2KCVA

Solution nmr structure of tetratricopeptide repeat domain protein sru_0103 from salinibacter ruber, northeast structural genomics consortium (nesg) target srr115c
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
EDPEDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQKDLSELQDAKLKAEGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetratricopeptide repeat domain protein
publication title Solution nmr structure of tetratricopeptide repeat domain protein sru_0103 from salinibacter ruber, northeast structural genomics consortium (nesg) target srr115c
rcsb
source organism Salinibacter ruber dsm 13855
molecule tags Structural genomics, unknown function
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kcvA00
4ME2A 4JHRA 4UI9J 4IN3B 2E2EA 3BEEA 3S7BA 4CGWA 3QWPA 4J8DA 2VYIA 1WM5A 1OUVA 5C1DA 1ZU2A 4GZ6A 5EKQD 3MV3B 4CGVA 3OXFA 3CK9A 5CCLA 3UUXA 3PE3A 5AYWD 2J9QA 4U0UA 2LSUA 1QZ2A 2KCVA 3NF1A 3TGOA 3UPVA 4ABNA 3E4BA 3ASGA 4GA2A 3LYAA 2V5FA 1HH8A 4J8EA 2BUGA 4EQFA 1TJCA 4N3AA 2LSVA 4KYOB 5JJ6A 3ZPJA 1NA0A 3OXLA 2XPIA 2HYZA 2PQNA 4XIFA 5CCMA 2R5SA 4HOTA 4UI9K 1HXIA 2XCBA 3Q15A 5FTPA 2QFCA 5M72A 2FO7A 5ARFA 4G24A 3CK7A 3S7DA 4GPKA 3U4TA 2UY1A 3ASHA 4AIFA 1ELRA 1YA0A 2WPVA 4YVOA 3SZ7A 4RG9A 3GZ2A 4G25A 3LY7A 5CHEE 3S7JA 5KJMA 1B89A 4KXKB 1P5QA 3ZHEA 4AY6A 2Y4TA 4I9EA 3QKYA 4Y6CA 3EDTB 3ZN3A 3LY9A 3N71A 2KATA 3MV2B 2YQ8A 5G04C 5BW8C 4BT9A 5G04J 5FJYA 3UQ3A 4U0SA 3QWVA 5DIZA 5D0QD 1ELWA 2FI7A 3LCAA 2IFUA 3CVNA 1IYGA 5G05C 3QDNA 5G05J 3ZGQA 2VGXA 3ESKA 1ZBPA 3RIBA 4F3VA 5EX3A 2XEVA 4BTBA 3CVQA 4Y6WA 2C2LA 3TAXA 3GYZA 5FZRA 4NRHB 3Q49B 2PQRA 3RKVA 2Q7FA 1KLXA 4APOA 3HYMB 4HOQA 1HZ4A 5KJNA 5HQ8A 4N5CA 1WAO1 3CKCA 1KT1A 3CVLA 3LPZA 3MEKA 1PC2A 4I17A 4N2QA 1FCHA 2IF4A 2KC7A 5BNWA 5FZSA 2FBNA 2YHCA 3K9IA 4CDRA 5ARGA 4G26A 3GW4A 4UQZA 2C0LA 3RO3A 2FEZA 2OOEA 2PL2A 4UQYA 1KT0A 4HORA 3PDNA 3LY8A 3ULQA 3CEQA 4LEUA 2VSYA 4WUYA 2Y4UA 3GZ1A 3FWVA 4NQ0A 5KJLA 5BT1A 2KCKA 4JA7A 4I2ZA 1Y8MA 3MA5A 2P58C 3TG5A 4JA9A 3MKRA 3S7FA 2C0MA 2MHKA 4J8FA 2L6JA 4WNGA 4WNFA 3AS4A 4XI9A 3CV0A 5A7DB 2VGYA 2UY1B 4GYYA 2KCLA 1IHGA 2UWJG 4W9RA 4N3CA 4H7YA 4O6FA 5DBKA 3PE4A 1QQEA 3ZHEB 5LCWC 2XGMA 4WNEA 4AM9A 4J0UA 4GA1A 4UI9C 5EX0A 4GA0A 3R9AB 4N2SA 2NC9A 3QWWA 3RO2A 3KD7A 4JL0A 2HO1A 4GZ3A 4G23A 1A17A 4U0ZA 3ZFWA 3RJVA 2XCCA 4I9CA 5JJ7A 2ONDA 5HI7A 4UQXA 3LKUA 4GZ5A 3ASFA 2VSNA 4A1SA 4U07A 4KBQA 2VGXB 2LNIA 3CK8A 5D0OD 4GYOA 4AY5A 4BT8A 4N3BA 3U3WA 4I1AA 3Q47B 2VQ2A 5JJTA 5A6CA 4HOUA 4WNDA 2AVPA 4N39A 4G1TA 4HOSA 3QOUA 1XNFA 3CVPA 2FF4A 1NA3A 2I6HA 4H7XA 3URZA 4XI0A 3VTYA 4GYWA 4YNDA 3WXXA 3TG4A 4GCNA 3IEGA 4YVQC 2XGOA 2XGSA 3RU0A 3SF4A 3FP3A 3O48A 2PZIA 3JYSA 1E96B 4GCOA 4B94A 3Q5MA 4RG6A 3OXGA 2GW1A 2JLBA 3FFLA 3KS2A 3CKBA 5FZQA 3AS5A 4I2WA 3VTXA 5FT9A 3ASDA 5KJKA 3Q4AB 4U04A 4BTAA 1NZNA 2DBAA 3AS8A 4G2VA 1W3BA 2HR2A 4BWRA 5LCWJ 2WQHA 3KAEA
chains in the Genus database with same CATH superfamily
3SFYA 1IKND 4MRUA 4IN3B 2E2EA 3ONLA 3FU0A 4G11A 4CGWA 3S7BA 3CSTA 3QWPA 2VYIA 3HVEA 3VLFA 1BI8B 4N5QA 3MV3B 3D9KA 3Q9NC 3CK9A 3UUXA 4DX7D 3CHRA 5AYWD 4U0UA 2LSUA 4LNGA 1BU9A 5CEDB 4J8YA 2NYJA 2NSZA 3DEOA 3ASGA 4GA2A 4DJAA 4XE0A 2V8SE 2V5FA 4J8EA 1S0PA 1QBQA 4EQFA 3PNLB 2A5EA 1TNBA 4FADA 3ZVVA 4FJZA 3ESLA 3Q7AA 5JJ6A 1NP7A 3UT4A 3ZPJA 1NA0A 3OXLA 1AP7A 2H6GA 3LXUX 2HYZA 2XEHA 2CFUA 4U63A 4XIFA 5CCMA 4FJYA 4PUCA 1HXIA 3Q15A 1YYHA 2XS8A 5CERB 1FT2A 3CHPA 3U4TA 3D9JA 2UY1A 1G3NB 3QJZA 4GB9A 3FU3A 3UM0A 5EDSA 2AW6A 1TEZA 3FUEA 4G25A 1N95A 4B0ZA 5CHEE 4I6JA 2VJ8A 4KXKB 4AY6A 2Y4TA 5AQAA 4JHJA 4BEPA 3EDTB 4AV7A 3ZN3A 3I4RB 3MV2B 2WXHA 3O4ZA 3FTVA 4BT9A 2WQ6A 5G04J 1XGWA 1K8KG 3ASNE 2XQ0A 4HNAD 5J08A 4U0SA 3FUMA 4LG6A 5CECB 5KWDA 3EHQA 3IHYA 2IFUA 2ZXWE 2HM8A 2J09A 3ENEA 3TWWA 4Q69A 5G05J 3ZGQA 3R7QA 3CQGB 3ESKA 3CVWA 4F3VA 1ZB1A 1D8DA 3PH0C 1IQUA 5G55A 4BTBA 4GAAA 1UN9A 4Y6WA 3APDA 1JUQA 4DI3A 1N4PA 5FQ8A 3EHNA 3G2TA 4Z68A 1BPOA 3RKVA 2Q7FA 1JCRA 3HYMB 4A63B 3FH5A 2XPZA 1HZ4A 5HQ8A 1WAO1 4ATGA 3LPZA 2EILE 3IKOB 3MEKA 1LTXA 4O60A 2IF4A 4L2YA 3FTYA 2JABA 4MKTA 3TWRA 4G26A 3GW4A 2C0LA 1IXVA 4U95D 3DPDA 2DWZA 2OOEA 1QYMA 1Z5SC 3G2SA 5HKPA 4HORA 3AU5A 2J4BA 3CEQA 3ULQA 1DC2A 4BSZB 2QY7A 5AARA 3ZEFA 5HS0A 2Y4UA 3FWVA 5E75A 3CGHA 3L9TA 1LD7A 4JA9A 1BLXB 4P29A 3HXBA 4DX2A 2OVBA 3X2QE 1D9SA 4WWPA 1N9AA 1HE8A 4GZDA 5AJDA 3ZU7B 2V5QC 1QNFA 5CRUA 3V31A 4GPMA 2X38A 4HLEA 5ENSD 3MKQB 2YNQA 3APFA 5ENQD 3HXFA 2ZU6B 4U8YD 2P9NG 4WWNA 1K1AA 1E7VA 2CG3A 3PE4A 3V2XA 1U2VG 3ZNGA 2MRIA 2GRMA 2Y3AA 4YDOA 2AXVA 4J0UA 4GA0A 5EIBE 4I6EA 1HFAA 3AU4A 2GROB 3QWWA 5ENPD 4KVOA 4JL0A 1OCOE 4G23A 1A17A 4U0ZA 3QNKA 3HXEA 1DVPA 5JJ7A 5FIOA 1H6KA 3EU9A 4F53A 4ANUA 4DLQA 4KMOA 2VSNA 4EZJA 3CSFA 4U07A 2VGXB 3CK8A 3LDZA 4TUMA 