDEA 1CM9A 2ZT9C 2K5HA 5JEAG 1VCIA 4LF5Q 3GTOH 4RH6A 3EIVA 1VQ9A 4L5QA 4HAEA 3MFYA 2NYZD 2EIFA 4AQYL 3R8BA 1IBLL 3K57A 2B8FA 4X65Q 1D1KA 1EY0A 4JCVE 1JMCA 4K5VA 1HH2P 2E8GA 1ONLA 4UP7A 1AW7A 4U68A 1RJTA 5ELDA 4LF9Q 4A3MB 1PRTB 5M5YB 1XPUA 3EFXD 2EXDA 2F0WA 1G6ZA 3AFPA 3I70A 1O7IA 3PF5A 3MFGA 2NVYH 2JEAI 3HOVH 4PMCA 5JJIA 4QUFA 5M3FH 4DV4L 2MPMA 1CKMA 4YWKA 3VR5A 1B3QA 4C3IH 3S2DH 2EYLA 1Q8KA 4RG1A 1YHQA 4JI1L 4DA2A 3NE5B 1JJCB 2SDFA 4Z9CB 2JA6G 5EPJA 3I91A 2L0CA 3M4QA 1SSOA 2F0UA 3Q0AA 3SK5A 1X55A 2WB1G 4ZAIA 4IURA 4OWTB 4A3DH 3CAMA 4LWCA 1LTSD 3J7AV 4DNTB 2A68D 5BN4A 4C3JB 1WCMG 5HGQA 2ATWA 1VQEA 1GOZA 4H02A 5LHY1 4V0BA 3X3NA 1JJGA 1HUMA 4JI8L 2XTIA 4CDDC 3BVMA 2J7ZA 4LFAL 2HIXA 4JI5L 2E2HB 1V1PA 5IGEA 3HOYB 5GAEC 3QJYA 3TP7A 4JW0A 2PZUA 1B44D 3S1NH 2L15A 5M3MB 4H44C 1BBUA 5ISRA 1X6OA 4NDXA 1F2MA 5ELBA 2AUKA 2MJ8A 5CV4A 4CJ1B 3MC0B 3BG3A 3I4OA 2EXZA 1HTLD 3U58A 1B4OA 1AH9A 3RN5A 1PRTD 5D3DA 4B3TL 3NWTA 1NTGA 1B70B 4LK1C 4HTHA 1GHKA 3KLWA 3G6JB 5FO8B 1YJWA 1BF4A 2HIVA 1RD9D 3S1QB 5KYLA 1DXMA 1O80A 2JA5G 3MXPA 2RDHA 2UXBQ 2WAQG 1A63A 1VF7A 1YNJC 1IXRA 1HQMC 5CBEE 5K5PA 1LTID 4K2KA 1STNA 5C0XJ 3Q22A 1SRUA 4OXPA 2G9DA 4GOPA 4JBKA 2B2TC 2WINB 1PRTF 2EVBA 1PH5A 2XN9C 1C48A 4POFA 1QILA 2I07B 2KVMA 4ZKBB 4IUQA 1Y8OB 1N8RC 5CV5A 4CJ2C 2IT1A 2X6GA 1C4QA 1PYSB 4X6AH 4BBSG 3X3MA 2VZAA 1VQ5A 2UXBL 1LTRD 3KK7A 3KF6B 1EY9A 4A3FG 5FO9B 1CKOA 5CV7A 4IUNA 1NCVA 3R2TA 3SK4A 1YNXA 1SYBA 1VQ7A 3S15H 3S1MB 1D8LA 3S24A 4KHPQ 2CW0C 4J8QA 1ZKOA 2F0NA 3H3VI 2RSOA 4CDFC 1IBKQ 2WACA 4DU9A 5IGGA 2B2VC 3GTPB 2JA6B 2OWOA 4HSVA 3C46A 3VYUA 1UAPA 5ELFA 3ULPA 4NW2A 1WTXA 2YU9B 3C2PA 3J80L 1EEFD 1Z9FA 1HFGA 5LL6X 1A3VA 4DV7Q 2WB1B 3JAML 4IJHA 3J81c 3MAQA 3UDIA 4HSPA 1WCMB 3R93A 1MSGA 3JC66 1Q81C 1CQFA 4LFBL 1KDAA 1ZXTA 1K0SA 4V190 4IUVA 1ENFA 1MBYA 1CA6A 2K4KA 3CCRA 2HCIA 3GTQH 4JYAQ 2K1BA 4MZ9A 3GTLH 2TMPA 3DEPA 2F0OA 3K5MA 2ZJRA 3I90A 1O78A 2E2DC 3KOJA 2J0TD 4IOAA 1EFWA 2KJXA 3G7LA 3KBXA 1BUVT 3RR5A 1IYUA 1Z6HA 1XNRL 2EY2A 2F0JA 1LTTD 1X65A 4HJ9A 4GN4B 1F9QA 1NUCA 1X54A 2HQLA 5DM63 1BQQT 5GADC 3MA2B 4OO1I 1G2TA 5FO7B 4BY1G 2R7DA 4YY3Q 4ME3A 5EKLA 3G4SA 4NXMQ 4A3CG 4JYAL 2JA5B 3K7AH 5KNCA 4DPGA 4APVA 1PFSA 2WAQB 1L0XB 4GN5A 2ASBA 4L5TA 4PZ6A 1XYIA 2JYOA 3FEWX 4A3MH 1N9WA 4YHHL 5D14A 5M5YH 1X3FA 4FXDA 2UXDQ 1PXUA 5HY6A 1C7YA 4B3SQ 4JI2Q 2F0SA 5L37A 3C3LA 3FDTA 3K59A 1A3TA 2B2UA 3L2PA 2OQ0A 5E4XA 1I50H 3QR8A 1GXDC 5EPLA 1XTCD 5M5XB 3S2HB 1NMFA 2K05A 5E7NA 4U673 5I9PA 3CCJA 1F2ZA 5F2DA 4JOIC 1TT2A 4YY3L 5IT9E 4NXML 5BR8Q 4BBSB 2BE5D 3CCVA 2RHSB 1G291 3VYSA 1SN8A 4A3IH 3SDZA 4A3FB 1I4XA 4DNRB 2MGSA 4JI0Q 4K6LA 2F0PA 1PFNA 1DYQA 2R93G 1AE2A 1BO0A 4JI2L 1LACA 4C3JH 3NTKA 2VW9A 4CDEC 2IX0A 4EQPA 1MGSA 4M8AA 1QZHA 2H1EA 1V1PB 1VMPA 5CMDA 2E2HH 2HD3A 2OT2A 5IE8A 1G6PA 1WI5A 2I5HA 1KC8C 3GTOB 3AU7A 2DY7A 3HS0C 4Q5VA 2GVBA 4RFBA 4UPAA 5M3MH 1YIJA 3SGIA 3NEMA 1J6QA 2J4XA 4DR5L 4XYOA 1W3SA 2IHFA 3RN2A 4ZKCB 1H9MA 1GD7A 3HEJA 3PUXA 4L5RC 2VQFQ 2PYKA 1K0RA 5J39A 4FF3A 3OOCA 4Q0FA 2Q8RE 2F4VQ 3EA6A 5KRUA 1WTRA 2A1AA 3BDCA 4KY5A 2MQHA 4RMFA 3VYRA 3S1QH 2GA4B 1HFNA 1IHZA 2CWAA 1C9OA 1N33Q 5C44G 1J5EL 4A3EH 4KN4C 2B2VA 4GOPB 1EY5A 1QVFA 1PH7A 5M5WB 3S2DB 2JJQA 5JJKA 2L9HA 2KEDA 1JOOA 2PMZB 4R9WA 3S17B 2EY5A 3LWUA 4JK1C 2QKIC 3EQLC 2JA9A 4BY1B 1XTDA 4RGMA 5IYBH 2BA1A 4OWWB 3Q24A 1UEAB 1X9NA 2Q2HA 2OTLA 2ZM6Q 2RCNA 2PQAA 1SE3A 1NBWA 3PUZA 4FF2A 1VQDA 2VQEQ 2E75C 4A3KG 1QB5D 2FXQA 1EWIA 3PMFA 2MP1A 3RLFA 1N33L 2RKSA 5IYCG 4LNQA 5FLXE 3K0YA 4TQUS 4PV1C 4HR7B 1SDFA 3S1MH 1VS0A 3NK9A 1V8QA 1S5DD 1N36L 1VQJA 4BBRG 4OX9L 4R8NA 3VR2A 4DUYQ 2QGQA 4YIJA 5C5MA 1PMRA 2AHOB 1LLRD 2KA7A 3GTPH 2VUMH 4DAPA 2JA6H 4HCSA 1ENAA 2F0VA 1DCZA 1PHJA 1ZEQX 2YU9H 3NQIA 1VQ6A 4A4IA 4PG3A 1L0WA 3CCEA 4QCLA 2R93B 1EUJA 3F2CA 1XMQQ 4K6DA 1CA5A 3DEOA 1KRTA 3TDQA 1TQOA 2QEXA 4BY7G 5M9OA 2DNCA 3MXGA 3NPPA 4KY6A 1U5KA 3VYTA 3DLLA 2A6HD 4MN3A 3KYHC 1B53A 1K8GA 1A8VA 1HNXQ 3HFZB 1EIGA 2F0IA 4DUYL 4KJNA 3HOWG 3AB9A 3K6OA 4A3MG 4L63B 5IWAL 3J7YW 1HR0L 4RHRA 1HRJA 2VB3X 1B9NA 2R7FA 2R6GA 5C5LA 3A56A 4HIDA 1I5FA 4KMUC 1S5FD 2KHSA 4CKBA 2I5LX 2ES2A 3UE0A 5JPNC 1NNXA 1SMXA 2RVLA 4RGNA 4DR4Q 1TY2A 3U4VA 1K3RA 2B29A 3AEVA 1S5ED 3ZJYC 1C8CA 1HNXL 3G48A 4A3IG 3PIPA 1JR0D 1N32Q 4K8IA 4IPHA 2AQ2B 3URYA 5IT9L 3CPWA 5C44B 2BH8A 3SE0A 2N88A 4BWGB 1JJ2A 3L9AX 2EQSA 2K52A 4OWXB 2LY7A 2Z6KC 3ER0A 3W3AA 2G9HD 1EYCA 4LF6L 5D65A 1EL0A 3BJUA 1IW7C 2N55A 3J81L 1DOMA 3D4RA 2RSNA 4KK7A 2F0FA 1HZCA 4MTNA 1YZ6A 4DR4L 1CSPA 1Q90A 2KHJA 4IFDJ 5I9OA 4P2CB 5M5XH 2IPKD 3S2HH 1Y8PB 1FYCA 2Z1CA 4JBJA 3NTHA 4JI4Q 1LT6D 5C0XH 1TVXA 4WJWA 4BBSH 4A3KB 3A5UA 3MXUA 2B2WA 2BH2A 2JXMB 4FP5D 1SJHD 1X3EA 5C3EG 4A3FH 2PCFB 2RCFA 2LS01 1F9PA 1FNVA 1O7YA 1IBML 4IFDG 3TQYA 4AYBG 4WJ4A 4BBRB 2PNRC 1L2FA 2MO0A 1TY0A 2CH4A 2K03A 1S5BD 1RDPD 2MFIA 3DXJC 5IGBA 3GQBA 1BVSA 4A3EG 2MUYA 2JSOA 2IW3A 2E2IB 4WFN3 1G51A 5AJ3L 1R4PB 4DAMA 2QDBA 1CZWA 2YYZA 4DV2Q 4HMIA 4RCOA 2Z9HA 1S72A 1MSHA 4EQ5A 4OGQC 4DN4M 4DR7L 2CHBD 1FL0A 2NB0A 4P73A 4BY7B 3BVGA 3GD7A 5IYBG 1KDBA 1Q7YC 4H7BA 2R92G 1B50A 3HGBA 2M00A 3K7AB 3QO2A 4MHEA 4B3RQ 4JC0A 3CCSA 4LF4L 4DV3Q 1GO3E 1PH3A 1MD2D 3HOWB 1PTOC 2K5QA 1JOQA 4QGUA 4TKOB 1EQRA 1B3AA 1E2ZA 1ZYRC 3P75A 3K0XA 2X6LA 4RKBA 2QEJC 5T1IA 1E2WA 3NENA 2C35B 1E22A 4XIGS 4LF5L 3ND8A 5KNBA 3BDOA 1I50B 1Y14B 5E4WC 5M5WH 2IHEA 5C3XA 4X65L 3S17H 2MHVA 2CKZB 2L1BA 3L7ZC 1PZKD 2EYPA 2RHQB 4IQZA 2VUMG 1YNJD 2EYHA 3T1YQ 5LMNW 1RL2A 1K73C 4BY1H 4A3IB 4A3CH 1K8OA 2PQAB 4C1NK 1CTMA 1KDCA 3HP3A 3MWYW 4LF9L 4A93G 3P7JA 2KENA 4DUZQ 1JQYD 1IL2A 1ET6A 1EY7A 1SMYD 3NTIA 3FKIG 2VS1A 1BR9A 4GKKQ 1TR5A 4X66Q 1T5XD 4DNIA 4DXFA 3G71A 1D5XC 2B2YC 3I73A 5DLQE 3GTMH 1D2BA 2JP1A 1QG7A 3C1FA 2WKCA 1I4QA 1EFID 3TSSA 2SNSA 3CCLA 3GV6A 2NBFA 3CC2A 1EY6A 3L0OA 2N49A 5AFWA 2PQEA 4WJ3M 4EX5A 2OEOA 2PI2E 1L1OC 3FRPB 3RMHA 3EN2A 1BOSA 3PIP3 5EPKA 5C3EB 1E2VA 4YCUA 2CW0D 4UP9A 2JN4A 3HOUH 1KAWA 4HJ7A 4KLKA 1B1ZA 4A3GG 2F3VA 2A69C 1MI2A 2R93H 1GUWA 2EJFC 4GKKL 3F2DA 1Q8IA 2D2CC 4AYBB 1VQHA 2ICIA 3OYYA 2Z6KA 4QUCA 3E0JA 1EIYB 1CI3M 3TREA 4TVAB 1A15A 1AEXA 1MJCA 5KNDA 2QILA 3IFDA 4XTCS 1AZQA 2OQKA 1BCPC 1SAPA 4A3EB 5I2XA 4DV0Q 1II3A 1EEID 2OXPA 3F1ZA 1YHAA 2BDOA 4CHTB 5IOCA 2K6AA 2V1CC 1STHA 3E9HA 3RUZA 3NBHA 2Q8IB 4K5WA 1ILPA 4HMJA 4PZ7A 2RF4A 5JVH3 1SYDA 2O2LD 4EGVA 5DM73 2R92B 2AQ3B 1WD1A 2OTJA
chains in the Genus database with same CATH topology