2QYUA 4AY5A 4EPZA 3P2BA 3RRUA 2QC9A 1Y6IA 1OCZE 3TWUA 4JB8P 2X6FA 4PS7A 1U3CA 3Q75A 5AAOA 5BPPA 3AG3E 2IO3C 4BX8A 1IQRA 5BXUA 2WXGA 2A5UA 3QOUA 3G2WA 3LVQE 5HRYA 3E32A 3VTYA 4DRXE 5EN5D 4CT0A 3WXXA 4A3VA 4YVQC 3QAQA 2OEVA 3FP3A 5D66A 4HFGA 3OXGA 3KEZA 3F6QA 2J4DA 4I2WA 3ASDA 4TXRA 1EDUA 2P9LG 2H6IA 2DBAA 4G2VA 1W3BA 3KAEA 3FDHA 3EHMA 4FP7A 3CVVA 4HQDA 4F1PA 3UMVA 2XPYA 4LERA 4X8QA 2GRNB 5EKQD 3J5PA 1OWMA 3SBSA 3PE3A 2WM9A 4RSYA 3SQVA 3SO8A 3DPYA 4CYMD 4ABNA 4TRQA 3SNXA 3LYAA 4J7WA 1OY3D 3BG0B 2DCPA 1HH8A 4MS6A 1MHQA 2LSVA 4GMLA 2RD0A 5EYPF 4DLOA 4KYOB 3D9HA 2P9KG 3EUVA 1Q2ZA 1V55E 1H6PA 2X3MA 3CVUA 2PQNA 4FLHA 3MX3A 1E8XA 3DSVA 3DBSA 3T5XA 3SHFA 1Z6TA 3APCA 4KVMA 4GTPA 3ULYA 5KNGA 3FULA 2LUHA 5A23A 2WPVA 1YA0A 4YVOA 3RAUA 1OWLA 5BV0A 3LJNA 4QFVA 5CBOA 2VTBB 3ULEG 2EIME 3B7RL 2CHXA 3IBEA 1B89A 3PEUB 1P5QA 3ZHEA 1MJ0A 4ILHB 4Y6CA 2KBXA 3LY9A 4OYSA 2B0OE 1GW6A 2XRYA 3V79K 4HI9A 3CVXA 2YQ8A 4PH4B 5G04C 3L82A 5FJYA 2VSOE 2YHEA 3NB2A 3I4GA 2F0YA 4Q96A 3QWVA 4C9BB 5DIZA 3ZXSA 2IOLA 1L5JA 4CRWA 1OWOA 5FINA 4XX5A 4L23A 2RG8A 4EBAG 3E30A 4K03A 2F37A 5G05C 2XZDG 1ZBPA 3RIBA 2L9BA 5EX3A 2XEVA 3B95A 2DYSE 2X6KA 3TAXA 3FUNA 3UIPC 1IHBA 3GYZA 1SQMA 4BY6A 2J08A 1X5BA 2GRQB 4A55A 3Q49B 2PQRA 4GMRA 4GTQA 2RKKA 3FTSA 4DPRA 1N4SA 4IULA 2WVIA 1N4QA 2EINE 4I17A 4N2QA 3GZSA 5FZSA 2FBNA 2WXIA 3SI5A 2NXPA 4JXTA 3TXMA 5ARGA 4RVBA 4IRUA 4TXPA 3CIAA 2PL2A 4LUNU 5LX8A 3FHEA 3PDNA 4EZKA 2WXLA 3E37A 2BKGA 2BF0X 4HRLA 2VSYA 1S64A 1HX8A 4NQ0A 5KJLA 1LD8A 4JA7A 1Y8MA 3MA5A 3ZYLA 4GTOA 2L0IA 2VSXE 2C0MA 2P9PG 4LNBA 2QYJA 3UKUG 4L1BA 2L0TB 3FUDA 4U8HA 4TUUA 4ILGA 2E0IA 2VGYA 4WAFA 4J6IA 1EPUA 4K5AB 5G2NA 4N3CA 2DVWA 3Q78A 3L16A 1QQEA 2WXNA 5LCWC 2XGMA 3WG7E 2LO6A 4UI9C 2X6IA 2GRRB 4BSXA 3DWLG 2IONA 3R9AB 1OWPA 1Z3XA 5JHAA 2M63A 3P1UA 3RO2A 3FH8A 3KD7A 2R03A 4FLBA 1SA5A 2KZTB 4GZ3A 4IYPA 5EILA 1TNYA 4AXHA 3C72A 1N54A 4GZ5A 2EIJE 2WXOA 3TWSA 4BX9A 2Y1LE 5JHBA 2I1JA 2XENA 2PM6A 3KSQA 4OVUA 1NFIE 2QZAA 3L22A 4I1OB 4BT8A 5CBNA 4I1AA 3Q47B 2XZTG 4MLPA 1V54E 2V4HC 1MX6A 1RW2A 3TL5A 4WNDA 2AVPA 4N39A 5LFAA 2WXQA 1SW6A 3TWQA 3DSWA 3UIOC 5CMYA 1XNFA 2MYOA 1BD8A 3CVPA 4V3IA 4CDMA 2CHZA 4F7AA 2R59A 4L9PA 2I1KA 4M3OA 3UM2A 4HLLA 4BESA 3PNTB 2DZNA 3OTNA 1HG5A 1WY6A 3G2UA 3RK6A 2RFMA 1SVXA 2IO2C 3O48A 1WDYA 4OAUC 4GCOA 4URKA 3Q5MA 3NAWA 4RG6A 3AG1E 1HS6A 4PS3A 2J07A 3PUJA 1LF8A 4ANWA 2Y0BG 3SGHA 3I5PA 1N11A 2WXRA 5FT9A 4XKBA 3UT7A 3JXIA 3Q4AB 4A3TA 5AJLA 1NZNA 5LCWJ 3MGBA 4RQIA 2WQHA 4KZ0A 3FTWA 4NURA 3FUFA 1HF8A 4JHRA 4UI9J 4DUIA 3T8MA 1MQSA 3UX4A 4BFRA 4TV3A 4J8DA 1TJFA 1A5EA 1OUVA 5C1DA 1TR4A 3UM3A 4ACLA 3AG4E 3ASOE 3OXFA 5FQ7A 2L6BA 2WMNA 3HXCA 4GTRA 2J9QA 3C98A 3NF1A 2KCVA 4OAVB 2PM7A 3B13A 3E4BA 4UWHA 3LVRE 2J8SD 3ZW3A 1TJCA 5B3SE 4UWLA 5AQ9A 2XPIA 5ENRD 3DXMG 3Q9UC 2R05A 3CHMA 2B6CA 2LAIA 4LNUD 2R5SA 1JCSA 4UI9K 2XCBA 5FTPA 5M72A 2MOWA 2FO7A 2AXZA 2AJAA 1K3ZD 3PUKA 3MKQA 3S7DA 3ML9A 4GPKA 1EYHA 5BV1A 3KEAA 3C5RA 3PEVB 1WG0A 3FTZA 1UJKA 2GRPB 3L54A 3Q79A 4RG9A 3GZ2A 2CG2A 3ONKA 4U96D 4LRZA 3LY7A 3S7JA 1ELKA 5KJMA 2HE0A 4I9EA 3S2AA 3C3QA 2DZOA 3HRAA 2KATA 1UJJA 2KXPC 2FULA 3T9KA 3FEXA 4DX6D 3UQ3A 1SA4A 4AP2A 2ZIRA 1ELWA 4OVVA 3EJNA 1RZ4A 5H7PA 1JWFA 2FI7A 3BU8A 3SFXA 5EYLA 4JC8A 1FVHA 3CVNA 1IYGA 3QDNA 3G2VA 3PVLA 2VGXA 1TNOA 3CVQA 4FU3A 4GTTA 3VLDA 1VDYA 4HXIA 5FZRA 2BTDA 3HIZA 5B1BE 1MZCA 2WQ7A 3T5VA 3DRAA 2X6HA 5FQ6A 3ZXPA 4N5CA 1Z3YA 1KT1A 5KCMA 1NL4A 5BNWA 3EU5A 4C0EA 5J90A 2YHCA 4CDRA 3HVEB 3NZSA 5E76A 4G8KA 1KT0A 2V4LA 2WXPA 5LP0A 4R7LA 3BQOA 3SFZA 4LEUA 2A4ZA 3FU5A 2ZGGA 4WUYA 2XRZA 1X81A 4DX5D 4I2ZA 2AWIA 1S63A 2IOSA 2BEDA 2BKKB 4Q94A 1E8YA 1TNUA 3C3OA 3UINC 3ZYQA 3E34A 4JD2G 3HHMA 3MKRA 3LEWA 4JEUA 2I9CA 5D2MC 2MHKA 2WXMA 2L6JA 2JEKA 4WNGA 3FUJA 1PAQA 4WNFA 3ML8A 1D8EA 3CV0A 3JCKC 3ABKE 5ANRA 3PZ2A 3B7UX 2WXFA 3L17A 3D9NA 3OAWA 2UY1B 4GYYA 1MX2A 1H2UA 2KCLA 1TYQG 2P9SG 5ANLA 1IHGA 4EBAA 4W9RA 4GTSA 3MYVA 4O6FA 5KBAA 5ENOD 3PS6A 2R2LA 4B93B 3AJIA 4KZCA 2ILRA 3B7BA 3DSTA 3PZ1A 3JUIA 3UT8A 4BERA 4AM9A 3MZLB 4GA1A 5EX0A 4ANVA 3R7RA 4F6RD 3L13A 1KPSB 4B8AA 4K5BA 3NBNB 4APFA 2HO1A 5KNHD 2V0PA 3ABLE 3DXKG 4ILIA 2DYRE 1S70B 3JQ0A 3RJVA 5HI7A 4UQXA 3UTMA 1HO8A 3LKUA 3SY2A 3ASFA 3UM1A 4A1SA 2P9UG 2VTBA 1O1RA 4JPSA 5D0OD 2ETBA 3PREA 4WWOA 4O1PA 2WXKA 5ITZF 3J5QB 3DSXA 3FEYA 1UW4B 5JJTA 5FWQA 5A6CA 3FUHA 4AJWA 4C0MA 4G1TA 1JWGA 3FU6A 2R17C 5BUZA 3TXNA 3I3NA 2FF4A 5ENTD 4CT4A 1K1BA 5CEAA 5AENA 4HS2A 4K0RA 4EZLA 4XEIG 4MBGA 4GCNA 1N94A 2GGFA 4CDNA 3RU0A 2PZIA 3JYSA 1E96B 4B94A 4AEZC 1H0AA 3FFLA 3U64A 5AQ7A 3DSSA 4PS8A 2R02A 5FZQA 4TXQA 3AS5A 4FULA 1TN6A 3B7SA 4O1OA 3VTXA 1DCEA 5T3RA 2F8XK 3FTXA 4GTMA 4HRNA 2HR2A 4BWRA 5AN8A 4HB5A 1O1SA 4UWKA 3JQ1A 4ME2A 1TN8A 3ABME 2H6FA 3BEEA 2X6JA 4AOFA 5AQBA 