5A2QL 1NSNS 3H3VC 2VNUD 5C0XG 1LO5D 4KKSA 2L4NA 2XRSD 5DEHA 2NN6G 3ITPA 4I7ZC 1A6XA 3TP6A 4E6IA 3BVZA 1RTOA 2LFNA 1TKWB 4BA2I 1PDQA 4NKLA 2PZTA 5CORA 2E2JB 2F0DA 3NSWA 3NP8A 4ILWA 1EIHA 1PLFA 5JVG3 2O5IC 1Y8NB 5EBCA 3V05A 2VUMB 4DFAA 2EY1A 5KEEA 1EZ6A 4K2LA 1Y1WB 4KHVA 4A93B 1HQRD 1STGA 4F7XA 3KLSA 3FKIB 1ESRA 2O4XA 3M7NA 4CJ0B 5I4DA 1AZPA 4G7OC 4L8JA 2F4IA 1I6HB 1GJXA 1WTOA 3S16B 2FMMA 3PUWA 5G3LD 4UDUC 5IIFA 1KABA 3J7AF 3CHBD 1F2LA 3IKJA 1TS4A 2WP8J 3HZXA 1DOLA 3A8IE 1IKLA 4A3GB 3I8ZA 3OSOA 1QNUA 4RA8A 4PMBA 1X3QA 1M4VA 4XQNA 4CKEA 3UI2A 4FO2A 2EYJA 3M4YA 4BS9A 5EJWA 5C4JB 3K5OA 4ZK9B 5G3LF 1E0BA 1VDZA 3D31A 3QWNA 1CQVA 3MTSA 2L12A 3OW7A 4PNYA 4IUPA 1VF5C 1LT4D 1QOHA 1YNNC 3N6RA 3SVMA 4DK1A 1RKNA 1SNCA 5CC4A 1NR2A 3SEBA 1ET9A 3H0GB 4ZLTF 2OF1A 1RF2D 4IZ8A 1LTBD 1AP0A 1Y1VB 3F2UA 2F0TA 4BA1I 1PZJD 3SXHA 3CKIB 4XDXA 3EVQA 1SNPA 1SYFA 1U4MA 3A8JE 3H6MA 4F8MA 2EE1A 1KNEA 1G2SA 3SK8A 5E3FA 4DGZA 1OXXK 2B2TA 5I6YA 2TSSA 1S5CD 4R8IA 1SYEA 2PW7A 3M3YB 3AMUA 1D5MC 1X32A 3PUVA 5BN5A 1DONA 1V43A 2L55A 2F0HA 1WVLA 3K5NA 2HCCA 4IFDH 5JJZA 1TWFB 1CT1D 3T16A 1H9RA 1K8MA 2PPBC 1QNKA 1W6KA 4H0LC 4G4KA 4OIKA 3VR4A 1TS2A 1ICWA 2E76C 1I4PA 4N9TA 2RDFA 1EU3A 4G7HC 1Y69U 4C2MB 2AQ1B 4NP5A 4HEDA 1RHPA 1H9SA 1ML0D 4X3KA 3O13A 1HA5A 4ODGA 2X69A 1CK1A 3EJIA 2LMCB 1U4LA 2K01A 3T53B 3PO3B 1STYA 4G7ZC 1SE2A 3DUZA 4Y7NB 3PUYA 3U9OA 1R9TB 3GTMB 1H9JA 4ULLA 1SEBD 3QOJA 1DOKA 4QF4A 3U9SA 1DZ1A 3HOZB 3DMUA 3L3OC 3N52A 3HOUB 1F9RA 1IW7D 4L6TB 4DAYA 1LT3D 3RD4A 1PTOB 1FGBD 2EPBA 2RQXA 4F88A 3BZDB 1CZGA 2ID0A 3FVQA 3TN2A 1IL8A 3BYYB 3SHLA 1F2YA 1A2TA 3OPOA 3ZYYX 4K14A 2FMCA 2DN8A 3I4MB 1IYVA 1BBXC 1A2UA 2RA4A 2PO4A 4EVOA 5CBAE 3LWEA 1I6VC 1FR3A 2XVSA 1S4ZA 2SNMA 3SK6A 3T56B 3GTGB 4KD3A 4IUTA 3KUPA 3PIO3 2QF7A 1OXUA 2D9UA 3TMEA 5KYIA 2PW5A 1HCZA 1ENCA 2O5JC 4C56C 3OMGA 3OIQA 4OO1G 3TZUA 2KECA 4J6HA 4KJOA 5C4XB 5EBDA 1LTGD 4X3TA 4ZYSA 1PTOD 1SXTA 2A6EC 2NUCA 5CGKA 1ZYRD 4FF4A 1PFBA 3QOLA 3GP7A 1I3QB 1TWCB 5ELCA 4QMGA 2NN6H 1WD0A 3H91A 1PZID 1EYDA 4TRDA 3QB3A 1BCPB 5IGDA 1SFOB 2F0KA 1D5ZC 3I4NB 1Z7TA 1G8ZD 4C3HG 5C4HA 4RAUC 4X3SA 1PTOF 4KI0A 2HDLA 2K5DA 5CR3A 1T5EA 2KCNA 4KKTA 5JEAJ 3M4OB 2HDMA 3A54A 3P20A 4KTAA 3D6CA 4PMWA 1HA6A 2B39A 1U4PA 1HHVA 3H94A 4KN7C 4G57A 1FNWA 2D5DA 4RKLA 3J80E 1LV9A 3D4WA 5FK9C 2B63B 1K83B 3JAME 2F0GA 3D3RA 4OHJA 2EJMA 3QIAA 1LTAD 1QWYA 1LABA 2K33A 3KLSX 2F0EA 2C9OA 4FYDA 2IJ0A 3TBIB 5LL6S 2K7VA 3LX0A 3ERQA 4M1UB 4X3UA 2A69D 5JOBA 5C4ZA 4MIUA 2XSCA 3OWFA 3NHHA 5FLXL 2F1MA 2V4DA 2VB2X 3FPPA 2EYOA 1IKMA 4OIJA 4J1MA 3FPUB 2HQEA 1BCPD 4UAIA 4RGTA 2DNEA 2F0QA 1M8AA 2AWNA 1H9SB 3HG9A 2NTTA 3MZ5A 1KTKA 3BYTB 4ZRZA 4A3JB 1GUTA 3ND9A 1I4RA 2R7ZB 4WORA 5HURA 3M85A 1X3PA 1KAAA 4TSSA 2I46A 1SBBB 4WRDA 1WTWA 1GUGA 3R2IA 2CVRA 2DY8A 3TZDA 5FOBB 1BCPF 2WKDA 2ICEC 2WIIB 1PFMA 3SR1A 3H09A 3OIPA 2A73B 4QB4A 5CYUA 1EOTA 4KKUA 3RZDB 1HTPA 2EOTA 1PTOH 3OMCA 5EGTA 4B08A 4FF1A 1JORA 1KNAA 1FD7D 1SYGA 2B2UC 4C3HB 1JWSD 1DM0B 4ZUJA 5A35A 1ESFA 1Z47A 3GTKB 4ME5A 5T1GA 3S1RB 2JA7B 2K04A 3QG1A 3HOXB 4CGYB 2ZXOA 1U9RA 2F3WA 1XXGA 3K5LA 2XNAC 2IX1A 2EJGC 2H4OA 2NVXB 1KLGD 1STEA 1GUSA 4OL7A 3T13A 1TWGB 3EROA 5EKKA 4K5XA 5EKIA 5TSSA 2HUGA 3C1EA 3MVVA 3WDNA 1JE4A 5D3IB 1SMYC 2A68C 2BDNA 2ENBA 3RZOB 3GTJB 3VR3A 2BA0A 1GUNA 2NVQB 5HGTA 3R3OA 1CHPD 3K58A 1SE4A 4DAVA 4FVMA 1EQTA 3CRLC 1SNMA 2QCPX 2R3ZA 3A7LA 1TWHB 5NUCA 2KOLA 2SOBA 2NWGA 2Z4IA 1JC7A 1SNQA 5CV9A 4CBVA 2KQ3A 1WTQA 1WTPA 1YNND 1PRTC 1O7LA 3TP5A 3V96A 1RODA 4IN3A 1JWMD 4PQXA 2SEBD 3NWSA 1STAA 4H13C 5ELEA 1NR4A 2JEBI 3DM1A 1J8IA 5I2YA 1BDOA 1EWCA 1STBA 1HPCA 4ZUIA 2KUMA 4ZQ3A 3NQTA 1WTVA 3BS1A 4S3SA 2B8GA 1LT5D 4GZYC 1L0YB 4F87A 3MXNA 1I4GA 2WV6D 1JOKA 2KEEA 3D8GA 2C5CA 2AUJD 3PV0A 1G91A 2NVTB 1EZ8A 2PZWA 3LNNA 5IGCA 4C3IG 5JAVA 2B2YA 1TWAB 1QCBD 4KV6A 2K32A 1HXYD 3M7GA 3IFTA 3NUCA 1JB3A 4I65A 3ONAB 1EWHA 2A5HA 4JBWA 5IODA 4QIWB 1F9SA 4FXKC 1XX8A 1EU4A 1A3UA 1Q1EA 2M9VA 3MHBA 4B9WA 1BXTA 4EQNA 5E1FA 5KIXA 2FFKB 1I4HA 2Y0SB 3I4LA 4RGOS 3KF8A 4IFDI 1OO9B 1Q12A 4OO1H 3A55A 4KHZA 1QJOA 3MEHA 3OWEB 3E5SA 2RDGA 1SJED 4EQOA 3PO2B 4C1NI 4CKCA 3J81E 2JA8B 2K5WA 1R4QB 3W2DA 4IALA 1B9MA 2XWJB 1EYAA 4LJZC 4IUUA 4B9XA 4XQQA 1SYCA 2EY6A 3GO5A 4N9PA 4XT1B 3DHQA 4DXGA 4FXGC 3NBIA 4K8JA 2IWHA 2D62A 1EQVA 3P1HA 4HCEA 2KCCA 5K36H 3DWPA 1B2TA 1V1OA 3CU7A 2B2WC 1XWEA 1BNZA 3D4DA 3I3CA 5DAUA 1SNDA 3I72A 2XWBB 4XQJA 3VA5A 3HOVB 2NVYB 2BE5C 2CQAA 2EZVA 5M3FB 3Q6SA 5JEAH 2A74C 1D1IA 4C3IB 2ZXPA 1TS3A 2EDGA 2BCOA 1U4RA 3HKZB 1RCVD 3DWQA 1UNSA 3WOEA 4RCNA 3VA7A 4A3DB 3OHXC 2VXWA 1J9OA 5DNFA 4XT3B 3HRZC 2NZ1D 2XRQD 2IL8A 5COYA 1FNUA 2R61A 1OXTA 1OXSC 3CRKC 4A3BB 2NTSA 1GHJA 2L5TA 3Q23A 5C3WA 3S1NB 3A8KE 2FHTA 4ID6A 2LKVA 1D6EC 2M2LA 5KGUA 1TIID 1Q1BA 1ILQA 2A6ED 3VR6A 3WOFA 3FMCA 3S14B 1W6JA 1JWUD 1CHQD 1KLUD 1OXVA 5FKAC 4HN7A 4LMQD 5CV8A 2FJ2A 4XXEA 2BOSA 1PYWD 2AWOA 5J1ZA 2IX3A 2Q8TA 3E6ZX 3NXWA 5IGFA 1JCKB 1TS5A 2F0MA 1HUNA 4ABNA 2EYFA 2F0LA 5C0XI 3A7AB 2EYMA 2ZXRA 5C6AA 1NAPA 3T51B 1GUOA 2NN6I 2JE6I 1AFPA 5I6WA 4KD4A 1RTNA 1DD2A 1F77A 1EY4A 3KLRA 1UUPA 2Z8LA 4DF7A 2F03A 2XIWA 2E74C 1EY8A 2L11A 2Z4HA 1Q3LA 3D6WA 3S15B 5EQ0A 2RBMA 4C3JG 3KBGA 1DJRD 3IL8A 4RWSC 3S9WA 4LAAA 4O42A 3T4AC 1H9KA 5A2QE 1VMCA 1O7ZA 2A6HC 3GV3A 1JICA 3TP8A 2FINB 3V2TA 1QE6A 4NMZA 5J22A 4RHSA 5K36G 3IAYA 4FNFA 1AN8A 5BN3A 2K28A 3BDLA 3GTQB 1TU2B 4KY7A 1SNOA 3GTLB 3DWAA 4DK0A 4XYQA 5JPMC 5CV6A 3CQZB 4O1NA 1CFMA 1CM9A 2ZT9C 5JEAG 1VCIA 4RH6A 4HAEA 3MFYA 2NYZD 3R8BA 3K57A 2B8FA 1D1KA 1EY0A 4K5VA 1ONLA 1AW7A 4U68A 1RJTA 5ELDA 4A3MB 1PRTB 5M5YB 3EFXD 2F0WA 1G6ZA 3I70A 3MFGA 2JEAI 4PMCA 4QUFA 2MPMA 3VR5A 2EYLA 4DA2A 3NE5B 2SDFA 4Z9CB 5EPJA 3I91A 2L0CA 1SSOA 2F0UA 3Q0AA 3SK5A 4ZAIA 4IURA 1LTSD 3J7AV 4DNTB 2A68D 5BN4A 4C3JB 1GOZA 5LHY1 4V0BA 3X3NA 1HUMA 3BVMA 2J7ZA 2E2HB 1V1PA 5IGEA 3HOYB 3QJYA 3TP7A 2PZUA 1B44D 5M3MB 4H44C 5ISRA 4NDXA 1F2MA 5ELBA 4CJ1B 2AUKA 2MJ8A 5CV4A 3MC0B 3BG3A 2EXZA 1HTLD 1B4OA 1PRTD 5D3DA 3NWTA 4LK1C 4HTHA 1GHKA 3G6JB 5FO8B 1BF4A 1RD9D 3S1QB 5KYLA 1DXMA 1O80A 3MXPA 2RDHA 1VF7A 1YNJC 1HQMC 5CBEE 5K5PA 1LTID 4K2KA 1STNA 5C0XJ 3Q22A 2G9DA 2B2TC 2WINB 1PRTF 2EVBA 2XN9C 1C48A 1QILA 2I07B 2KVMA 4ZKBB 4IUQA 1Y8OB 5CV5A 4CJ2C 2IT1A 2X6GA 1C4QA 3X3MA 1LTRD 3KK7A 1EY9A 5FO9B 5CV7A 4IUNA 1NCVA 3R2TA 3SK4A 1SYBA 3S1MB 2CW0C 4J8QA 1ZKOA 2F0NA 2RSOA 2WACA 4DU9A 5IGGA 2B2VC 3GTPB 2JA6B 4HSVA 3C46A 3VYUA 1UAPA 5ELFA 4NW2A 1WTXA 2YU9B 3C2PA 3J80L 1EEFD 1HFGA 5LL6X 1A3VA 2WB1B 3JAML 3MAQA 4HSPA 1WCMB 3R93A 1MSGA 1CQFA 1KDAA 1ZXTA 4V190 4IUVA 1ENFA 1MBYA 1CA6A 2HCIA 2K1BA 2TMPA 3DEPA 2F0OA 3K5MA 3I90A 1O78A 2E2DC 2J0TD 2KJXA 3G7LA 3KBXA 1BUVT 1IYUA 1Z6HA 2EY2A 2F0JA 1LTTD 1F9QA 1NUCA 5DM63 1BQQT 3MA2B 4OO1I 1G2TA 5FO7B 5EKLA 2JA5B 5KNCA 2WAQB 1L0XB 1XYIA 2JYOA 3FEWX 5D14A 4FXDA 1PXUA 2F0SA 3C3LA 3FDTA 3K59A 1A3TA 2B2UA 5E4XA 1GXDC 5EPLA 1XTCD 5M5XB 3S2HB 