2IEJA 4D10C 1O5MA 1WM5A 1DCQA 4UWGA 3TWXA 3Q7FA 1ZU2A 3NQPA 4GZ6A 2LAHA 5EIDA 4CGVA 4QQIA 5ENNA 3NOGD 5CCLA 3D9OA 4E85A 1QZ2A 3TGOA 3C3RA 3W9FA 2OEWA 3UPVA 2XHEA 5T4YA 3U66A 4ACKA 2RFAA 4CZ2D 2BUGA 4UUCA 4N3AA 2P2CP 4J8SA 1O1TA 3T8KA 3QB2A 1DNPA 4NIKA 4GZCA 2GRLA 4JW1A 3CVYA 4L2LA 4ATZD 3PRZA 4YDEA 4HOTA 2IY0C 2QFCA 5ARFA 4G24A 3CK7A 2IU1A 2Y69E 3KSLA 3JXJA 4AVXA 4ZHBA 2ZGDA 4HBDA 3ASHA 4AIFA 4NACA 5IY5E 1ELRA 3SZ7A 2EIKE 3FH7A 4LSZE 5CMWA 4YDWA 3UKRG 1OT8A 1TN7A 4JHKA 1MX4A 4F1SA 3LS8A 1YMPA 1U3DA 3AG2E 2YINA 3AAAC 4B89A 3D3MA 2WB2A 3QKYA 3N71A 3FUIA 2OCCE 4G8LA 2LXMA 4JZYA 5BW8C 3RRNB 1N0RA 4E6HA 2KZTA 2FO1E 2CFZA 3DSUA 4U8VD 4HI8A 5D0QD 3UI2A 3VLEA 2CHWA 3LCAA 1FVFA 3EIJA 1NI1A 5AIJA 2IQCA 2PNNA 4FHJA 4I1MA 3V30A 4CCAA 1OWNA 3SD5A 2I2OA 2ZISA 3CR3A 1H2VC 2C2LA 1E7UA 3HDXA 1E8ZA 4NRHB 2ETAA 4GMJA 2XS1A 1KLXA 4APOA 3PZDA 3UXGA 3CHOA 3E33A 4HOQA 2AXUA 5KJNA 3CKCA 3ZYMA 3U9WA 5JMND 3CVLA 3CLJA 1PC2A 5C2YA 3Q73A 1FCHA 2KC7A 4FA6A 4RLYA 3K9IA 4UQZA 3RO3A 2FEZA 4UQYA 2ETCA 3D9LA 1UN8A 3LY8A 4CEMA 4DK5A 3ISMC 3NZUA 3FUKA 4PDXA 2VGEA 5T8IA 3D9MA 1KZOA 3CQCB 3TJPA 3GZ1A 2OV8A 1E90A 5BT1A 2KCKA 3MCXA 3ZKJA 2P58C 1PY1A 1FT1A 3BUAA 3TG5A 3FY4A 4EHMA 1JCQA 3ZRHA 3S7FA 1UOHA 3QARA 4JEHA 4LCTA 3PZ3A 1SZAA 3TWVA 1INZA 4J8FA 1N52A 3DEPA 3AS4A 1UG3A 4XI9A 4YDYA 1OCCE 3QC1A 1OCRE 3R9MA 5A7DB 1JPLA 3IV0A 3CHQA 1TNZA 4DX1A 4HRMB 4UWFA 2UWJG 4H7YA 3MJWA 1HU3A 3TWTA 2P9IG 1SZ9A 5DBKA 2F8YA 1MYOA 3ZHEB 1KZPA 4I43A 1N4RA 4WNEA 1H6OA 1BI7B 5JA4D 5LOZA 4N2SA 2NC9A 3LJ3A 4GU5A 4BETA 3EIQC 3HG0D 5FQ4A 4U7EB 3ZFWA 3IXEA 4C48B 2XCCA 4I9CA 2XEEA 2KM4A 3HXDA 5B1AE 1H2TC 2ONDA 1E8WA 3ZYKA 5BXOA 3SBTB 4KBQA 2LNIA 2WMOA 3PZ4A 4GYOA 1OXJA 5CRVA 4FC8A 4N3BA 4I6GA 3QK0A 3U3WA 2EQXA 4FHKA 3D9PA 4DI4A 2OVFA 1YCSB 2VQ2A 4HVBA 3W9GA 4HOUA 1H19A 2H6HA 3FTUA 3JUEA 1FPPA 3NOCD 4B8CB 2LXLA 4HOSA 2DIWA 3V2OA 4JVSA 4ANXA 4XZ4A 1NA3A 3RSEG 4XKCA 2I6HA 1N0QA 4H7XA 3URZA 1HG2A 4XI0A 2IJGX 3D9IA 4GYWA 4YNDA 3TG4A 3ZIMA 1EF1C 3IEGA 3L6AA 2XGOA 2XGSA 1AWCB 3SF4A 3CHSA 4K5CA 3B7TA 4ZFHA 4L7TA 2GW1A 2JLBA 3KS2A 3L08A 3CKBA 3BG1B 4A1GA 3ZUVB 2WXJA 3RRMB 3EHRA 4KT6B 5KJKA 4U04A 4BTAA 3AS8A 4M7CA 4GTVA 2J49A 3IHVA 4EECA
chains in the Genus database with same CATH topology
3FUFA 4ME2A 1HF8A 4FP7A 4JHRA 4MRUA 4UI9J 4IN3B 2E2EA 3ONLA 3CVVA 3FU0A 4G11A 3BEEA 3S7BA 4CGWA 2X6JA 3UMVA 3T8MA 4AOFA 2XPYA 3CSTA 1MQSA 3QWPA 4LERA 3UX4A 4BFRA 4D10C 4TV3A 4J8DA 1TJFA 2VYIA 1WM5A 4UWGA 1OUVA 5C1DA 3HVEA 1ZU2A 3NQPA 3VLFA 4GZ6A 4ACLA 2LAHA 5EKQD 3MV3B 4CGVA 5ENNA 3D9KA 1OWMA 3OXFA 5FQ7A 3CK9A 3SBSA 5CCLA 2WMNA 3UUXA 3PE3A 3CHRA 5AYWD 2J9QA 3D9OA 2WM9A 4RSYA 2LSUA 3C98A 4U0UA 4E85A 1QZ2A 2KCVA 3NF1A 3TGOA 2PM7A 2NSZA 3UPVA 2XHEA 5T4YA 3B13A 4ABNA 3E4BA 4UWHA 3U66A 3ASGA 4GA2A 4TRQA 4ACKA 4DJAA 3SNXA 3LYAA 4XE0A 2V8SE 3BG0B 3LVRE 2V5FA 2DCPA 1HH8A 4J8EA 1S0PA 2BUGA 3ZW3A 4EQFA 3PNLB 4MS6A 1TJCA 4N3AA 4FADA 1MHQA 2LSVA 4GMLA 3ZVVA 4J8SA 2RD0A 4FJZA 4DLOA 3ESLA 4KYOB 5JJ6A 4UWLA 1NP7A 3UT4A 3ZPJA 1NA0A 3OXLA 2XPIA 3QB2A 1DNPA 3LXUX 2HYZA 4GZCA 2GRLA 2CFUA 3CHMA 4U63A 2X3MA 3CVUA 2PQNA 4JW1A 4XIFA 5CCMA 2LAIA 4FLHA 4L2LA 3MX3A 3PRZA 4FJYA 2R5SA 4PUCA 3CVYA 4HOTA 1E8XA 4UI9K 1HXIA 2XCBA 3Q15A 5FTPA 2QFCA 5M72A 2MOWA 3DBSA 2FO7A 2AXZA 5ARFA 4G24A 3T5XA 3CK7A 2IU1A 3PUKA 3MKQA 3S7DA 3ML9A 4AVXA 3CHPA 1EYHA 3SHFA 5BV1A 4GPKA 1Z6TA 3U4TA 3D9JA 3APCA 4KVMA 2UY1A 3ASHA 3PEVB 3QJZA 3FTZA 4AIFA 4NACA 3FULA 5A23A 2WPVA 1ELRA 1YA0A 1UJKA 4GB9A 1OWLA 4YVOA 3FU3A 3SZ7A 3FH7A 3L54A 5CMWA 4RG9A 3GZ2A 2CG2A 4JHKA 5BV0A 5EDSA 3ONKA 4QFVA 2AW6A 1TEZA 2VTBB 3FUEA 4G25A 4B0ZA 4LRZA 3LY7A 5CHEE 1ELKA 3S7JA 4F1SA 3B7RL 5KJMA 4I6JA 2CHXA 3LS8A 2VJ8A 1B89A 3IBEA 3PEUB 4KXKB 1P5QA 3ZHEA 1U3DA 4AY6A 2Y4TA 4I9EA 2YINA 3S2AA 4EECA 4JHJA 4B89A 4ILHB 3D3MA 2WB2A 3QKYA 4Y6CA 3EDTB 4AV7A 3ZN3A 3LY9A 3I4RB 4OYSA 3N71A 2KATA 3FUIA 3MV2B 1GW6A 2WXHA 2XRYA 4JZYA 3O4ZA 1UJJA 3CVXA 2YQ8A 4PH4B 5G04C 5BW8C 3FTVA 4BT9A 2WQ6A 5G04J 1XGWA 2FULA 3RRNB 5FJYA 2XQ0A 3FEXA 4E6HA 2KZTA 2VSOE 2YHEA 5J08A 3UQ3A 2CFZA 3FUMA 4U0SA 3I4GA 4Q96A 4AP2A 3QWVA 4C9BB 5DIZA 3ZXSA 2IOLA 3IHYA 1L5JA 4CRWA 5D0QD 1ELWA 4OVVA 1OWOA 3EJNA 4XX5A 4L23A 3VLEA 1JWFA 2CHWA 2FI7A 2RG8A 3LCAA 1FVFA 3EIJA 4JC8A 1FVHA 4EBAG 2IFUA 3CVNA 4K03A 1IYGA 2HM8A 2J09A 3ENEA 5G05C 3QDNA 3G2VA 4Q69A 5G05J 3PVLA 3ZGQA 3R7QA 2IQCA 2VGXA 3CQGB 1ZBPA 3ESKA 5AIJA 3RIBA 4FHJA 4F3VA 3CVWA 2L9BA 4I1MA 5EX3A 2XEVA 3PH0C 1IQUA 5G55A 4BTBA 4CCAA 3CVQA 1OWNA 3SD5A 4GAAA 4FU3A 2I2OA 3VLDA 1UN9A 4Y6WA 1VDYA 3CR3A 1H2VC 1JUQA 2C2LA 2X6KA 3APDA 1E7UA 3HDXA 5FQ8A 4HXIA 3TAXA 4DI3A 3EHNA 3FUNA 3GYZA 5FZRA 1SQMA 3G2TA 4BY6A 1E8ZA 2J08A 1X5BA 2BTDA 4NRHB 3HIZA 4A55A 3Q49B 4GMJA 2PQRA 1BPOA 3RKVA 2WQ7A 3T5VA 2Q7FA 1KLXA 4APOA 2X6HA 3PZDA 3HYMB 5FQ6A 3FH5A 2XPZA 3CHOA 3FTSA 4DPRA 4HOQA 1HZ4A 2AXUA 5KJNA 5HQ8A 4N5CA 1WAO1 3CKCA 3ZYMA 1Z3YA 1KT1A 2WVIA 4IULA 5KCMA 3U9WA 4ATGA 3CVLA 3LPZA 3CLJA 3IKOB 1PC2A 3MEKA 4I17A 5C2YA 4N2QA 3GZSA 1FCHA 2IF4A 2KC7A 5BNWA 3JQ1A 4L2YA 5FZSA 2FBNA 3FTYA 2WXIA 4C0EA 3SI5A 2NXPA 4FA6A 5J90A 2YHCA 3K9IA 4JXTA 4MKTA 5ARGA 4G26A 3GW4A 4UQZA 2C0LA 3TXMA 4CDRA 4RVBA 3RO3A 3HVEB 3NZSA 5E76A 3DPDA 4IRUA 2FEZA 3CIAA 2OOEA 2PL2A 4LUNU 4UQYA 5LX8A 3FHEA 1KT0A 3D9LA 3G2SA 3PDNA 1UN8A 3LY8A 3AU5A 4EZKA 4CEMA 2V4LA 2J4BA 3CEQA 3ULQA 2WXLA 2WXPA 4R7LA 3NZUA 3FUKA 4DK5A 3SFZA 5LP0A 4PDXA 2BF0X 4LEUA 5T8IA 3D9MA 3CQCB 2QY7A 2A4ZA 3FU5A 2VSYA 3TJPA 3ZEFA 4WUYA 2Y4UA 3GZ1A 3FWVA 5E75A 2XRZA 2OV8A 1E90A 1HX8A 3CGHA 4NQ0A 5BT1A 5KJLA 2KCKA 3MCXA 4JA7A 4I2ZA 2AWIA 1Y8MA 3MA5A 2P58C 3ZYLA 1PY1A 2IOSA 3TG5A 3FY4A 4Q94A 2L0IA 4JA9A 1E8YA 4P29A 3ZRHA 3ZYQA 2VSXE 2OVBA 4HORA 3HHMA 3MKRA 3S7FA 3LEWA 4WWPA 2C0MA 3QARA 4JEUA 2I9CA 4JEHA 4LCTA 1HE8A 1SZAA 2MHKA 2WXMA 4GZDA 5AJDA 1INZA 4J8FA 2L6JA 2JEKA 1N52A 3FUJA 4L1BA 4WNGA 1PAQA 1QNFA 2L0TB 3AS4A 1UG3A 4WNFA 4XI9A 3FUDA 3ML8A 3CV0A 3QC1A 4U8HA 5A7DB 4TUUA 4ILGA 3JCKC 2X38A 4HLEA 5ANRA 1JPLA 3B7UX 2E0IA 2WXFA 3L17A 3MKQB 2YNQA 3APFA 2VGYA 3IV0A 3D9NA 3OAWA 3CHQA 2UY1B 4GYYA 4WAFA 1H2UA 2ZU6B 4J6IA 2KCLA 1EPUA 1IHGA 5ANLA 4UWFA 5G2NA 4EBAA 2UWJG 4W9RA 4N3CA 3KAEA 4WWNA 4H7YA 3MYVA 3MJWA 4O6FA 1E7VA 1HU3A 3PS6A 1SZ9A 2CG3A 3L16A 3PE4A 5DBKA 1QQEA 4KZCA 2MRIA 2GRMA 2ILRA 2Y3AA 3ZHEB 4I43A 2WXNA 5LCWC 3JUIA 3UT8A 2AXVA 2XGMA 4WNEA 4AM9A 4J0UA 3MZLB 2LO6A 4GA1A 4UI9C 2X6IA 5EX0A 4BSXA 4ANVA 3R7RA 4GA0A 2IONA 3R9AB 1OWPA 4I6EA 1Z3XA 5JHAA 1HFAA 3AU4A 5LOZA 4N2SA 2NC9A 2M63A 3P1UA 3QWWA 3LJ3A 4GU5A 3FH8A 3KD7A 3L13A 3RO2A 4B8AA 4FLBA 4KVOA 4APFA 4JL0A 2HO1A 2V0PA 2KZTB 4GZ3A 4G23A 3IHVA 3EIQC 4IYPA 1A17A 4U0ZA 5FQ4A 4ILIA 3ZFWA 3JQ0A 3RJVA 2XCCA 3QNKA 4I9CA 2KM4A 4AXHA 1DVPA 5JJ7A 1N54A 1H2TC 1H6KA 2ONDA 5HI7A 4UQXA 1E8WA 3ZYKA 4F53A 1HO8A 3LKUA 4GZ5A 4ANUA 4DLQA 4KMOA 2WXOA 3ASFA 2VSNA 4BX9A 3SBTB 4EZJA 4A1SA 3CSFA 4U07A 4KBQA 5JHBA 2VGXB 2LNIA 2I1JA 3CK8A 2PM6A 2VTBA 4JPSA 5D0OD 3LDZA 2WMOA 3PREA 4OVUA 4WWOA 3L22A 4GYOA 4AY5A 2WXKA 4I1OB 4EPZA 4FC8A 3P2BA 4BT8A 4N3BA 4I6GA 3QK0A 3U3WA 2EQXA 4I1AA 3Q47B 4FHKA 1Y6IA 3RRUA 3FEYA 4MLPA 3D9PA 1UW4B 2OVFA 2X6FA 1U3CA 2VQ2A 4PS7A 5FWQA 4DI4A 3TL5A 4HVBA 5BPPA 5A6CA 3FUHA 4HOUA 4WNDA 2AVPA 4N39A 1H19A 4AJWA 4BX8A 5LFAA 3FTUA 4C0MA 2WXQA 4G1TA 1IQRA 4B8CB 1JWGA 2WXGA 3FU6A 4HOSA 2A5UA 2DIWA 2R17C 3QOUA 5CMYA 1XNFA 5BUZA 3TXNA 4JVSA 3CVPA 2FF4A 3G2WA 3I3NA 4V3IA 4ANXA 4XZ4A 4CDMA 5JJTA 1NA3A 2CHZA 4CT4A 4XKCA 2I6HA 2R59A 4F7AA 2I1KA 4M3OA 4H7XA 3URZA 5AENA 3LVQE 4HS2A 1HG2A 4K0RA 4XI0A 2IJGX 3VTYA 4EZLA 3D9IA 3PNTB 3OTNA 4GYWA 4YNDA 1HG5A 4CT0A 3WXXA 1WY6A 3TG4A 3G2UA 3ZIMA 1EF1C 3IEGA 4GCNA 2GGFA 3RK6A 4A3VA 4YVQC 3L6AA 4CDNA 2XGOA 2XGSA 3QAQA 3RU0A 3SF4A 3CHSA 3FP3A 3O48A 2PZIA 3JYSA 1E96B 4HFGA 4GCOA 4URKA 3B7TA 4B94A 3Q5MA 4AEZC 4RG6A 3OXGA 4L7TA 1HS6A 2GW1A 1H0AA 2JLBA 3FFLA 3KEZA 2J07A 3KS2A 4PS3A 3U64A 3PUJA 3L08A 3CKBA 3BG1B 4PS8A 1LF8A 5FZQA 4A1GA 2J4DA 3AS5A 4FULA 3B7SA 4ANWA 4I2WA 3VTXA 3SGHA 2WXJA 3RRMB 3I5PA 2WXRA 5FT9A 3ASDA 4XKBA 3UT7A 5T3RA 4KT6B 1EDUA 5KJKA 3Q4AB 4U04A 4A3TA 3FTXA 5AJLA 1NZNA 2DBAA 3AS8A 4BTAA 4G2VA 1W3BA 2HR2A 4BWRA 5LCWJ 3MGBA 2J49A 4UWKA 2WQHA 4KZ0A 3FTWA 4NURA 3FDHA 3EHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME2 A;  4JHR A;  4UI9 J;  4IN3 B;  2E2E A;  3BEE A;  3S7B A;  4CGW A;  3QWP A;  4J8D A;  2VYI A;  1WM5 A;  1OUV A;  5C1D A;  1ZU2 A;  4GZ6 A;  5EKQ D;  3MV3 B;  4CGV A;  3OXF A;  3CK9 A;  5CCL A;  3UUX A;  3PE3 A;  5AYW D;  2J9Q A;  4U0U A;  2LSU A;  1QZ2 A;  2KCV A;  3NF1 A;  3TGO A;  3UPV A;  4ABN A;  3E4B A;  3ASG A;  4GA2 A;  3LYA A;  2V5F A;  1HH8 A;  4J8E A;  2BUG A;  4EQF A;  1TJC A;  4N3A A;  2LSV A;  4KYO B;  5JJ6 A;  3ZPJ A;  1NA0 A;  3OXL A;  2XPI A;  2HYZ A;  2PQN A;  4XIF A;  5CCM A;  2R5S A;  4HOT A;  4UI9 K;  1HXI A;  2XCB A;  3Q15 A;  5FTP A;  2QFC A;  5M72 A;  2FO7 A;  5ARF A;  4G24 A;  3CK7 A;  3S7D A;  4GPK A;  3U4T A;  2UY1 A;  3ASH A;  4AIF A;  1ELR A;  1YA0 A;  2WPV A;  4YVO A;  3SZ7 A;  4RG9 A;  3GZ2 A;  4G25 A;  3LY7 A;  5CHE E;  3S7J A;  5KJM A;  1B89 A;  4KXK B;  1P5Q A;  3ZHE A;  4AY6 A;  2Y4T A;  4I9E A;  3QKY A;  4Y6C A;  3EDT B;  3ZN3 A;  3LY9 A;  3N71 A;  2KAT A;  3MV2 B;  2YQ8 A;  5G04 C;  5BW8 C;  4BT9 A;  5G04 J;  5FJY A;  3UQ3 A;  4U0S A;  3QWV A;  5DIZ A;  5D0Q D;  1ELW A;  2FI7 A;  3LCA A;  2IFU A;  3CVN A;  1IYG A;  5G05 C;  3QDN A;  5G05 J;  3ZGQ A;  2VGX A;  3ESK A;  1ZBP A;  3RIB A;  4F3V A;  5EX3 A;  2XEV A;  4BTB A;  3CVQ A;  4Y6W A;  2C2L A;  3TAX A;  3GYZ A;  5FZR A;  4NRH B;  3Q49 B;  