2K05A 4U673 5I9PA 5F2DA 1F2ZA 1TT2A 5IT9E 4BBSB 2BE5D 1G291 3VYSA 3SDZA 4A3FB 1I4XA 4DNRB 2MGSA 4K6LA 2F0PA 1PFNA 1DYQA 1BO0A 1LACA 3NTKA 2IX0A 4EQPA 1MGSA 4M8AA 2H1EA 1V1PB 1VMPA 5CMDA 2OT2A 3GTOB 3AU7A 2DY7A 3HS0C 4Q5VA 4RFBA 2J4XA 4XYOA 4ZKCB 1H9MA 3HEJA 3PUXA 2PYKA 5J39A 4FF3A 3OOCA 4Q0FA 2Q8RE 3EA6A 5KRUA 1WTRA 3BDCA 4KY5A 3VYRA 2GA4B 1HFNA 1IHZA 4KN4C 2B2VA 1EY5A 5M5WB 3S2DB 2L9HA 2KEDA 1JOOA 2PMZB 4R9WA 3S17B 2EY5A 3LWUA 4JK1C 2QKIC 3EQLC 4BY1B 4RGMA 2BA1A 3Q24A 1UEAB 1SE3A 4FF2A 3PUZA 2E75C 1QB5D 3PMFA 2MP1A 3RLFA 2RKSA 5FLXE 3K0YA 4TQUS 4PV1C 4HR7B 1SDFA 3NK9A 1V8QA 1S5DD 4R8NA 3VR2A 4YIJA 5C5MA 1PMRA 1LLRD 2KA7A 4DAPA 4HCSA 1ENAA 2F0VA 1DCZA 1ZEQX 3NQIA 4QCLA 2R93B 4K6DA 1CA5A 3DEOA 3TDQA 1TQOA 5M9OA 2DNCA 3MXGA 3NPPA 4KY6A 3VYTA 2A6HD 4MN3A 1B53A 1EIGA 2F0IA 4KJNA 3AB9A 3K6OA 4L63B 3J7YW 4RHRA 1HRJA 2VB3X 1B9NA 2R6GA 5C5LA 3A56A 4KMUC 1S5FD 2KHSA 4CKBA 5JPNC 2RVLA 4RGNA 1TY2A 1S5ED 1C8CA 1JR0D 4K8IA 2AQ2B 3URYA 5IT9L 5C44B 3SE0A 2N88A 4BWGB 3L9AX 2LY7A 3W3AA 2G9HD 1EYCA 5D65A 1EL0A 1IW7C 2N55A 3J81L 1DOMA 3D4RA 2RSNA 4KK7A 2F0FA 1Q90A 4IFDJ 5I9OA 4P2CB 2IPKD 1Y8PB 1FYCA 2Z1CA 3NTHA 1LT6D 5C0XH 1TVXA 4WJWA 4A3KB 3MXUA 2B2WA 2JXMB 1SJHD 4FP5D 2PCFB 2LS01 1F9PA 1FNVA 1O7YA 4IFDG 4BBRB 2PNRC 1TY0A 2K03A 1S5BD 1RDPD 3DXJC 5IGBA 3GQBA 2MUYA 2JSOA 2IW3A 2E2IB 4WFN3 1R4PB 2QDBA 1CZWA 2YYZA 4HMIA 4RCOA 1MSHA 4OGQC 4DN4M 2CHBD 2NB0A 4BY7B 3BVGA 3GD7A 1B50A 1KDBA 4H7BA 3HGBA 2M00A 3K7AB 3QO2A 4MHEA 1MD2D 3HOWB 1PTOC 2K5QA 1JOQA 4TKOB 1B3AA 1E2ZA 1ZYRC 3P75A 2X6LA 4RKBA 2QEJC 5T1IA 1E2WA 4XIGS 3ND8A 5KNBA 3BDOA 1I50B 5E4WC 5C3XA 2MHVA 2L1BA 3L7ZC 1PZKD 2EYPA 4IQZA 1YNJD 2EYHA 4A3IB 1K8OA 4C1NK 1CTMA 1KDCA 3HP3A 3MWYW 3P7JA 1JQYD 1ET6A 1EY7A 1SMYD 3NTIA 1BR9A 1TR5A 1T5XD 4DXFA 1D5XC 2B2YC 3I73A 1D2BA 2JP1A 1QG7A 3C1FA 2WKCA 1I4QA 1EFID 3TSSA 2SNSA 3GV6A 2NBFA 1EY6A 5AFWA 2PQEA 2OEOA 3PIP3 3FRPB 3RMHA 1BOSA 5EPKA 5C3EB 1E2VA 2CW0D 1B1ZA 2F3VA 2A69C 1MI2A 1GUWA 2EJFC 1Q8IA 2D2CC 4AYBB 2ICIA 4QUCA 3E0JA 1CI3M 1A15A 1AEXA 5KNDA 2QILA 3IFDA 4XTCS 1AZQA 4A3EB 1BCPC 1SAPA 5I2XA 1II3A 1EEID 2OXPA 2BDOA 4CHTB 5IOCA 2K6AA 1STHA 3RUZA 3NBHA 2Q8IB 4K5WA 1ILPA 4HMJA 5JVH3 1SYDA 2O2LD 4EGVA 5DM73 2R92B 2AQ3B 1WD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCN A;  2NBF A;  1AFP A;  2MHV A;  2NB0 A; 
#chains in the Genus database with same CATH topology
 5A2Q L;  1NSN S;  3H3V C;  2VNU D;  3D0F A;  5C0X G;  1OTC A;  1LO5 D;  3I2Z A;  4KKS A;  4IJL A;  1Y1V G;  4DK6 C;  2L4N A;  1QUQ A;  2XRS D;  5DEH A;  2NN6 G;  3ITP A;  4I7Z C;  1A6X A;  3TP6 A;  4E6I A;  3BVZ A;  1RTO A;  3CF5 A;  4DV0 L;  2LFN A;  5C44 H;  1TKW B;  4BA2 I;  1LTL A;  1PDQ A;  3J80 i;  1VQA A;  4NKL A;  2PZT A;  3JAM i;  5COR A;  2NZH A;  2E2J B;  2F0D A;  2N3S A;  3NP8 A;  3NSW A;  4ILW A;  1YVC A;  4I7A A;  4DV1 Q;  1EIH A;  1PLF A;  2PNH A;  5JVG 3;  1Y8N B;  5EBC A;  2O5I C;  1WOC A;  1XJV A;  3V05 A;  2VUM B;  4DFA A;  2EY1 A;  4AH6 A;  5IT9 c;  1PH6 A;  5KEE A;  1EZ6 A;  1EIF A;  1X56 A;  4K2L A;  1Y1W B;  4KHV A;  5IP9 H;  1E1T A;  4A93 B;  1HQR D;  1STG A;  4F7X A;  1JE5 A;  1TWC H;  4A3K H;  3KLS A;  3FKI B;  1ESR A;  2O4X A;  3H15 A;  1WYD A;  3M7N A;  4CJ0 B;  5IYC H;  5I4D A;  4KHP L;  1AZP A;  4G7O C;  4L8J A;  2F4I A;  5GAG C;  3I4N H;  1I6H B;  3G6E A;  3HKS A;  1GJX A;  4BBR H;  1IBK L;  1UE5 A;  2KHI A;  1WTO A;  4B3M Q;  2FMM A;  3S16 B;  3PUW A;  5G3L D;  4UDU C;  5IIF A;  5LMU Q;  1HZA A;  3AFQ A;  1KAB A;  4QY7 A;  3J7A F;  3CHB D;  3CW2 C;  1F2L A;  3IKJ A;  2ALY B;  4DR3 Q;  2E2I H;  4DV7 L;  1TS4 A;  2WP8 J;  3HZX A;  1DOL A;  4JG2 A;  1RIP A;  3A8I E;  3J7A 5;  1IKL A;  1QVC A;  1I94 Q;  4A3G B;  1MHW C;  3I8Z A;  3OSO A;  1QVG A;  1QNU A;  4RA8 A;  4PMB A;  1X3Q A;  4K0K Q;  5J3B A;  1M4V A;  3OTO Q;  2CCZ A;  4XQN A;  4BY7 H;  4CKE A;  3STB C;  4FO2 A;  3UI2 A;  2EYJ A;  1XPR A;  3M4Y A;  2KBN A;  1FGU A;  4BS9 A;  5EJW A;  5C4J B;  3K5O A;  2Z6B A;  4ZK9 B;  5G3L F;  3HOW H;  5LMU L;  1E0B A;  3I56 A;  1VQ4 A;  1VDZ A;  3D31 A;  3QWN A;  1CQV A;  3MTS A;  4IPG A;  2L12 A;  3OW7 A;  4PNY A;  4IUP A;  1VF5 C;  3PO3 G;  1LT4 D;  1QOH A;  1LYL A;  1YNN C;  3N6R A;  3SVM A;  4DK1 A;  1RKN A;  4IPD A;  1SNC A;  1I94 L;  1UE7 A;  5CC4 A;  4UP8 A;  2N78 A;  1L1O A;  1NR2 A;  3SEB A;  1U0L A;  2K75 A;  1ET9 A;  4K0K L;  3H0G B;  4ALP A;  4ZLT F;  2OF1 A;  1RF2 D;  4IZ8 A;  3HOZ G;  1LTB D;  1JB7 A;  1AP0 A;  1Y1V B;  3F2U A;  2F0T A;  4BA1 I;  1PZJ D;  2E5L Q;  4LW1 A;  3SXH A;  3HOU G;  3CKI B;  4XDX A;  2HHH Q;  3EVQ A;  1SNP A;  1SYF A;  1U4M A;  3U50 C;  2UXD L;  4DK3 C;  2YTX A;  3A8J E;  3H6M A;  4B3S L;  4MNO A;  4F8M A;  2EE1 A;  2UXC Q;  1KNE A;  1G2S A;  1HZB A;  3SK8 A;  1E1O A;  5E3F A;  4DGZ A;  1OXX K;  3RLN A;  2B2T A;  5I6Y A;  3CP0 A;  4YWM A;  1D7Q A;  1LM0 A;  2TSS A;  4POG A;  1S5C D;  1YHB A;  5BR8 L;  2UUC Q;  4R8I A;  1SYE A;  3CC4 A;  2PW7 A;  3M3Y B;  1GKH A;  1ASY A;  3AMU A;  3I4M G;  1D5M C;  2HHH L;  1X32 A;  2D0P A;  3PUV A;  4JI0 L;  5BN5 A;  5C3E H;  3CD6 A;  1FVI A;  1DON A;  1V43 A;  2L55 A;  4A75 A;  2F0H A;  2WB1 E;  1WVL A;  4GNX C;  3K5N A;  2HCC A;  1YEZ A;  4IFD H;  2DJG C;  5JJZ A;  1TWF B;  2ZTE A;  1CT1 D;  3T16 A;  1ICF B;  4YCW A;  1H9R A;  2A8V A;  1K8M A;  1KHI A;  2PPB C;  1QNK A;  1EQQ A;  2JA7 H;  4UHV A;  4GKJ Q;  4R4C A;  2UUC L;  4LFC Q;  3M4P A;  1P8L A;  1W6K A;  4H0L C;  4P74 A;  3NBH B;  1VQK A;  1PV4 A;  1SR3 A;  5IY0 A;  4G4K A;  1VQP A;  2CQO A;  2JK8 A;  4OIK A;  2VQF L;  3VR4 A;  3CC7 A;  1TS2 A;  1ICW A;  2E76 C;  2F4V L;  5C4X G;  1SRO A;  1I4P A;  4N9T A;  4AIM A;  1P16 A;  2R92 H;  2RDF A;  1EU3 A;  4G7H C;  1Y69 U;  4JI6 Q;  5IP9 G;  4C2M B;  2AQ1 B;  1IYJ B;  1TWG H;  1QUQ B;  4NP5 A;  4HED A;  1RHP A;  1H9S A;  1ML0 D;  4X3K A;  3O13 A;  1HA5 A;  4ODG A;  2X69 A;  1CK1 A;  3EJI A;  2LMC B;  1U4L A;  2K01 A;  3T53 B;  4R4O A;  3PO3 B;  1STY A;  2H5X A;  3RZO H;  4G7Z C;  2LXJ A;  1QZG A;  1SE2 A;  3DUZ A;  4Y7N B;  3PUY A;  3U9O A;  1R9T B;  3GTM B;  2K5V A;  2Q2I A;  4QIW E;  3W5O A;  2UU9 Q;  3I4N G;  1C0A A;  1H9J A;  4DV5 Q;  4ULL A;  1SEB D;  3QOJ A;  2E2J H;  1DOK A;  4QF4 A;  2HT1 A;  3U9S A;  1DZ1 A;  3HOZ B;  3DMU A;  3IRB A;  2Y0S E;  5FLM G;  3TRZ A;  3L3O C;  2ZM6 L;  3N52 A;  3HOU B;  2VQE L;  1TXY A;  1F9R A;  2ZTD A;  1Y1W H;  4A93 H;  1IW7 D;  4L6T B;  1PH2 A;  4DAY A;  4DR6 Q;  2MO1 A;  1LT3 D;  3RD4 A;  1PTO B;  1FGB D;  4DR2 Q;  4JV5 Q;  2EPB A;  2RQX A;  3FKI H;  1W2B A;  1UE6 A;  4F88 A;  3BZD B;  1CZG A;  2B63 G;  2ID0 A;  3FVQ A;  