2PQR A;  3RKV A;  2Q7F A;  1KLX A;  4APO A;  3HYM B;  4HOQ A;  1HZ4 A;  5KJN A;  5HQ8 A;  4N5C A;  1WAO 1;  3CKC A;  1KT1 A;  3CVL A;  3LPZ A;  3MEK A;  1PC2 A;  4I17 A;  4N2Q A;  1FCH A;  2IF4 A;  2KC7 A;  5BNW A;  5FZS A;  2FBN A;  2YHC A;  3K9I A;  4CDR A;  5ARG A;  4G26 A;  3GW4 A;  4UQZ A;  2C0L A;  3RO3 A;  2FEZ A;  2OOE A;  2PL2 A;  4UQY A;  1KT0 A;  4HOR A;  3PDN A;  3LY8 A;  3ULQ A;  3CEQ A;  4LEU A;  2VSY A;  4WUY A;  2Y4U A;  3GZ1 A;  3FWV A;  4NQ0 A;  5KJL A;  5BT1 A;  2KCK A;  4JA7 A;  4I2Z A;  1Y8M A;  3MA5 A;  2P58 C;  3TG5 A;  4JA9 A;  3MKR A;  3S7F A;  2C0M A;  2MHK A;  4J8F A;  2L6J A;  4WNG A;  4WNF A;  3AS4 A;  4XI9 A;  3CV0 A;  5A7D B;  2VGY A;  2UY1 B;  4GYY A;  2KCL A;  1IHG A;  2UWJ G;  4W9R A;  4N3C A;  4H7Y A;  4O6F A;  5DBK A;  3PE4 A;  1QQE A;  3ZHE B;  5LCW C;  2XGM A;  4WNE A;  4AM9 A;  4J0U A;  4GA1 A;  4UI9 C;  5EX0 A;  4GA0 A;  3R9A B;  4N2S A;  2NC9 A;  3QWW A;  3RO2 A;  3KD7 A;  4JL0 A;  2HO1 A;  4GZ3 A;  4G23 A;  1A17 A;  4U0Z A;  3ZFW A;  3RJV A;  2XCC A;  4I9C A;  5JJ7 A;  2OND A;  5HI7 A;  4UQX A;  3LKU A;  4GZ5 A;  3ASF A;  2VSN A;  4A1S A;  4U07 A;  4KBQ A;  2VGX B;  2LNI A;  3CK8 A;  5D0O D;  4GYO A;  4AY5 A;  4BT8 A;  4N3B A;  3U3W A;  4I1A A;  3Q47 B;  2VQ2 A;  5JJT A;  5A6C A;  4HOU A;  4WND A;  2AVP A;  4N39 A;  4G1T A;  4HOS A;  3QOU A;  1XNF A;  3CVP A;  2FF4 A;  1NA3 A;  2I6H A;  4H7X A;  3URZ A;  4XI0 A;  3VTY A;  4GYW A;  4YND A;  3WXX A;  3TG4 A;  4GCN A;  3IEG A;  4YVQ C;  2XGO A;  2XGS A;  3RU0 A;  3SF4 A;  3FP3 A;  3O48 A;  2PZI A;  3JYS A;  1E96 B;  4GCO A;  4B94 A;  3Q5M A;  4RG6 A;  3OXG A;  2GW1 A;  2JLB A;  3FFL A;  3KS2 A;  3CKB A;  5FZQ A;  3AS5 A;  4I2W A;  3VTX A;  5FT9 A;  3ASD A;  5KJK A;  3Q4A B;  4U04 A;  4BTA A;  1NZN A;  2DBA A;  3AS8 A;  4G2V A;  1W3B A;  2HR2 A;  4BWR A;  5LCW J;  2WQH A;  3KAE A; 
#chains in the Genus database with same CATH topology
 3SFY A;  1IKN D;  4MRU A;  4IN3 B;  2E2E A;  3ONL A;  3FU0 A;  4G11 A;  4CGW A;  3S7B A;  3CST A;  3QWP A;  2VYI A;  3HVE A;  3VLF A;  1BI8 B;  4N5Q A;  3MV3 B;  3D9K A;  3Q9N C;  3CK9 A;  3UUX A;  4DX7 D;  3CHR A;  5AYW D;  4U0U A;  2LSU A;  4LNG A;  1BU9 A;  5CED B;  4J8Y A;  2NYJ A;  2NSZ A;  3DEO A;  3ASG A;  4GA2 A;  4DJA A;  4XE0 A;  2V8S E;  2V5F A;  4J8E A;  1S0P A;  1QBQ A;  4EQF A;  3PNL B;  2A5E A;  1TNB A;  4FAD A;  3ZVV A;  4FJZ A;  3ESL A;  3Q7A A;  5JJ6 A;  1NP7 A;  3UT4 A;  3ZPJ A;  1NA0 A;  3OXL A;  1AP7 A;  2H6G A;  3LXU X;  2HYZ A;  2XEH A;  2CFU A;  4U63 A;  4XIF A;  5CCM A;  4FJY A;  4PUC A;  1HXI A;  3Q15 A;  1YYH A;  2XS8 A;  5CER B;  1FT2 A;  3CHP A;  3U4T A;  3D9J A;  2UY1 A;  1G3N B;  3QJZ A;  4GB9 A;  3FU3 A;  3UM0 A;  5EDS A;  2AW6 A;  1TEZ A;  3FUE A;  4G25 A;  1N95 A;  4B0Z A;  5CHE E;  4I6J A;  2VJ8 A;  4KXK B;  4AY6 A;  2Y4T A;  5AQA A;  4JHJ A;  4BEP A;  3EDT B;  4AV7 A;  3ZN3 A;  3I4R B;  3MV2 B;  2WXH A;  3O4Z A;  3FTV A;  4BT9 A;  2WQ6 A;  5G04 J;  1XGW A;  1K8K G;  3ASN E;  2XQ0 A;  4HNA D;  5J08 A;  4U0S A;  3FUM A;  4LG6 A;  5CEC B;  5KWD A;  3EHQ A;  3IHY A;  2IFU A;  2ZXW E;  2HM8 A;  2J09 A;  3ENE A;  3TWW A;  4Q69 A;  5G05 J;  3ZGQ A;  3R7Q A;  3CQG B;  3ESK A;  3CVW A;  4F3V A;  1ZB1 A;  1D8D A;  3PH0 C;  1IQU A;  5G55 A;  4BTB A;  4GAA A;  1UN9 A;  4Y6W A;  3APD A;  1JUQ A;  4DI3 A;  1N4P A;  5FQ8 A;  3EHN A;  3G2T A;  4Z68 A;  1BPO A;  3RKV A;  2Q7F A;  1JCR A;  3HYM B;  4A63 B;  3FH5 A;  2XPZ A;  1HZ4 A;  5HQ8 A;  1WAO 1;  4ATG A;  3LPZ A;  2EIL E;  3IKO B;  3MEK A;  1LTX A;  4O60 A;  2IF4 A;  4L2Y A;  3FTY A;  2JAB A;  4MKT A;  3TWR A;  4G26 A;  3GW4 A;  2C0L A;  1IXV A;  4U95 D;  3DPD A;  2DWZ A;  2OOE A;  1QYM A;  1Z5S C;  3G2S A;  5HKP A;  4HOR A;  3AU5 A;  2J4B A;  3CEQ A;  3ULQ A;  1DC2 A;  4BSZ B;  2QY7 A;  5AAR A;  3ZEF A;  5HS0 A;  2Y4U A;  3FWV A;  5E75 A;  3CGH A;  3L9T A;  1LD7 A;  4JA9 A;  1BLX B;  4P29 A;  3HXB A;  4DX2 A;  2OVB A;  3X2Q E;  1D9S A;  4WWP A;  1N9A A;  1HE8 A;  4GZD A;  5AJD A;  3ZU7 B;  2V5Q C;  1QNF A;  5CRU A;  3V31 A;  4GPM A;  2X38 A;  4HLE A;  5ENS D;  3MKQ B;  2YNQ A;  3APF A;  5ENQ D;  3HXF A;  2ZU6 B;  4U8Y D;  2P9N G;  4WWN A;  1K1A A;  1E7V A;  2CG3 A;  3PE4 A;  3V2X A;  1U2V G;  3ZNG A;  2MRI A;  2GRM A;  2Y3A A;  4YDO A;  2AXV A;  4J0U A;  4GA0 A;  5EIB E;  4I6E A;  1HFA A;  3AU4 A;  2GRO B;  3QWW A;  5ENP D;  4KVO A;  4JL0 A;  1OCO E;  4G23 A;  1A17 A;  4U0Z A;  3QNK A;  3HXE A;  1DVP A;  5JJ7 A;  5FIO A;  1H6K A;  3EU9 A;  4F53 A;  4ANU A;  4DLQ A;  4KMO A;  2VSN A;  4EZJ A;  3CSF A;  4U07 A;  2VGX B;  3CK8 A;  3LDZ A;  4TUM A;  2QYU A;  4AY5 A;  4EPZ A;  3P2B A;  3RRU A;  2QC9 A;  1Y6I A;  1OCZ E;  3TWU A;  4JB8 P;  2X6F A;  4PS7 A;  1U3C A;  3Q75 A;  5AAO A;  5BPP A;  3AG3 E;  2IO3 C;  4BX8 A;  1IQR A;  5BXU A;  2WXG A;  2A5U A;  3QOU A;  3G2W A;  3LVQ E;  5HRY A;  3E32 A;  3VTY A;  4DRX E;  5EN5 D;  4CT0 A;  3WXX A;  4A3V A;  4YVQ C;  3QAQ A;  2OEV A;  3FP3 A;  5D66 A;  4HFG A;  3OXG A;  3KEZ A;  3F6Q A;  2J4D A;  4I2W A;  3ASD A;  4TXR A;  1EDU A;  2P9L G;  2H6I A;  2DBA A;  4G2V A;  1W3B A;  3KAE A;  3FDH A;  3EHM A;  4FP7 A;  3CVV A;  4HQD A;  4F1P A;  3UMV A;  2XPY A;  4LER A;  4X8Q A;  2GRN B;  5EKQ D;  3J5P A;  1OWM A;  3SBS A;  3PE3 A;  2WM9 A;  4RSY A;  3SQV A;  3SO8 A;  3DPY A;  4CYM D;  4ABN A;  4TRQ A;  3SNX A;  3LYA A;  4J7W A;  1OY3 D;  3BG0 B;  2DCP A;  1HH8 A;  4MS6 A;  1MHQ A;  2LSV A;  4GML A;  2RD0 A;  5EYP F;  4DLO A;  4KYO B;  3D9H A;  2P9K G;  3EUV A;  1Q2Z A;  1V55 E;  1H6P A;  2X3M A;  3CVU A;  2PQN A;  4FLH A;  3MX3 A;  1E8X A;  3DSV A;  3DBS A;  3T5X A;  3SHF A;  1Z6T A;  3APC A;  4KVM A;  4GTP A;  3ULY A;  5KNG A;  3FUL A;  2LUH A;  5A23 A;  2WPV A;  1YA0 A;  4YVO A;  3RAU A;  1OWL A;  5BV0 A;  3LJN A;  4QFV A;  5CBO A;  2VTB B;  3ULE G;  2EIM E;  3B7R L;  2CHX A;  3IBE A;  1B89 A;  3PEU B;  1P5Q A;  3ZHE A;  1MJ0 A;  4ILH B;  4Y6C A;  2KBX A;  3LY9 A;  4OYS A;  2B0O E;  1GW6 A;  2XRY A;  3V79 K;  4HI9 A;  3CVX A;  2YQ8 A;  4PH4 B;  5G04 C;  3L82 A;  5FJY A;  2VSO E;  2YHE A;  3NB2 A;  3I4G A;  2F0Y A;  4Q96 A;  3QWV A;  4C9B B;  5DIZ A;  3ZXS A;  2IOL A;  1L5J A;  4CRW A;  1OWO A;  5FIN A;  4XX5 A;  4L23 A;  2RG8 A;  4EBA G;  3E30 A;  4K03 A;  2F37 A;  5G05 C;  2XZD G;  1ZBP A;  3RIB A;  2L9B A;  5EX3 A;  2XEV A;  3B95 A;  2DYS E;  2X6K A;  3TAX A;  3FUN A;  3UIP C;  1IHB A;  3GYZ A;  1SQM A;  4BY6 A;  2J08 A;  1X5B A;  2GRQ B;  4A55 A;  3Q49 B;  2PQR A;  4GMR A;  4GTQ A;  2RKK A;  3FTS A;  4DPR A;  1N4S A;  4IUL A;  2WVI A;  1N4Q A;  2EIN E;  4I17 A;  4N2Q A;  3GZS A;  5FZS A;  2FBN A;  2WXI A;  3SI5 A;  2NXP A;  4JXT A;  3TXM A;  5ARG A;  4RVB A;  4IRU A;  4TXP A;  3CIA A;  2PL2 A;  4LUN U;  5LX8 A;  3FHE A;  3PDN A;  4EZK A;  2WXL A;  3E37 A;  2BKG A;  2BF0 X;  4HRL A;  2VSY A;  1S64 A;  1HX8 A;  4NQ0 A;  5KJL A;  1LD8 A;  4JA7 A;  1Y8M A;  3MA5 A;  3ZYL A;  4GTO A;  2L0I A;  2VSX E;  2C0M A;  2P9P G;  4LNB A;  2QYJ A;  3UKU G;  4L1B A;  2L0T B;  3FUD A;  4U8H A;  4TUU A;  4ILG A;  2E0I A;  2VGY A;  4WAF A;  4J6I A;  1EPU A;  4K5A B;  5G2N A;  4N3C A;  2DVW A;  3Q78 A;  3L16 A;  1QQE A;  2WXN A;  5LCW C;  2XGM A;  3WG7 E;  2LO6 A;  4UI9 C;  2X6I A;  2GRR B;  4BSX A;  3DWL G;  2ION A;  3R9A B;  1OWP A;  1Z3X A;  5JHA A;  2M63 A;  3P1U A;  3RO2 A;  3FH8 A;  3KD7 A;  2R03 A;  4FLB A;  1SA5 A;  2KZT B;  4GZ3 A;  4IYP A;  5EIL A;  1TNY A;  4AXH A;  3C72 A;  1N54 A;  4GZ5 A;  2EIJ E;  2WXO A;  3TWS A;  4BX9 A;  2Y1L E;  5JHB A;  2I1J A;  2XEN A;  2PM6 A;  3KSQ A;  4OVU A;  1NFI E;  2QZA A;  3L22 A;  4I1O B;  4BT8 A;  5CBN A;  4I1A A;  3Q47 B;  2XZT G;  4MLP A;  1V54 E;  2V4H C;  1MX6 A;  1RW2 A;  3TL5 A;  4WND A;  2AVP A;  4N39 A;  5LFA A;  2WXQ A;  1SW6 A;  3TWQ A;  3DSW A;  3UIO C;  5CMY A;  1XNF A;  2MYO A;  1BD8 A;  3CVP A;  4V3I A;  4CDM A;  2CHZ A;  4F7A A;  2R59 A;  4L9P A;  2I1K A;  4M3O A;  3UM2 A;  4HLL A;  4BES A;  3PNT B;  2DZN A;  3OTN A;  1HG5 A;  1WY6 A;  3G2U A;  3RK6 A;  2RFM A;  1SVX A;  2IO2 C;  3O48 A;  1WDY A;  4OAU C;  4GCO A;  4URK A;  3Q5M A;  3NAW A;  4RG6 A;  3AG1 E;  1HS6 A;  4PS3 A;  2J07 A;  3PUJ A;  1LF8 A;  4ANW A;  2Y0B G;  3SGH A;  3I5P A;  1N11 A;  2WXR A;  5FT9 A;  4XKB A;  3UT7 A;  3JXI A;  3Q4A B;  4A3T A;  5AJL A;  1NZN A;  5LCW J;  3MGB A;  4RQI A;  2WQH A;  4KZ0 A;  3FTW A;  4NUR A;  3FUF A;  1HF8 A;  4JHR A;  4UI9 J;  4DUI A;  3T8M A;  1MQS A;  3UX4 A;  4BFR A;  4TV3 A;  4J8D A;  1TJF A;  1A5E A;  1OUV A;  5C1D A;  1TR4 A;  3UM3 A;  4ACL A;  3AG4 E;  3ASO E;  3OXF A;  5FQ7 A;  2L6B A;  2WMN A;  3HXC A;  4GTR A;  2J9Q A;  3C98 A;  3NF1 A;  2KCV A;  4OAV B;  2PM7 A;  3B13 A;  3E4B A;  4UWH A;  3LVR E;  2J8S D;  3ZW3 A;  1TJC A;  5B3S E;  4UWL A;  5AQ9 A;  2XPI A;  5ENR D;  3DXM G;  3Q9U C;  2R05 A;  3CHM A;  2B6C A;  2LAI A;  4LNU D;  2R5S A;  1JCS A;  4UI9 K;  2XCB A;  5FTP A;  5M72 A;  2MOW A;  2FO7 A;  2AXZ A;  2AJA A;  1K3Z D;  3PUK A;  3MKQ A;  3S7D A;  3ML9 A;  4GPK A;  1EYH A;  5BV1 A;  3KEA A;  3C5R A;  3PEV B;  1WG0 A;  3FTZ A;  1UJK A;  2GRP B;  3L54 A;  3Q79 A;  4RG9 A;  3GZ2 A;  2CG2 A;  3ONK A;  4U96 D;  4LRZ A;  3LY7 A;  3S7J A;  1ELK A;  5KJM A;  2HE0 A;  4I9E A;  3S2A A;  3C3Q A;  2DZO A;  3HRA A;  2KAT A;  1UJJ A;  2KXP C;  2FUL A;  3T9K A;  3FEX A;  4DX6 D;  3UQ3 A;  1SA4 A;  4AP2 A;  2ZIR A;  1ELW A;  4OVV A;  3EJN A;  1RZ4 A;  5H7P A;  1JWF A;  2FI7 A;  3BU8 A;  3SFX A;  5EYL A;  4JC8 A;  1FVH A;  