1VQO A;  3TN2 A;  1IL8 A;  3CCM A;  1I6H H;  1VQC A;  3BYY B;  3SHL A;  1F2Y A;  1A2T A;  3OPO A;  3ZYY X;  4K14 A;  2FMC A;  3S16 H;  4UY8 C;  2DN8 A;  2QDL A;  2I5M X;  3I4M B;  1IYV A;  5IP7 G;  1BBX C;  4JOI A;  3U4Z A;  1PH4 A;  1A2U A;  2RA4 A;  4A76 A;  2PO4 A;  2P5Z X;  4O0A A;  1XMQ L;  4EVO A;  5CBA E;  4A3G H;  3LWE A;  3ERS X;  4OEL B;  1I6V C;  2UUA Q;  1FR3 A;  2XVS A;  1S4Z A;  2SNM A;  3J81 i;  3SK6 A;  3T56 B;  1HNW Q;  3GTG B;  4KD3 A;  4IUT A;  3KUP A;  3PIO 3;  5C4J H;  2QF7 A;  1OXU A;  4R4Q A;  2D9U A;  3TME A;  4A3J G;  5KYI A;  4N8X 1;  2PW5 A;  1HCZ A;  5JJL A;  1N34 Q;  1ENC A;  2O5J C;  4C56 C;  3OMG A;  5IYD G;  1V1Q A;  3OIQ A;  2R7Z G;  4OO1 G;  3TZU A;  2KEC A;  1L1O B;  1S3O A;  4J6H A;  4KJO A;  3EBE A;  5C4X B;  5EBD A;  1LTG D;  4X3T A;  4ZYS A;  1PTO D;  2G5D A;  2KCM A;  1SXT A;  1ASZ A;  2A6E C;  3H0G H;  2NUC A;  5CGK A;  1ZYR D;  3KDF A;  4FF4 A;  3HKZ E;  1PFB A;  3QOL A;  3GP7 A;  1I3Q B;  4GNX A;  1N32 L;  1CSQ A;  1TWC B;  1UEB A;  1Y1V H;  4P75 A;  4DR1 Q;  4LF7 Q;  5ELC A;  4JI7 Q;  3M9B A;  4QMG A;  2NN6 H;  1WD0 A;  3H91 A;  1PZI D;  1FJG Q;  1EYD A;  4TRD A;  4CDC C;  3E3X A;  3QB3 A;  1VQG A;  1BCP B;  1N34 L;  5IGD A;  4GOP C;  2F0K A;  1D5Z C;  1SFO B;  3I4N B;  3F8T A;  1Z7T A;  3OW2 A;  2XGT A;  1G8Z D;  1SE8 A;  1YBY A;  4C3H G;  5C4H A;  3AYH B;  3LGJ A;  4RAU C;  3J81 j;  4X3S A;  1PTO F;  4KI0 A;  2IY5 B;  2HDL A;  2K5D A;  5CR3 A;  1T5E A;  1VQN A;  2JA7 G;  2KCN A;  1DGS A;  1IBL Q;  4KKT A;  5JEA J;  3UDX A;  3PO2 H;  5GRO A;  3M4O B;  3HOX G;  2HDM A;  3A54 A;  1Q86 C;  1X3G A;  3P20 A;  4KTA A;  4JI4 L;  1KQS A;  2DJF C;  3D6C A;  4PMW A;  1HA6 A;  2B39 A;  3M3Y H;  2LSS A;  1U4P A;  4GLX A;  3CME A;  1HHV A;  3H94 A;  4KN7 C;  4G57 A;  1GVP A;  1FJG L;  1FNW A;  1H95 A;  2D5D A;  2VL6 A;  3E9I A;  4RKL A;  3J80 E;  1LV9 A;  3D4W A;  2GVA A;  3MEF A;  5FK9 C;  1K83 B;  1WTH A;  3JAM E;  4IOC A;  2B63 B;  4A3L G;  2F0G A;  3D3R A;  4OHJ A;  2EJM A;  3QIA A;  1LTA D;  4R4I A;  1QWY A;  2AKW B;  3CCU A;  4DV4 Q;  1LAB A;  1TWF H;  2K33 A;  3KLS X;  1S40 A;  2F0E A;  3PQI A;  2C9O A;  4FYD A;  2IJ0 A;  3TBI B;  5LL6 S;  4JI1 Q;  4HJ8 A;  2K7V A;  3LX0 A;  3ERQ A;  4M1U B;  2CFM A;  5EAY A;  4X3U A;  2A69 D;  5JOB A;  5C4Z A;  1HR0 W;  4MIU A;  4R4T A;  4DV2 L;  2XSC A;  5GAH C;  3OWF A;  3NHH A;  5FLX L;  2F1M A;  2LXK A;  1V9P A;  3T1H Q;  2V4D A;  2VB2 X;  3FPP A;  2EYO A;  1NJI C;  1LUZ A;  1IKM A;  4OIJ A;  5H1S E;  4J1M A;  2UUB Q;  3FPU B;  3RLO A;  2HQE A;  1BCP D;  4UAI A;  4RGT A;  1KXL A;  2DNE A;  4B3R L;  2F0Q A;  4IPC A;  1M8A A;  2AWN A;  1H9S B;  3HG9 A;  3PGZ A;  4DV3 L;  2NTT A;  3MZ5 A;  1Y1W G;  4C2M H;  4JI8 Q;  1KTK A;  1HJP A;  3BYT B;  3TS0 A;  2B3G A;  4ZRZ A;  4LFA Q;  4A3J B;  4QQB X;  2KCT A;  4JI5 Q;  1GUT A;  3ND9 A;  1I4R A;  3PO3 H;  4X62 Q;  2R7Z B;  1WJJ A;  4WOR A;  5HUR A;  4Y7N H;  3M85 A;  1X3P A;  1R9T H;  1PVO A;  3UDF A;  1KAA A;  3T1H L;  1NY4 A;  4TSS A;  2I46 A;  1SBB B;  2DGY A;  4WRD A;  1WTW A;  1GUG A;  3R2I A;  2CVR A;  2DY8 A;  2UUB L;  3KJO A;  4NPS A;  1UWV A;  3TZD A;  5FOB B;  1BCP F;  1E24 A;  3T1Y L;  1HZ9 A;  2WKD A;  2ICE C;  2WII B;  4B3T Q;  3FHW A;  3HOZ H;  1PFM A;  3SR1 A;  3H09 A;  3OIP A;  1E3P A;  4DUZ L;  2A73 B;  4QB4 A;  4DAY B;  5CYU A;  1EOT A;  1VQI A;  4KKU A;  3RZD B;  3TEH B;  1HTP A;  2EOT A;  1PA6 A;  1PTO H;  3OMC A;  5EGT A;  4A3B H;  4B08 A;  4FF1 A;  1JOR A;  4X62 L;  4X66 L;  1KNA A;  1FD7 D;  1SYG A;  2B2U C;  2QW7 A;  4C3H B;  1JWS D;  2CH4 W;  1DM0 B;  2CWP A;  4ZUJ A;  5A35 A;  1ESF A;  3BU2 A;  4L5S A;  1Z47 A;  1IZ6 A;  3GTK B;  3UE1 A;  4ME5 A;  5T1G A;  3S1R B;  3S14 H;  2JA7 B;  5FJ8 G;  3F2B A;  2K04 A;  3QG1 A;  3BZC A;  4CGY B;  3HOX B;  2ZXO A;  1U9R A;  3DM3 A;  2F3W A;  1XXG A;  3K5L A;  2XNA C;  3I4M H;  2K14 A;  2IX1 A;  2EJG C;  2H4O A;  2NVX B;  1KLG D;  1STE A;  3H0G G;  1GUS A;  4OL7 A;  3T13 A;  1TWG B;  3ERO A;  5EKK A;  4K5X A;  5EKI A;  5TSS A;  2HUG A;  1NMG A;  1UE1 A;  3C1E A;  3MVV A;  3WDN A;  1JE4 A;  5D3I B;  3GTG H;  1SMY C;  2A68 C;  2BDN A;  2ENB A;  3RZO B;  3GTJ B;  3VR3 A;  2BA0 A;  1CKN B;  1GUN A;  2NVQ B;  5HGT A;  2Y0S G;  3R3O A;  3B6Y A;  4PZ8 A;  1CHP D;  3K58 A;  1SE4 A;  4DAV A;  1VQ8 A;  4FVM A;  1EQT A;  3STB D;  3CRL C;  1SNM A;  1YI2 A;  2QCP X;  2R3Z A;  3A7L A;  1TWH B;  2YV5 A;  1Q82 C;  5NUC A;  2KOL A;  1CUK A;  5C4X H;  3PO2 G;  3KJP A;  3KDF B;  2SOB A;  3AQQ A;  2F3I A;  2NWG A;  1WFQ A;  2Z4I A;  4GNX B;  1M1K C;  4LFB Q;  2MNA A;  2JA8 G;  1JC7 A;  1SNQ A;  5CV9 A;  4CBV A;  1K9M C;  2KQ3 A;  1I3Q H;  1WTQ A;  1WTP A;  1YNN D;  1PRT C;  1O7L A;  3TP5 A;  3V96 A;  2DUD A;  2ZJQ A;  2QA4 A;  1ROD A;  4IN3 A;  1JWM D;  4PQX A;  2SEB D;  1YJN A;  3NWS A;  1STA A;  4H13 C;  5ELE A;  1NR4 A;  1SFO H;  2YTV A;  1PH8 A;  4DV1 L;  2JEB I;  3DM1 A;  4JPB W;  1J8I A;  5I2Y A;  1BDO A;  1XNR Q;  1JT8 A;  1EWC A;  1EYG A;  1STB A;  4DKA C;  1MKH A;  1HPC A;  1VQB A;  4ZUI A;  3M4O H;  5FLM H;  1XNQ Q;  2KUM A;  4ZQ3 A;  3NQT A;  1WTV A;  3BS1 A;  4S3S A;  4HIO A;  2B8G A;  3BZK A;  1LT5 D;  3H3V H;  4O2D A;  1BBW A;  2AMC B;  4GZY C;  1L0Y B;  1BKB A;  4F87 A;  3MXN A;  1I4G A;  2WV6 D;  1JOK A;  2KEE A;  3D8G A;  4YHH Q;  2C5C A;  2AUJ D;  3PV0 A;  3CQZ H;  3HOV G;  1G91 A;  2B63 H;  1K83 H;  2NVT B;  1EZ8 A;  5M3F G;  2PZW A;  3LNN A;  4AYB E;  2GN5 A;  1MIU A;  5IGC A;  4B3M L;  4C3I G;  5JAV A;  1A62 A;  2B2Y A;  2Z0S A;  1TWA B;  1QCB D;  4BXX H;  4KV6 A;  1PH1 A;  3HKZ G;  3A74 A;  1KIX A;  4DR3 L;  3CPF A;  3Q8D A;  1XNQ L;  2VY3 A;  2K32 A;  5IP7 H;  1HXY D;  3M7G A;  3IFT A;  4HJA A;  3NUC A;  3I7F A;  1JB3 A;  4I65 A;  4GS3 A;  3J7Z C;  1YJ9 A;  4LF8 Q;  3ONA B;  4A3D G;  1EWH A;  2A5H A;  1KD1 C;  4YCV A;  3OTO L;  4JBW A;  4FDB A;  2I0Q A;  5IOD A;  4QIW B;  1F9S A;  4FXK C;  1XX8 A;  1EU4 A;  1A3U A;  1Q1E A;  1AE3 A;  2M9V A;  3MHB A;  4B9W A;  1BXT A;  4EQN A;  3K7U C;  4JBM A;  5E1F A;  5KIX A;  5FLX c;  2FFK B;  1MJE A;  1I4H A;  2Y0S B;  3I4L A;  4HIK A;  4RGO S;  4QJF A;  4A3J H;  3KF8 A;  2Q2T A;  4A3B G;  4IFD I;  2PI2 A;  4GN3 B;  1OO9 B;  3WWV A;  3ULL A;  1Q12 A;  4DV6 Q;  5IYD H;  2R7Z H;  4OO1 H;  3A55 A;  4KHZ A;  1QJO A;  4N8F A;  4ZCK A;  3MEH A;  4LF8 L;  1T9H A;  4DR5 Q;  4LUO A;  3OWE B;  3E5S A;  2RDG A;  1SJE D;  4EQO A;  3PIO A;  3PO2 B;  4MTK A;  4C1N I;  4CKC A;  3J81 E;  2JA8 B;  1PH9 A;  1VQM A;  2K5W A;  1R4Q B;  3W2D A;  4IAL A;  2E5L L;  1B9M A;  3PCO B;  2XWJ B;  1EYA A;  3ICE A;  1YIT A;  4LJZ C;  3RZD H;  4IUU A;  4B9X A;  2UXC L;  4XQQ A;  1SYC A;  2K5N A;  3HOY H;  1J5E Q;  4DV6 L;  2EY6 A;  3GO5 A;  4N9P A;  4XT1 B;  1VQL A;  5GQO A;  3DHQ A;  4C3H H;  4DXG A;  4FXG C;  3NBI A;  4K8J A;  2IWH A;  4NXN Q;  3GTK H;  2D62 A;  1EQV A;  3UDG A;  4Y52 H;  3P1H A;  4HCE A;  2KCC A;  3I55 A;  3S1R H;  3TS2 A;  3DWP A;  5K36 H;  3NEL A;  3HOX H;  1B2T A;  4P71 A;  1V1O A;  3CU7 A;  2B2W C;  2JQO A;  1XWE A;  1GM5 A;  1BNZ A;  3D4D A;  4R1J A;  3I3C A;  5DAU A;  1SND A;  3I72 A;  2XWB B;  1KRS A;  3PF4 A;  4XQJ A;  2NVX H;  3VA5 A;  2A19 A;  3HOV B;  2NVY B;  4A3L H;  2BE5 C;  2CQA A;  1B7Y B;  1E7Z A;  2EZV A;  3A0J A;  5M3F B;  3Q6S A;  5JEA H;  2A74 C;  3FP9 A;  1D1I A;  4C3I B;  2ZXP A;  4OEM B;  1TS3 A;  2EDG A;  1N36 Q;  4NXN L;  4OX9 Q;  2BCO A;  4GKJ L;  1U4R A;  2WAQ E;  3HKZ B;  1RCV D;  4JI3 Q;  1A0I A;  4LFC L;  3GTJ H;  3DWQ A;  2NVQ H;  1UNS A;  3WOE A;  4RCN A;  1VQF A;  3VA7 A;  4A3D B;  3OHX C;  4GLA C;  3CXC A;  2VXW A;  1J9O A;  5DNF A;  4XT3 B;  1TWH H;  5ELO A;  4JI6 L;  3HRZ C;  2D0O A;  2NZ1 D;  2XRQ D;  1SLJ A;  2IL8 A;  2WFW A;  3K80 C;  4NB3 A;  5COY A;  1FNU A;  2R61 A;  1OXT A;  1XMO Q;  1OXS C;  3CRK C;  4A3B B;  2NTS A;  4JI3 L;  1GHJ A;  2L5T A;  3Q23 A;  2Q2U A;  5C3W A;  3S1N B;  5IWA Q;  3A8K E;  2FHT A;  4ID6 A;  4X64 Q;  2LKV A;  1D6E C;  2M2L A;  3RNU A;  1HR0 Q;  2UU9 L;  5KGU A;  1K3B C;  1KL9 A;  1HNZ Q;  1TII D;  1Q1B A;  1ILQ A;  2ZTC A;  4DV5 L;  4YWL A;  2A6E D;  3VR6 A;  3WOF A;  3FMC A;  3S14 B;  1W6J A;  2ZJP A;  1JWU D;  1CHQ D;  1KLU D;  1OXV A;  5FKA C;  1M90 C;  4HN7 A;  4BXX G;  4LMQ D;  5CV8 A;  2FJ2 A;  4XXE A;  2BOS A;  1WCM H;  5LMN Q;  2N8N A;  1PYW D;  4LUV A;  3E0E A;  2AWO A;  5J1Z A;  2IX3 A;  2Q8T A;  4IO9 A;  4DR6 L;  1XMO L;  3E6Z X;  1NE3 A;  3J80 c;  2F52 A;  3NXW A;  4DR2 L;  4JV5 L;  5IGF A;  3MXN B;  3JAM c;  1JCK B;  1TS5 A;  3A5Z B;  2F0M A;  1HUN A;  4LUZ A;  4ABN A;  4X64 L;  2EYF A;  2F0L A;  1HNZ L;  4QL5 A;  5C0X I;  3A7A B;  3VDY A;  4LF6 Q;  2NVT H;  2EYM A;  2OCE A;  2ZXR A;  5C6A A;  1NAP A;  3K8A A;  1GUO A;  3T51 B;  1XPO A;  2NN6 I;  2JE6 I;  2NZO A;  1AFP A;  5FJ8 H;  5I6W A;  4KD4 A;  1RTN A;  3PSI A;  1DD2 A;  1TWA H;  5LMN L;  4GLV B;  1F77 A;  1CKN A;  1EY4 A;  3KLR A;  3W1G A;  1UUP A;  2Z8L A;  4DF7 A;  4HJ5 A;  2F03 A;  2XIW A;  2E74 C;  4JVZ A;  1EY8 A;  2L11 A;  2JA5 H;  3KF6 A;  2Z4H A;  1Q3L A;  3D6W A;  2UUA L;  3S15 B;  2PMZ E;  5EQ0 A;  1Q46 A;  2YTY A;  1HNW L;  2RBM A;  4C3J G;  1K28 A;  1IBM Q;  3KBG A;  1DJR D;  3IL8 A;  4RWS C;  3CCQ A;  4OON A;  3S9W A;  4P72 A;  4LAA A;  3W1B A;  4O42 A;  3T4A C;  1H9K A;  3KF8 B;  5A2Q E;  1VMC A;  1O7Z A;  2A6H C;  3HOY G;  3ULJ A;  3CMA A;  3GV3 A;  1JIC A;  3TP8 A;  5AJ3 Q;  5M3M G;  4HIM A;  1B8A A;  1EOV A;  2FIN B;  3V2T A;  1QE6 A;  4NMZ A;  5J22 A;  4RHS A;  5K36 G;  4AQY Q;  3IAY A;  4FNF A;  4DR7 Q;  1K8A C;  1AN8 A;  5BN3 A;  2K50 A;  2K28 A;  4J15 A;  3BDL A;  1PYB A;  3GTQ B;  2JA8 H;  4DR1 L;  4LF7 L;  1TU2 B;  4KY7 A;  4JI7 L;  1SNO A;  3GTL B;  4LF4 Q;  3KFU A;  3DWA A;  4DK0 A;  5ELN A;  3K81 C;  4XYQ A;  5JPM C;  5CV6 A;  3CQZ B;  4O1N A;  1CFM A;  3GDE A;  1CM9 A;  2ZT9 C;  2K5H A;  5JEA G;  1VCI A;  4LF5 Q;  3GTO H;  4RH6 A;  3EIV A;  1VQ9 A;  4L5Q A;  4HAE A;  3MFY A;  2NYZ D;  2EIF A;  4AQY L;  3R8B A;  1IBL L;  3K57 A;  2B8F A;  4X65 Q;  1D1K A;  1EY0 A;  4JCV E;  1JMC A;  4K5V A;  1HH2 P;  2E8G A;  1ONL A;  4UP7 A;  1AW7 A;  4U68 A;  1RJT A;  5ELD A;  4LF9 Q;  4A3M B;  1PRT B;  5M5Y B;  1XPU A;  3EFX D;  2EXD A;  2F0W A;  1G6Z A;  3AFP A;  3I70 A;  1O7I A;  3PF5 A;  3MFG A;  2NVY H;  2JEA I;  3HOV H;  4PMC A;  5JJI A;  4QUF A;  5M3F H;  4DV4 L;  2MPM A;  1CKM A;  4YWK A;  3VR5 A;  1B3Q A;  4C3I H;  3S2D H;  2EYL A;  1Q8K A;  4RG1 A;  1YHQ A;  4JI1 L;  4DA2 A;  3NE5 B;  1JJC B;  2SDF A;  4Z9C B;  2JA6 G;  5EPJ A;  3I91 A;  2L0C A;  3M4Q A;  1SSO A;  2F0U A;  3Q0A A;  3SK5 A;  1X55 A;  2WB1 G;  4ZAI A;  4IUR A;  4OWT B;  4A3D H;  3CAM A;  4LWC A;  1LTS D;  3J7A V;  4DNT B;  2A68 D;  5BN4 A;  4C3J B;  1WCM G;  5HGQ A;  2ATW A;  1VQE A;  1GOZ A;  4H02 A;  5LHY 1;  4V0B A;  3X3N A;  1JJG A;  1HUM A;  4JI8 L;  2XTI A;  4CDD C;  3BVM A;  2J7Z A;  4LFA L;  2HIX A;  4JI5 L;  2E2H B;  1V1P A;  5IGE A;  3HOY B;  5GAE C;  3QJY A;  3TP7 A;  4JW0 A;  2PZU A;  1B44 D;  3S1N H;  2L15 A;  5M3M B;  4H44 C;  1BBU A;  5ISR A;  1X6O A;  4NDX A;  1F2M A;  5ELB A;  2AUK A;  2MJ8 A;  5CV4 A;  4CJ1 B;  3MC0 B;  3BG3 A;  3I4O A;  2EXZ A;  1HTL D;  3U58 A;  1B4O A;  1AH9 A;  3RN5 A;  1PRT D;  5D3D A;  4B3T L;  3NWT A;  1NTG A;  1B70 B;  4LK1 C;  4HTH A;  1GHK A;  3KLW A;  3G6J B;  5FO8 B;  1YJW A;  1BF4 A;  2HIV A;  1RD9 D;  3S1Q B;  5KYL A;  1DXM A;  1O80 A;  2JA5 G;  3MXP A;  2RDH A;  2UXB Q;  2WAQ G;  1A63 A;  1VF7 A;  1YNJ C;  1IXR A;  1HQM C;  5CBE E;  5K5P A;  1LTI D;  4K2K A;  1STN A;  5C0X J;  3Q22 A;  1SRU A;  4OXP A;  2G9D A;  4GOP A;  4JBK A;  2B2T C;  2WIN B;  1PRT F;  2EVB A;  1PH5 A;  2XN9 C;  1C48 A;  4POF A;  1QIL A;  2I07 B;  2KVM A;  4ZKB B;  4IUQ A;  1Y8O B;  1N8R C;  5CV5 A;  4CJ2 C;  2IT1 A;  2X6G A;  1C4Q A;  1PYS B;  4X6A H;  4BBS G;  3X3M A;  2VZA A;  1VQ5 A;  2UXB L;  1LTR D;  3KK7 A;  3KF6 B;  1EY9 A;  4A3F G;  5FO9 B;  1CKO A;  5CV7 A;  4IUN A;  1NCV A;  3R2T A;  3SK4 A;  1YNX A;  1SYB A;  1VQ7 A;  3S15 H;  3S1M B;  1D8L A;  3S24 A;  4KHP Q;  2CW0 C;  4J8Q A;  1ZKO A;  2F0N A;  3H3V I;  2RSO A;  4CDF C;  1IBK Q;  2WAC A;  4DU9 A;  5IGG A;  2B2V C;  3GTP B;  2JA6 B;  2OWO A;  4HSV A;  3C46 A;  3VYU A;  1UAP A;  5ELF A;  3ULP A;  4NW2 A;  1WTX A;  2YU9 B;  3C2P A;  3J80 L;  1EEF D;  1Z9F A;  1HFG A;  5LL6 X;  1A3V A;  4DV7 Q;  2WB1 B;  3JAM L;  4IJH A;  3J81 c;  3MAQ A;  3UDI A;  4HSP A;  1WCM B;  3R93 A;  1MSG A;  3JC6 6;  1Q81 C;  1CQF A;  4LFB L;  1KDA A;  1ZXT A;  1K0S A;  4V19 0;  4IUV A;  1ENF A;  1MBY A;  1CA6 A;  2K4K A;  3CCR A;  2HCI A;  3GTQ H;  4JYA Q;  2K1B A;  4MZ9 A;  3GTL H;  2TMP A;  3DEP A;  2F0O A;  3K5M A;  2ZJR A;  3I90 A;  1O78 A;  2E2D C;  3KOJ A;  2J0T D;  4IOA A;  1EFW A;  2KJX A;  3G7L A;  3KBX A;  1BUV T;  3RR5 A;  1IYU A;  1Z6H A;  1XNR L;  2EY2 A;  2F0J A;  1LTT D;  1X65 A;  4HJ9 A;  4GN4 B;  1F9Q A;  1NUC A;  1X54 A;  2HQL A;  5DM6 3;  1BQQ T;  5GAD C;  3MA2 B;  4OO1 I;  1G2T A;  5FO7 B;  4BY1 G;  2R7D A;  4YY3 Q;  4ME3 A;  5EKL A;  3G4S A;  4NXM Q;  4A3C G;  4JYA L;  2JA5 B;  3K7A H;  5KNC A;  4DPG A;  4APV A;  1PFS A;  2WAQ B;  1L0X B;  4GN5 A;  2ASB A;  4L5T A;  4PZ6 A;  1XYI A;  2JYO