3CVN A;  1IYG A;  3QDN A;  3G2V A;  3PVL A;  2VGX A;  1TNO A;  3CVQ A;  4FU3 A;  4GTT A;  3VLD A;  1VDY A;  4HXI A;  5FZR A;  2BTD A;  3HIZ A;  5B1B E;  1MZC A;  2WQ7 A;  3T5V A;  3DRA A;  2X6H A;  5FQ6 A;  3ZXP A;  4N5C A;  1Z3Y A;  1KT1 A;  5KCM A;  1NL4 A;  5BNW A;  3EU5 A;  4C0E A;  5J90 A;  2YHC A;  4CDR A;  3HVE B;  3NZS A;  5E76 A;  4G8K A;  1KT0 A;  2V4L A;  2WXP A;  5LP0 A;  4R7L A;  3BQO A;  3SFZ A;  4LEU A;  2A4Z A;  3FU5 A;  2ZGG A;  4WUY A;  2XRZ A;  1X81 A;  4DX5 D;  4I2Z A;  2AWI A;  1S63 A;  2IOS A;  2BED A;  2BKK B;  4Q94 A;  1E8Y A;  1TNU A;  3C3O A;  3UIN C;  3ZYQ A;  3E34 A;  4JD2 G;  3HHM A;  3MKR A;  3LEW A;  4JEU A;  2I9C A;  5D2M C;  2MHK A;  2WXM A;  2L6J A;  2JEK A;  4WNG A;  3FUJ A;  1PAQ A;  4WNF A;  3ML8 A;  1D8E A;  3CV0 A;  3JCK C;  3ABK E;  5ANR A;  3PZ2 A;  3B7U X;  2WXF A;  3L17 A;  3D9N A;  3OAW A;  2UY1 B;  4GYY A;  1MX2 A;  1H2U A;  2KCL A;  1TYQ G;  2P9S G;  5ANL A;  1IHG A;  4EBA A;  4W9R A;  4GTS A;  3MYV A;  4O6F A;  5KBA A;  5ENO D;  3PS6 A;  2R2L A;  4B93 B;  3AJI A;  4KZC A;  2ILR A;  3B7B A;  3DST A;  3PZ1 A;  3JUI A;  3UT8 A;  4BER A;  4AM9 A;  3MZL B;  4GA1 A;  5EX0 A;  4ANV A;  3R7R A;  4F6R D;  3L13 A;  1KPS B;  4B8A A;  4K5B A;  3NBN B;  4APF A;  2HO1 A;  5KNH D;  2V0P A;  3ABL E;  3DXK G;  4ILI A;  2DYR E;  1S70 B;  3JQ0 A;  3RJV A;  5HI7 A;  4UQX A;  3UTM A;  1HO8 A;  3LKU A;  3SY2 A;  3ASF A;  3UM1 A;  4A1S A;  2P9U G;  2VTB A;  1O1R A;  4JPS A;  5D0O D;  2ETB A;  3PRE A;  4WWO A;  4O1P A;  2WXK A;  5ITZ F;  3J5Q B;  3DSX A;  3FEY A;  1UW4 B;  5JJT A;  5FWQ A;  5A6C A;  3FUH A;  4AJW A;  4C0M A;  4G1T A;  1JWG A;  3FU6 A;  2R17 C;  5BUZ A;  3TXN A;  3I3N A;  2FF4 A;  5ENT D;  4CT4 A;  1K1B A;  5CEA A;  5AEN A;  4HS2 A;  4K0R A;  4EZL A;  4XEI G;  4MBG A;  4GCN A;  1N94 A;  2GGF A;  4CDN A;  3RU0 A;  2PZI A;  3JYS A;  1E96 B;  4B94 A;  4AEZ C;  1H0A A;  3FFL A;  3U64 A;  5AQ7 A;  3DSS A;  4PS8 A;  2R02 A;  5FZQ A;  4TXQ A;  3AS5 A;  4FUL A;  1TN6 A;  3B7S A;  4O1O A;  3VTX A;  1DCE A;  5T3R A;  2F8X K;  3FTX A;  4GTM A;  4HRN A;  2HR2 A;  4BWR A;  5AN8 A;  4HB5 A;  1O1S A;  4UWK A;  3JQ1 A;  4ME2 A;  1TN8 A;  3ABM E;  2H6F A;  3BEE A;  2X6J A;  4AOF A;  5AQB A;  2IEJ A;  4D10 C;  1O5M A;  1WM5 A;  1DCQ A;  4UWG A;  3TWX A;  3Q7F A;  1ZU2 A;  3NQP A;  4GZ6 A;  2LAH A;  5EID A;  4CGV A;  4QQI A;  5ENN A;  3NOG D;  5CCL A;  3D9O A;  4E85 A;  1QZ2 A;  3TGO A;  3C3R A;  3W9F A;  2OEW A;  3UPV A;  2XHE A;  5T4Y A;  3U66 A;  4ACK A;  2RFA A;  4CZ2 D;  2BUG A;  4UUC A;  4N3A A;  2P2C P;  4J8S A;  1O1T A;  3T8K A;  3QB2 A;  1DNP A;  4NIK A;  4GZC A;  2GRL A;  4JW1 A;  3CVY A;  4L2L A;  4ATZ D;  3PRZ A;  4YDE A;  4HOT A;  2IY0 C;  2QFC A;  5ARF A;  4G24 A;  3CK7 A;  2IU1 A;  2Y69 E;  3KSL A;  3JXJ A;  4AVX A;  4ZHB A;  2ZGD A;  4HBD A;  3ASH A;  4AIF A;  4NAC A;  5IY5 E;  1ELR A;  3SZ7 A;  2EIK E;  3FH7 A;  4LSZ E;  5CMW A;  4YDW A;  3UKR G;  1OT8 A;  1TN7 A;  4JHK A;  1MX4 A;  4F1S A;  3LS8 A;  1YMP A;  1U3D A;  3AG2 E;  2YIN A;  3AAA C;  4B89 A;  3D3M A;  2WB2 A;  3QKY A;  3N71 A;  3FUI A;  2OCC E;  4G8L A;  2LXM A;  4JZY A;  5BW8 C;  3RRN B;  1N0R A;  4E6H A;  2KZT A;  2FO1 E;  2CFZ A;  3DSU A;  4U8V D;  4HI8 A;  5D0Q D;  3UI2 A;  3VLE A;  2CHW A;  3LCA A;  1FVF A;  3EIJ A;  1NI1 A;  5AIJ A;  2IQC A;  2PNN A;  4FHJ A;  4I1M A;  3V30 A;  4CCA A;  1OWN A;  3SD5 A;  2I2O A;  2ZIS A;  3CR3 A;  1H2V C;  2C2L A;  1E7U A;  3HDX A;  1E8Z A;  4NRH B;  2ETA A;  4GMJ A;  2XS1 A;  1KLX A;  4APO A;  3PZD A;  3UXG A;  3CHO A;  3E33 A;  4HOQ A;  2AXU A;  5KJN A;  3CKC A;  3ZYM A;  3U9W A;  5JMN D;  3CVL A;  3CLJ A;  1PC2 A;  5C2Y A;  3Q73 A;  1FCH A;  2KC7 A;  4FA6 A;  4RLY A;  3K9I A;  4UQZ A;  3RO3 A;  2FEZ A;  4UQY A;  2ETC A;  3D9L A;  1UN8 A;  3LY8 A;  4CEM A;  4DK5 A;  3ISM C;  3NZU A;  3FUK A;  4PDX A;  2VGE A;  5T8I A;  3D9M A;  1KZO A;  3CQC B;  3TJP A;  3GZ1 A;  2OV8 A;  1E90 A;  5BT1 A;  2KCK A;  3MCX A;  3ZKJ A;  2P58 C;  1PY1 A;  1FT1 A;  3BUA A;  3TG5 A;  3FY4 A;  4EHM A;  1JCQ A;  3ZRH A;  3S7F A;  1UOH A;  3QAR A;  4JEH A;  4LCT A;  3PZ3 A;  1SZA A;  3TWV A;  1INZ A;  4J8F A;  1N52 A;  3DEP A;  3AS4 A;  1UG3 A;  4XI9 A;  4YDY A;  1OCC E;  3QC1 A;  1OCR E;  3R9M A;  5A7D B;  1JPL A;  3IV0 A;  3CHQ A;  1TNZ A;  4DX1 A;  4HRM B;  4UWF A;  2UWJ G;  4H7Y A;  3MJW A;  1HU3 A;  3TWT A;  2P9I G;  1SZ9 A;  5DBK A;  2F8Y A;  1MYO A;  3ZHE B;  1KZP A;  4I43 A;  1N4R A;  4WNE A;  1H6O A;  1BI7 B;  5JA4 D;  5LOZ A;  4N2S A;  2NC9 A;  3LJ3 A;  4GU5 A;  4BET A;  3EIQ C;  3HG0 D;  5FQ4 A;  4U7E B;  3ZFW A;  3IXE A;  4C48 B;  2XCC A;  4I9C A;  2XEE A;  2KM4 A;  3HXD A;  5B1A E;  1H2T C;  2OND A;  1E8W A;  3ZYK A;  5BXO