A;  3FEW X;  4A3M H;  1N9W A;  4YHH L;  5D14 A;  5M5Y H;  1X3F A;  4FXD A;  2UXD Q;  1PXU A;  5HY6 A;  1C7Y A;  4B3S Q;  4JI2 Q;  2F0S A;  5L37 A;  3C3L A;  3FDT A;  3K59 A;  1A3T A;  2B2U A;  3L2P A;  2OQ0 A;  5E4X A;  1I50 H;  3QR8 A;  1GXD C;  5EPL A;  1XTC D;  5M5X B;  3S2H B;  1NMF A;  2K05 A;  5E7N A;  4U67 3;  5I9P A;  3CCJ A;  1F2Z A;  5F2D A;  4JOI C;  1TT2 A;  4YY3 L;  5IT9 E;  4NXM L;  5BR8 Q;  4BBS B;  2BE5 D;  3CCV A;  2RHS B;  1G29 1;  3VYS A;  1SN8 A;  4A3I H;  3SDZ A;  4A3F B;  1I4X A;  4DNR B;  2MGS A;  4JI0 Q;  4K6L A;  2F0P A;  1PFN A;  1DYQ A;  2R93 G;  1AE2 A;  1BO0 A;  4JI2 L;  1LAC A;  4C3J H;  3NTK A;  2VW9 A;  4CDE C;  2IX0 A;  4EQP A;  1MGS A;  4M8A A;  1QZH A;  2H1E A;  1V1P B;  1VMP A;  5CMD A;  2E2H H;  2HD3 A;  2OT2 A;  5IE8 A;  1G6P A;  1WI5 A;  2I5H A;  1KC8 C;  3GTO B;  3AU7 A;  2DY7 A;  3HS0 C;  4Q5V A;  2GVB A;  4RFB A;  4UPA A;  5M3M H;  1YIJ A;  3SGI A;  3NEM A;  1J6Q A;  2J4X A;  4DR5 L;  4XYO A;  1W3S A;  2IHF A;  3RN2 A;  4ZKC B;  1H9M A;  1GD7 A;  3HEJ A;  3PUX A;  4L5R C;  2VQF Q;  2PYK A;  1K0R A;  5J39 A;  4FF3 A;  3OOC A;  4Q0F A;  2Q8R E;  2F4V Q;  3EA6 A;  5KRU A;  1WTR A;  2A1A A;  3BDC A;  4KY5 A;  2MQH A;  4RMF A;  3VYR A;  3S1Q H;  2GA4 B;  1HFN A;  1IHZ A;  2CWA A;  1C9O A;  1N33 Q;  5C44 G;  1J5E L;  4A3E H;  4KN4 C;  2B2V A;  4GOP B;  1EY5 A;  1QVF A;  1PH7 A;  5M5W B;  3S2D B;  2JJQ A;  5JJK A;  2L9H A;  2KED A;  1JOO A;  2PMZ B;  4R9W A;  3S17 B;  2EY5 A;  3LWU A;  4JK1 C;  2QKI C;  3EQL C;  2JA9 A;  4BY1 B;  1XTD A;  4RGM A;  5IYB H;  2BA1 A;  4OWW B;  3Q24 A;  1UEA B;  1X9N A;  2Q2H A;  2OTL A;  2ZM6 Q;  2RCN A;  2PQA A;  1SE3 A;  1NBW A;  3PUZ A;  4FF2 A;  1VQD A;  2VQE Q;  2E75 C;  4A3K G;  1QB5 D;  2FXQ A;  1EWI A;  3PMF A;  2MP1 A;  3RLF A;  1N33 L;  2RKS A;  5IYC G;  4LNQ A;  5FLX E;  3K0Y A;  4TQU S;  4PV1 C;  4HR7 B;  1SDF A;  3S1M H;  1VS0 A;  3NK9 A;  1V8Q A;  1S5D D;  1N36 L;  1VQJ A;  4BBR G;  4OX9 L;  4R8N A;  3VR2 A;  4DUY Q;  2QGQ A;  4YIJ A;  5C5M A;  1PMR A;  2AHO B;  1LLR D;  2KA7 A;  3GTP H;  2VUM H;  4DAP A;  2JA6 H;  4HCS A;  1ENA A;  2F0V A;  1DCZ A;  1PHJ A;  1ZEQ X;  2YU9 H;  3NQI A;  1VQ6 A;  4A4I A;  4PG3 A;  1L0W A;  3CCE A;  4QCL A;  2R93 B;  1EUJ A;  3F2C A;  1XMQ Q;  4K6D A;  1CA5 A;  3DEO A;  1KRT A;  3TDQ A;  1TQO A;  2QEX A;  4BY7 G;  5M9O A;  2DNC A;  3MXG A;  3NPP A;  4KY6 A;  1U5K A;  3VYT A;  3DLL A;  2A6H D;  4MN3 A;  3KYH C;  1B53 A;  1K8G A;  1A8V A;  1HNX Q;  3HFZ B;  1EIG A;  2F0I A;  4DUY L;  4KJN A;  3HOW G;  3AB9 A;  3K6O A;  4A3M G;  4L63 B;  5IWA L;  3J7Y W;  1HR0 L;  4RHR A;  1HRJ A;  2VB3 X;  1B9N A;  2R7F A;  2R6G A;  5C5L A;  3A56 A;  4HID A;  1I5F A;  4KMU C;  1S5F D;  2KHS A;  4CKB A;  2I5L X;  2ES2 A;  3UE0 A;  5JPN C;  1NNX A;  1SMX A;  2RVL A;  4RGN A;  4DR4 Q;  1TY2 A;  3U4V A;  1K3R A;  2B29 A;  3AEV A;  1S5E D;  3ZJY C;  1C8C A;  1HNX L;  3G48 A;  4A3I G;  3PIP A;  1JR0 D;  1N32 Q;  4K8I A;  4IPH A;  2AQ2 B;  3URY A;  5IT9 L;  3CPW A;  5C44 B;  2BH8 A;  3SE0 A;  2N88 A;  4BWG B;  1JJ2 A;  3L9A X;  2EQS A;  2K52 A;  4OWX B;  2LY7 A;  2Z6K C;  3ER0 A;  3W3A A;  2G9H D;  1EYC A;  4LF6 L;  5D65 A;  1EL0 A;  3BJU A;  1IW7 C;  2N55 A;  3J81 L;  1DOM A;  3D4R A;  2RSN A;  4KK7 A;  2F0F A;  1HZC A;  4MTN A;  1YZ6 A;  4DR4 L;  1CSP A;  1Q90 A;  2KHJ A;  4IFD J;  5I9O A;  4P2C B;  5M5X H;  2IPK D;  3S2H H;  1Y8P B;  1FYC A;  2Z1C A;  4JBJ A;  3NTH A;  4JI4 Q;  1LT6 D;  5C0X H;  1TVX A;  4WJW A;  4BBS H;  4A3K B;  3A5U A;  3MXU A;  2B2W A;  2BH2 A;  2JXM B;  4FP5 D;  1SJH D;  1X3E A;  5C3E G;  4A3F H;  2PCF B;  2RCF A;  2LS0 1;  1F9P A;  1FNV A;  1O7Y A;  1IBM L;  4IFD G;  3TQY A;  4AYB G;  4WJ4 A;  4BBR B;  2PNR C;  1L2F A;  2MO0 A;  1TY0 A;  2CH4 A;  2K03 A;  1S5B D;  1RDP D;  2MFI A;  3DXJ C;  5IGB A;  3GQB A;  1BVS A;  4A3E G;  2MUY A;  2JSO A;  2IW3 A;  2E2I B;  4WFN 3;  1G51 A;  5AJ3 L;  1R4P B;  4DAM A;  2QDB A;  1CZW A;  2YYZ A;  4DV2 Q;  4HMI A;  4RCO A;  2Z9H A;  1S72 A;  1MSH A;  4EQ5 A;  4OGQ C;  4DN4 M;  4DR7 L;  2CHB D;  1FL0 A;  2NB0 A;  4P73 A;  4BY7 B;  3BVG A;  3GD7 A;  5IYB G;  1KDB A;  1Q7Y C;  4H7B A;  2R92 G;  1B50 A;  3HGB A;  2M00 A;  3K7A B;  3QO2 A;  4MHE A;  4B3R Q;  4JC0 A;  3CCS A;  4LF4 L;  4DV3 Q;  1GO3 E;  1PH3 A;  1MD2 D;  3HOW B;  1PTO C;  2K5Q A;  1JOQ A;  4QGU A;  4TKO B;  1EQR A;  1B3A A;  1E2Z A;  1ZYR C;  3P75 A;  3K0X A;  2X6L A;  4RKB A;  2QEJ C;  5T1I A;  1E2W A;  3NEN A;  2C35 B;  1E22 A;  4XIG S;  4LF5 L;  3ND8 A;  5KNB A;  3BDO A;  1I50 B;  1Y14 B;  5E4W C;  5M5W H;  2IHE A;  5C3X A;  4X65 L;  3S17 H;  2MHV A;  2CKZ B;  2L1B A;  3L7Z C;  1PZK D;  2EYP A;  2RHQ B;  4IQZ A;  2VUM G;  1YNJ D;  2EYH A;  3T1Y Q;  5LMN W;  1RL2 A;  1K73 C;  4BY1 H;  4A3I B;  4A3C H;  1K8O A;  2PQA B;  4C1N K;  1CTM A;  1KDC A;  3HP3 A;  3MWY W;  4LF9 L;  4A93 G;  3P7J A;  2KEN A;  4DUZ Q;  1JQY D;  1IL2 A;  1ET6 A;  1EY7 A;  1SMY D;  3NTI A;  3FKI G;  2VS1 A;  1BR9 A;  4GKK Q;  1TR5 A;  4X66 Q;  1T5X D;  4DNI A;  4DXF A;  3G71 A;  1D5X C;  2B2Y C;  3I73 A;  5DLQ E;  3GTM H;  1D2B A;  2JP1 A;  1QG7 A;  3C1F A;  2WKC A;  1I4Q A;  1EFI D;  3TSS A;  2SNS A;  3CCL A;  3GV6 A;  2NBF A;  3CC2 A;  1EY6 A;  3L0O A;  2N49 A;  5AFW A;  2PQE A;  4WJ3 M;  4EX5 A;  2OEO A;  2PI2 E;  1L1O C;  3FRP B;  3RMH A;  3EN2 A;  1BOS A;  3PIP 3;  5EPK A;  5C3E B;  1E2V A;  4YCU A;  2CW0 D;  4UP9 A;  2JN4 A;  3HOU H;  1KAW A;  4HJ7 A;  4KLK A;  1B1Z A;  4A3G G;  2F3V A;  2A69 C;  1MI2 A;  2R93 H;  1GUW A;  2EJF C;  4GKK L;  3F2D A;  1Q8I A;  2D2C C;  4AYB B;  1VQH A;  2ICI A;  3OYY A;  2Z6K A;  4QUC A;  3E0J A;  1EIY B;  1CI3 M;  3TRE A;  4TVA B;  1A15 A;  1AEX A;  1MJC A;  5KND A;  2QIL A;  3IFD A;  4XTC S;  1AZQ A;  2OQK A;  1BCP C;  1SAP A;  4A3E B;  5I2X A;  4DV0 Q;  1II3 A;  1EEI D;  2OXP A;  3F1Z A;  1YHA A;  2BDO A;  4CHT B;  5IOC A;  2K6A A;  2V1C C;  1STH A;  3E9H A;  3RUZ A;  3NBH A;  2Q8I B;  4K5W A;  1ILP A;  4HMJ A;  4PZ7 A;  2RF4 A;  5JVH 3;  1SYD A;  2O2L D;  4EGV A;  5DM7 3;  2R92 B;  2AQ3 B;  1WD1 A;  2OTJ A; 
#chains in the Genus database with same CATH homology
 5A2Q L;  1NSN S;  3H3V C;  2VNU D;  5C0X G;  1LO5 D;  4KKS A;  2L4N A;  2XRS D;  5DEH A;  2NN6 G;  3ITP A;  4I7Z C;  1A6X A;  3TP6 A;  4E6I A;  3BVZ A;  1RTO A;  2LFN A;  1TKW B;  4BA2 I;  1PDQ A;  4NKL A;  2PZT A;  5COR A;  2E2J B;  2F0D A;  3NSW A;  3NP8 A;  4ILW A;  1EIH A;  1PLF A;  5JVG 3;  2O5I C;  1Y8N B;  5EBC A;  3V05 A;  2VUM B;  4DFA A;  2EY1 A;  5KEE A;  1EZ6 A;  4K2L A;  1Y1W B;  4KHV A;  4A93 B;  1HQR D;  1STG A;  4F7X A;  3KLS A;  3FKI B;  1ESR A;  2O4X A;  3M7N A;  4CJ0 B;  5I4D A;  1AZP A;  4G7O C;  4L8J A;  2F4I A;  1I6H B;  1GJX A;  1WTO A;  3S16 B;  2FMM A;  3PUW A;  5G3L D;  4UDU C;  5IIF A;  1KAB A;  3J7A F;  3CHB D;  1F2L A;  3IKJ A;  1TS4 A;  2WP8 J;  3HZX A;  1DOL A;  3A8I E;  1IKL A;  4A3G B;  3I8Z A;  3OSO A;  1QNU A;  4RA8 A;  4PMB A;  1X3Q A;  1M4V A;  4XQN A;  4CKE A;  3UI2 A;  4FO2 A;  2EYJ A;  3M4Y A;  4BS9 A;  5EJW A;  5C4J B;  3K5O A;  4ZK9 B;  5G3L F;  1E0B A;  1VDZ A;  3D31 A;  3QWN A;  1CQV A;  3MTS A;  2L12 A;  3OW7 A;  4PNY A;  4IUP A;  1VF5 C;  1LT4 D;  1QOH A;  1YNN C;  3N6R A;  3SVM A;  4DK1 A;  1RKN A;  1SNC A;  5CC4 A;  1NR2 A;  3SEB A;  1ET9 A;  3H0G B;  4ZLT F;  2OF1 A;  1RF2 D;  4IZ8 A;  1LTB D;  1AP0 A;  1Y1V B;  3F2U A;  2F0T A;  4BA1 I;  1PZJ D;  3SXH A;  3CKI B;  4XDX A;  3EVQ A;  1SNP A;  1SYF A;  1U4M A;  3A8J E;  3H6M A;  4F8M A;  2EE1 A;  1KNE A;  1G2S A;  3SK8 A;  5E3F A;  4DGZ A;  1OXX K;  2B2T A;  5I6Y A;  2TSS A;  1S5C D;  4R8I A;  1SYE A;  2PW7 A;  3M3Y B;  3AMU A;  1D5M C;  1X32 A;  3PUV A;  5BN5 A;  1DON A;  1V43 A;  2L55 A;  2F0H A;  1WVL A;  3K5N A;  2HCC A;  4IFD H;  5JJZ A;  1TWF B;  1CT1 D;  3T16 A;  1H9R A;  1K8M A;  2PPB C;  1QNK A;  1W6K A;  4H0L C;  4G4K A;  4OIK A;  3VR4 A;  1TS2 A;  1ICW A;  2E76 C;  1I4P A;  4N9T A;  2RDF A;  1EU3 A;  4G7H C;  1Y69 U;  4C2M B;  2AQ1 B;  4NP5 A;  4HED A;  1RHP A;  1H9S A;  1ML0 D;  4X3K A;  3O13 A;  1HA5 A;  4ODG A;  2X69 A;  1CK1 A;  3EJI A;  2LMC B;  1U4L A;  2K01 A;  3T53 B;  3PO3 B;  1STY A;  4G7Z C;  1SE2 A;  3DUZ A;  4Y7N B;  3PUY A;  3U9O A;  1R9T B;  3GTM B;  1H9J A;  4ULL A;  1SEB D;  3QOJ A;  1DOK A;  4QF4 A;  3U9S A;  1DZ1 A;  3HOZ B;  3DMU A;  3L3O C;  3N52 A;  3HOU B;  1F9R A;  1IW7 D;  4L6T B;  4DAY A;  1LT3 D;  3RD4 A;  1PTO B;  1FGB D;  2EPB A;  2RQX A;  4F88 A;  3BZD B;  1CZG A;  2ID0 A;  3FVQ A;  3TN2 A;  1IL8 A;  3BYY B;  3SHL A;  1F2Y A;  1A2T A;  3OPO A;  3ZYY X;  4K14 A;  2FMC A;  2DN8 A;  3I4M B;  1IYV A;  1BBX C;  1A2U A;  2RA4 A;  2PO4 A;  4EVO A;  5CBA E;  3LWE A;  1I6V C;  1FR3 A;  2XVS A;  1S4Z A;  2SNM A;  3SK6 A;  3T56 B;  3GTG B;  4KD3 A;  4IUT A;  3KUP A;  3PIO 3;  2QF7 A;  1OXU A;  2D9U A;  3TME A;  5KYI A;  2PW5 A;  1HCZ A;  1ENC A;  2O5J C;  4C56 C;  3OMG A;  3OIQ A;  4OO1 G;  3TZU A;  2KEC A;  4J6H A;  4KJO A;  5C4X B;  5EBD A;  1LTG D;  4X3T A;  4ZYS A;  1PTO D;  1SXT A;  2A6E C;  2NUC A;  5CGK A;  1ZYR D;  4FF4 A;  1PFB A;  3QOL A;  3GP7 A;  1I3Q B;  1TWC B;  5ELC A;  4QMG A;  2NN6 H;  1WD0 A;  3H91 A;  1PZI D;  1EYD A;  4TRD A;  3QB3 A;  1BCP B;  5IGD A;  1SFO B;  2F0K A;  1D5Z C;  3I4N B;  1Z7T A;  1G8Z D;  4C3H G;  5C4H A;  4RAU C;  4X3S A;  1PTO F;  4KI0 A;  2HDL A;  2K5D A;  5CR3 A;  1T5E A;  2KCN A;  4KKT A;  5JEA J;  3M4O B;  2HDM A;  3A54 A;  3P20 A;  4KTA A;  3D6C A;  4PMW A;  1HA6 A;  2B39 A;  1U4P A;  1HHV A;  3H94 A;  4KN7 C;  4G57 A;  1FNW A;  2D5D A;  4RKL A;  3J80 E;  1LV9 A;  3D4W A;  5FK9 C;  2B63 B;  1K83 B;  3JAM E;  2F0G A;  3D3R A;  4OHJ A;  2EJM A;  3QIA A;  1LTA D;  1QWY A;  1LAB A;  2K33 A;  3KLS X;  2F0E A;  2C9O A;  4FYD A;  2IJ0 A;  3TBI B;  5LL6 S;  2K7V A;  3LX0 A;  3ERQ A;  4M1U B;  4X3U A;  2A69 D;  5JOB A;  5C4Z A;  4MIU A;  2XSC A;  3OWF A;  3NHH A;  5FLX L;  2F1M A;  2V4D A;  2VB2 X;  3FPP A;  2EYO A;  1IKM A;  4OIJ A;  4J1M A;  3FPU B;  2HQE A;  1BCP D;  4UAI A;  4RGT A;  2DNE A;  2F0Q A;  1M8A A;  2AWN A;  1H9S B;  3HG9 A;  2NTT A;  3MZ5 A;  1KTK A;  3BYT B;  4ZRZ A;  4A3J B;  1GUT A;  3ND9 A;  1I4R A;  2R7Z B;  4WOR A;  5HUR A;  3M85 A;  1X3P A;  1KAA A;  4TSS A;  2I46 A;  1SBB B;  4WRD A;  1WTW A;  1GUG A;  3R2I A;  2CVR A;  2DY8 A;  3TZD A;  5FOB B;  1BCP F;  2WKD A;  2ICE C;  2WII B;  1PFM A;  3SR1 A;  3H09 A;  3OIP A;  2A73 B;  4QB4 A;  5CYU A;  1EOT A;  4KKU A;  3RZD B;  1HTP A;  2EOT A;  1PTO H;  3OMC A;  5EGT A;  4B08 A;  4FF1 A;  1JOR A;  1KNA A;  1FD7 D;  1SYG A;  2B2U C;  4C3H B;  1JWS D;  1DM0 B;  4ZUJ A;  5A35 A;  1ESF A;  1Z47 A;  3GTK B;  4ME5 A;  5T1G A;  3S1R B;  2JA7 B;  2K04 A;  3QG1 A;  3HOX B;  4CGY B;  2ZXO A;  1U9R A;  2F3W A;  1XXG A;  3K5L A;  2XNA C;  2IX1 A;  2EJG C;  2H4O A;  2NVX B;  1KLG D;  1STE A;  1GUS A;  4OL7 A;  3T13 A;  1TWG B;  3ERO A;  5EKK A;  4K5X A;  5EKI A;  5TSS A;  2HUG A;  3C1E A;  3MVV A;  3WDN A;  1JE4 A;  5D3I B;  1SMY C;  2A68 C;  2BDN A;  2ENB A;  3RZO B;  3GTJ B;  3VR3 A;  2BA0 A;  1GUN A;  2NVQ B;  5HGT A;  3R3O A;  1CHP D;  3K58 A;  1SE4 A;  4DAV A;  4FVM A;  1EQT A;  3CRL C;  1SNM A;  2QCP X;  2R3Z A;  3A7L A;  1TWH B;  5NUC A;  2KOL A;  2SOB A;  2NWG A;  2Z4I A;  1JC7 A;  1SNQ A;  5CV9 A;  4CBV A;  2KQ3 A;  1WTQ A;  1WTP A;  1YNN D;  1PRT C;  1O7L A;  3TP5 A;  3V96 A;  1ROD A;  4IN3 A;  1JWM D;  4PQX A;  2SEB D;  3NWS A;  1STA A;  4H13 C;  5ELE A;  1NR4 A;  2JEB I;  3DM1 A;  1J8I A;  5I2Y A;  1BDO A;  1EWC A;  1STB A;  1HPC A;  4ZUI A;  2KUM A;  4ZQ3 A;  3NQT A;  1WTV A;  3BS1 A;  4S3S A;  2B8G A;  1LT5 D;  4GZY C;  1L0Y B;  4F87 A;  3MXN A;  1I4G A;  2WV6 D;  1JOK A;  2KEE A;  3D8G A;  2C5C A;  2AUJ D;  3PV0 A;  1G91 A;  2NVT B;  1EZ8 A;  2PZW A;  3LNN A;  5IGC A;  4C3I G;  5JAV A;  2B2Y A;  1TWA B;  1QCB D;  4KV6 A;  2K32 A;  1HXY D;  3M7G A;  3IFT A;  3NUC A;  1JB3 A;  4I65 A;  3ONA B;  1EWH A;  2A5H A;  4JBW A;  5IOD A;  4QIW B;  1F9S A;  4FXK C;  1XX8 A;  1EU4 A;  1A3U A;  1Q1E A;  2M9V A;  3MHB A;  4B9W A;  1BXT A;  4EQN A;  5E1F A;  5KIX A;  2FFK B;  1I4H A;  2Y0S B;  3I4L A;  4RGO S;  3KF8 A;  4IFD I;  1OO9 B;  1Q12 A;  4OO1 H;  3A55 A;  4KHZ A;  1QJO A;  3MEH A;  3OWE B;  3E5S A;  2RDG A;  1SJE D;  4EQO A;  3PO2 B;  4C1N I;  4CKC A;  3J81 E;  2JA8 B;  2K5W A;  1R4Q B;  3W2D A;  4IAL A;  1B9M A;  2XWJ B;  1EYA A;  4LJZ C;  4IUU A;  4B9X A;  4XQQ A;  1SYC A;  2EY6 A;  3GO5 A;  4N9P A;  4XT1 B;  3DHQ A;  4DXG A;  4FXG C;  3NBI A;  4K8J A;  2IWH A;  2D62 A;  1EQV A;  3P1H A;  4HCE A;  2KCC A;  5K36 H;  3DWP A;  1B2T A;  1V1O A;  3CU7 A;  2B2W C;  1XWE A;  1BNZ A;  3D4D A;  3I3C A;  5DAU A;  1SND A;  3I72 A;  2XWB B;  4XQJ A;  3VA5 A;  3HOV B;  2NVY B;  2BE5 C;  2CQA A;  2EZV A;  5M3F B;  3Q6S A;  5JEA H;  2A74 C;  1D1I A;  4C3I B;  2ZXP A;  1TS3 A;  2EDG A;  2BCO A;  1U4R A;  3HKZ B;  1RCV D;  3DWQ A;  1UNS A;  3WOE A;  4RCN A;  3VA7 A;  4A3D B;  3OHX C;  2VXW A;  1J9O A;  5DNF A;  4XT3 B;  3HRZ C;  2NZ1 D;  2XRQ D;  2IL8 A;  5COY A;  1FNU A;  2R61 A;  1OXT A;  1OXS C;  3CRK C;  4A3B B;  2NTS A;  1GHJ A;  2L5T A;  3Q23 A;  5C3W A;  3S1N B;  3A8K E;  2FHT A;  4ID6 A;  2LKV A;  1D6E C;  2M2L A;  5KGU A;  1TII D;  1Q1B A;  1ILQ A;  2A6E D;  3VR6 A;  3WOF A;  3FMC A;  3S14 B;  1W6J A;  1JWU D;  1CHQ D;  1KLU D;  1OXV A;  5FKA C;  4HN7 A;  4LMQ D;  5CV8 A;  2FJ2 A;  4XXE A;  2BOS A;  1PYW D;  2AWO A;  5J1Z A;  2IX3 A;  2Q8T A;  3E6Z X;  3NXW A;  5IGF A;  1JCK B;  1TS5 A;  2F0M A;  1HUN A;  4ABN A;  2EYF A;  2F0L A;  5C0X I;  3A7A B;  2EYM A;  2ZXR A;  5C6A A;  1NAP A;  3T51 B;  1GUO A;  2NN6 I;  2JE6 I;  1AFP A;  5I6W A;  4KD4 A;  1RTN A;  1DD2 A;  1F77 A;  1EY4 A;  3KLR A;  1UUP A;  2Z8L A;  4DF7 A;  2F03 A;  2XIW A;  2E74 C;  1EY8 A;  2L11 A;  2Z4H A;  1Q3L A;  3D6W A;  3S15 B;  5EQ0 A;  2RBM A;  4C3J G;  3KBG A;  1DJR D;  3IL8 A;  4RWS C;  3S9W A;  4LAA A;  4O42 A;  3T4A C;  1H9K A;  5A2Q E;  1VMC A;  1O7Z A;  2A6H C;  3GV3 A;  1JIC A;  3TP8 A;  2FIN B;  3V2T A;  1QE6 A;  4NMZ A;  5J22 A;  4RHS A;  5K36 G;  3IAY A;  4FNF A;  1AN8 A;  5BN3 A;  2K28 A;  3BDL A;  3GTQ B;  1TU2 B;  4KY7 A;  1SNO A;  3GTL B;  3DWA A;  4DK0 A;  4XYQ A;  5JPM C;  5CV6 A;  3CQZ B;  4O1N A;  1CFM A;  1CM9 A;  2ZT9 C;  5JEA G;  1VCI A;  4RH6 A;  4HAE A;  3MFY A;  2NYZ D;  3R8B A;  3K57 A;  2B8F A;  1D1K A;  1EY0 A;  4K5V A;  1ONL A;  1AW7 A;  4U68 A;  1RJT A;  5ELD A;  4A3M B;  1PRT B;  5M5Y B;  3EFX D;  2F0W A;  1G6Z A;  3I70 A;  3MFG A;  2JEA I;  4PMC A;  4QUF A;  2MPM A;  3VR5 A;  2EYL A;  4DA2 A;  3NE5 B;  2SDF A;  4Z9C B;  5EPJ A;  3I91 A;  2L0C A;  1SSO A;  2F0U A;  3Q0A A;  3SK5 A;  4ZAI A;  4IUR A;  1LTS D;  3J7A V;  4DNT B;  2A68 D;  5BN4 A;  4C3J B;  1GOZ A;  5LHY 1;  4V0B A;  3X3N A;  1HUM A;  3BVM A;  2J7Z A;  2E2H B;  1V1P A;  5IGE A;  3HOY B;  3QJY A;  3TP7 A;  2PZU A;  1B44 D;  5M3M B;  4H44 C;  5ISR A;  4NDX A;  1F2M A;  5ELB A;  4CJ1 B;  2AUK A;  2MJ8 A;  5CV4 A;  3MC0 B;  3BG3 A;  2EXZ A;  1HTL D;  1B4O A;  1PRT D;  5D3D A;  3NWT A;  4LK1 C;  4HTH A;  1GHK A;  3G6J B;  5FO8 B;  1BF4 A;  1RD9 D;  3S1Q B;  5KYL A;  1DXM A;  1O80 A;  3MXP A;  2RDH A;  1VF7 A;  1YNJ C;  1HQM C;  5CBE E;  5K5P A;  1LTI D;  4K2K A;  1STN A;  5C0X J;  3Q22 A;  2G9D A;  2B2T C;  2WIN B;  1PRT F;  2EVB A;  2XN9 C;  1C48 A;  1QIL A;  2I07 B;  2KVM A;  4ZKB B;  4IUQ A;  1Y8O B;  5CV5 A;  4CJ2 C;  2IT1 A;  2X6G A;  1C4Q A;  3X3M A;  1LTR D;  3KK7 A;  1EY9 A;  5FO9 B;  5CV7 A;  4IUN A;  1NCV A;  3R2T A;  3SK4 A;  1SYB A;  3S1M B;  2CW0 C;  4J8Q A;  1ZKO A;  2F0N A;  2RSO A;  2WAC A;  4DU9 A;  5IGG A;  2B2V C;  3GTP B;  2JA6 B;  4HSV A;  3C46 A;  3VYU A;  1UAP A;  5ELF A;  4NW2 A;  1WTX A;  2YU9 B;  3C2P A;  3J80 L;  1EEF D;  1HFG A;  5LL6 X;  1A3V A;  2WB1 B;  3JAM L;  3MAQ A;  4HSP A;  1WCM B;  3R93 A;  1MSG A;  1CQF A;  1KDA A;  1ZXT A;  4V19 0;  4IUV A;  1ENF A;  1MBY A;  1CA6 A;  2HCI A;  2K1B A;  2TMP A;  3DEP A;  2F0O A;  3K5M A;  3I90 A;  1O78 A;  2E2D C;  2J0T D;  2KJX A;  3G7L A;  3KBX A;  1BUV T;  1IYU A;  1Z6H A;  2EY2 A;  2F0J A;  1LTT D;  1F9Q A;  1NUC A;  5DM6 3;  1BQQ T;  3MA2 B;  4OO1 I;  1G2T A;  5FO7 B;  5EKL A;  2JA5 B;  5KNC A;  2WAQ B;  1L0X B;  1XYI A;  2JYO A;  3FEW X;  5D14 A;  4FXD A;  1PXU A;  2F0S A;  3C3L A;  3FDT A;  3K59 A;  1A3T A;  2B2U A;  5E4X A;  1GXD C;  5EPL A;  1XTC D;  5M5X B;  3S2H B;  2K05 A;  4U67 3;  5I9P A;  5F2D A;  1F2Z A;  1TT2 A;  5IT9 E;  4BBS B;  2BE5 D;  1G29 1;  3VYS A;  3SDZ A;  4A3F B;  1I4X A;  4DNR B;  2MGS A;  4K6L A;  2F0P A;  1PFN A;  1DYQ A;  1BO0 A;  1LAC A;  3NTK A;  2IX0 A;  4EQP A;  1MGS A;  4M8A A;  2H1E A;  1V1P B;  1VMP A;  5CMD A;  2OT2 A;  3GTO B;  3AU7 A;  2DY7 A;  3HS0 C;  4Q5V A;  4RFB A;  2J4X A;  4XYO A;  4ZKC B;  1H9M A;  3HEJ A;  3PUX A;  2PYK A;  5J39 A;  4FF3 A;  3OOC A;  4Q0F A;  2Q8R E;  3EA6 A;  5KRU A;  1WTR A;  3BDC A;  4KY5 A;  3VYR A;  2GA4 B;  1HFN A;  1IHZ A;  4KN4 C;  2B2V A;  1EY5 A;  5M5W B;  3S2D B;  2L9H A;  2KED A;  1JOO A;  2PMZ B;  4R9W A;  3S17 B;  2EY5 A;  3LWU A;  4JK1 C;  2QKI C;  3EQL C;  4BY1 B;  4RGM A;  2BA1 A;  3Q24 A;  1UEA B;  1SE3 A;  4FF2 A;  3PUZ A;  2E75 C;  1QB5 D;  3PMF A;  2MP1 A;  3RLF A;  2RKS A;  5FLX E;  3K0Y A;  4TQU S;  4PV1 C;  4HR7 B;  1SDF A;  3NK9 A;  1V8Q A;  1S5D D;  4R8N A;  3VR2 A;  4YIJ A;  5C5M A;  1PMR A;  1LLR D;  2KA7 A;  4DAP A;  4HCS A;  1ENA A;  2F0V A;  1DCZ A;  1ZEQ X;  3NQI A;  4QCL A;  2R93 B;  4K6D A;  1CA5 A;  3DEO A;  3TDQ A;  1TQO A;  5M9O A;  2DNC A;  3MXG A;  3NPP A;  4KY6 A;  3VYT A;  2A6H D;  4MN3 A;  1B53 A;  1EIG A;  2F0I A;  4KJN A;  3AB9 A;  3K6O A;  4L63 B;  3J7Y W;  4RHR A;  1HRJ A;  2VB3 X;  1B9N A;  2R6G A;  5C5L A;  3A56 A;  4KMU C;  1S5F D;  2KHS A;  4CKB A;  5JPN C;  2RVL A;  4RGN A;  1TY2 A;  1S5E D;  1C8C A;  1JR0 D;  4K8I A;  2AQ2 B;  3URY A;  5IT9 L;  5C44 B;  3SE0 A;  2N88 A;  4BWG B;  3L9A X;  2LY7 A;  3W3A A;  2G9H D;  1EYC A;  5D65 A;  1EL0 A;  1IW7 C;  2N55 A;  3J81 L;  1DOM A;  3D4R A;  2RSN A;  4KK7 A;  2F0F A;  1Q90 A;  4IFD J;  5I9O A;  4P2C B;  2IPK D;  1Y8P B;  1FYC A;  2Z1C A;  3NTH A;  1LT6 D;  5C0X H;  1TVX A;  4WJW A;  4A3K B;  3MXU A;  2B2W A;  2JXM B;  1SJH D;  4FP5 D;  2PCF B;  2LS0 1;  1F9P A;  1FNV A;  1O7Y A;  4IFD G;  4BBR B;  2PNR C;  1TY0 A;  2K03 A;  1S5B D;  1RDP D;  3DXJ C;  5IGB A;  3GQB A;  2MUY A;  2JSO A;  2IW3 A;  2E2I B;  4WFN 3;  1R4P B;  2QDB A;  1CZW A;  2YYZ A;  4HMI A;  4RCO A;  1MSH A;  4OGQ C;  4DN4 M;  2CHB D;  2NB0 A;  4BY7 B;  3BVG A;  3GD7 A;  1B50 A;  1KDB A;  4H7B A;  3HGB A;  2M00 A;  3K7A B;  3QO2 A;  4MHE A;  1MD2 D;  3HOW B;  1PTO C;  2K5Q A;  1JOQ A;  4TKO B;  1B3A A;  1E2Z A;  1ZYR C;  3P75 A;  2X6L A;  4RKB A;  2QEJ C;  5T1I A;  1E2W A;  4XIG S;  3ND8 A;  5KNB A;  3BDO A;  1I50 B;  5E4W C;  5C3X A;  2MHV A;  2L1B A;  3L7Z C;  1PZK D;  2EYP A;  4IQZ A;  1YNJ D;  2EYH A;  4A3I B;  1K8O A;  4C1N K;  1CTM A;  1KDC A;  3HP3 A;  3MWY W;  3P7J A;  1JQY D;  1ET6 A;  1EY7 A;  1SMY D;  3NTI A;  1BR9 A;  1TR5 A;  1T5X D;  4DXF A;  1D5X C;  2B2Y C;  3I73 A;  1D2B A;  2JP1 A;  1QG7 A;  3C1F A;  2WKC A;  1I4Q A;  1EFI D;  3TSS A;  2SNS A;  3GV6 A;  2NBF A;  1EY6 A;  5AFW A;  2PQE A;  2OEO A;  3PIP 3;  3FRP B;  3RMH A;  1BOS A;  5EPK A;  5C3E B;  1E2V A;  2CW0 D;  1B1Z A;  2F3V A;  2A69 C;  1MI2 A;  1GUW A;  2EJF C;  1Q8I A;  2D2C C;  4AYB B;  2ICI A;  4QUC A;  3E0J A;  1CI3 M;  1A15 A;  1AEX A;  5KND A;  2QIL A;  3IFD A;  4XTC S;  1AZQ A;  4A3E B;  1BCP C;  1SAP A;  5I2X A;  1II3 A;  1EEI D;  2OXP A;  2BDO A;  4CHT B;  5IOC A;  2K6A A;  1STH A;  3RUZ A;  3NBH A;  2Q8I B;  4K5W A;  1ILP A;  4HMJ A;  5JVH 3;  1SYD A;  2O2L D;  4EGV A;  5DM7 3;  2R92 B;  2AQ3 B;  1WD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...