A;  3SBT B;  4KBQ A;  2LNI A;  2WMO A;  3PZ4 A;  4GYO A;  1OXJ A;  5CRV A;  4FC8 A;  4N3B A;  4I6G A;  3QK0 A;  3U3W A;  2EQX A;  4FHK A;  3D9P A;  4DI4 A;  2OVF A;  1YCS B;  2VQ2 A;  4HVB A;  3W9G A;  4HOU A;  1H19 A;  2H6H A;  3FTU A;  3JUE A;  1FPP A;  3NOC D;  4B8C B;  2LXL A;  4HOS A;  2DIW A;  3V2O A;  4JVS A;  4ANX A;  4XZ4 A;  1NA3 A;  3RSE G;  4XKC A;  2I6H A;  1N0Q A;  4H7X A;  3URZ A;  1HG2 A;  4XI0 A;  2IJG X;  3D9I A;  4GYW A;  4YND A;  3TG4 A;  3ZIM A;  1EF1 C;  3IEG A;  3L6A A;  2XGO A;  2XGS A;  1AWC B;  3SF4 A;  3CHS A;  4K5C A;  3B7T A;  4ZFH A;  4L7T A;  2GW1 A;  2JLB A;  3KS2 A;  3L08 A;  3CKB A;  3BG1 B;  4A1G A;  3ZUV B;  2WXJ A;  3RRM B;  3EHR A;  4KT6 B;  5KJK A;  4U04 A;  4BTA A;  3AS8 A;  4M7C A;  4GTV A;  2J49 A;  3IHV A;  4EEC A; 
#chains in the Genus database with same CATH homology
 3FUF A;  4ME2 A;  1HF8 A;  4FP7 A;  4JHR A;  4MRU A;  4UI9 J;  4IN3 B;  2E2E A;  3ONL A;  3CVV A;  3FU0 A;  4G11 A;  3BEE A;  3S7B A;  4CGW A;  2X6J A;  3UMV A;  3T8M A;  4AOF A;  2XPY A;  3CST A;  1MQS A;  3QWP A;  4LER A;  3UX4 A;  4BFR A;  4D10 C;  4TV3 A;  4J8D A;  1TJF A;  2VYI A;  1WM5 A;  4UWG A;  1OUV A;  5C1D A;  3HVE A;  1ZU2 A;  3NQP A;  3VLF A;  4GZ6 A;  4ACL A;  2LAH A;  5EKQ D;  3MV3 B;  4CGV A;  5ENN A;  3D9K A;  1OWM A;  3OXF A;  5FQ7 A;  3CK9 A;  3SBS A;  5CCL A;  2WMN A;  3UUX A;  3PE3 A;  3CHR A;  5AYW D;  2J9Q A;  3D9O A;  2WM9 A;  4RSY A;  2LSU A;  3C98 A;  4U0U A;  4E85 A;  1QZ2 A;  2KCV A;  3NF1 A;  3TGO A;  2PM7 A;  2NSZ A;  3UPV A;  2XHE A;  5T4Y A;  3B13 A;  4ABN A;  3E4B A;  4UWH A;  3U66 A;  3ASG A;  4GA2 A;  4TRQ A;  4ACK A;  4DJA A;  3SNX A;  3LYA A;  4XE0 A;  2V8S E;  3BG0 B;  3LVR E;  2V5F A;  2DCP A;  1HH8 A;  4J8E A;  1S0P A;  2BUG A;  3ZW3 A;  4EQF A;  3PNL B;  4MS6 A;  1TJC A;  4N3A A;  4FAD A;  1MHQ A;  2LSV A;  4GML A;  3ZVV A;  4J8S A;  2RD0 A;  4FJZ A;  4DLO A;  3ESL A;  4KYO B;  5JJ6 A;  4UWL A;  1NP7 A;  3UT4 A;  3ZPJ A;  1NA0 A;  3OXL A;  2XPI A;  3QB2 A;  1DNP A;  3LXU X;  2HYZ A;  4GZC A;  2GRL A;  2CFU A;  3CHM A;  4U63 A;  2X3M A;  3CVU A;  2PQN A;  4JW1 A;  4XIF A;  5CCM A;  2LAI A;  4FLH A;  4L2L A;  3MX3 A;  3PRZ A;  4FJY A;  2R5S A;  4PUC A;  3CVY A;  4HOT A;  1E8X A;  4UI9 K;  1HXI A;  2XCB A;  3Q15 A;  5FTP A;  2QFC A;  5M72 A;  2MOW A;  3DBS A;  2FO7 A;  2AXZ A;  5ARF A;  4G24 A;  3T5X A;  3CK7 A;  2IU1 A;  3PUK A;  3MKQ A;  3S7D A;  3ML9 A;  4AVX A;  3CHP A;  1EYH A;  3SHF A;  5BV1 A;  4GPK A;  1Z6T A;  3U4T A;  3D9J A;  3APC A;  4KVM A;  2UY1 A;  3ASH A;  3PEV B;  3QJZ A;  3FTZ A;  4AIF A;  4NAC A;  3FUL A;  5A23 A;  2WPV A;  1ELR A;  1YA0 A;  1UJK A;  4GB9 A;  1OWL A;  4YVO A;  3FU3 A;  3SZ7 A;  3FH7 A;  3L54 A;  5CMW A;  4RG9 A;  3GZ2 A;  2CG2 A;  4JHK A;  5BV0 A;  5EDS A;  3ONK A;  4QFV A;  2AW6 A;  1TEZ A;  2VTB B;  3FUE A;  4G25 A;  4B0Z A;  4LRZ A;  3LY7 A;  5CHE E;  1ELK A;  3S7J A;  4F1S A;  3B7R L;  5KJM A;  4I6J A;  2CHX A;  3LS8 A;  2VJ8 A;  1B89 A;  3IBE A;  3PEU B;  4KXK B;  1P5Q A;  3ZHE A;  1U3D A;  4AY6 A;  2Y4T A;  4I9E A;  2YIN A;  3S2A A;  4EEC A;  4JHJ A;  4B89 A;  4ILH B;  3D3M A;  2WB2 A;  3QKY A;  4Y6C A;  3EDT B;  4AV7 A;  3ZN3 A;  3LY9 A;  3I4R B;  4OYS A;  3N71 A;  2KAT A;  3FUI A;  3MV2 B;  1GW6 A;  2WXH A;  2XRY A;  4JZY A;  3O4Z A;  1UJJ A;  3CVX A;  2YQ8 A;  4PH4 B;  5G04 C;  5BW8 C;  3FTV A;  4BT9 A;  2WQ6 A;  5G04 J;  1XGW A;  2FUL A;  3RRN B;  5FJY A;  2XQ0 A;  3FEX A;  4E6H A;  2KZT A;  2VSO E;  2YHE A;  5J08 A;  3UQ3 A;  2CFZ A;  3FUM A;  4U0S A;  3I4G A;  4Q96 A;  4AP2 A;  3QWV A;  4C9B B;  5DIZ A;  3ZXS A;  2IOL A;  3IHY A;  1L5J A;  4CRW A;  5D0Q D;  1ELW A;  4OVV A;  1OWO A;  3EJN A;  4XX5 A;  4L23 A;  3VLE A;  1JWF A;  2CHW A;  2FI7 A;  2RG8 A;  3LCA A;  1FVF A;  3EIJ A;  4JC8 A;  1FVH A;  4EBA G;  2IFU A;  3CVN A;  4K03 A;  1IYG A;  2HM8 A;  2J09 A;  3ENE A;  5G05 C;  3QDN A;  3G2V A;  4Q69 A;  5G05 J;  3PVL A;  3ZGQ A;  3R7Q A;  2IQC A;  2VGX A;  3CQG B;  1ZBP A;  3ESK A;  5AIJ A;  3RIB A;  4FHJ A;  4F3V A;  3CVW A;  2L9B A;  4I1M A;  5EX3 A;  2XEV A;  3PH0 C;  1IQU A;  5G55 A;  4BTB A;  4CCA A;  3CVQ A;  1OWN A;  3SD5 A;  4GAA A;  4FU3 A;  2I2O A;  3VLD A;  1UN9 A;  4Y6W A;  1VDY A;  3CR3 A;  1H2V C;  1JUQ A;  2C2L A;  2X6K A;  3APD A;  1E7U A;  3HDX A;  5FQ8 A;  4HXI A;  3TAX A;  4DI3 A;  3EHN A;  3FUN A;  3GYZ A;  5FZR A;  1SQM A;  3G2T A;  4BY6 A;  1E8Z A;  2J08 A;  1X5B A;  2BTD A;  4NRH B;  3HIZ A;  4A55 A;  3Q49 B;  4GMJ A;  2PQR A;  1BPO A;  3RKV A;  2WQ7 A;  3T5V A;  2Q7F A;  1KLX A;  4APO A;  2X6H A;  3PZD A;  3HYM B;  5FQ6 A;  3FH5 A;  2XPZ A;  3CHO A;  3FTS A;  4DPR A;  4HOQ A;  1HZ4 A;  2AXU A;  5KJN A;  5HQ8 A;  4N5C A;  1WAO 1;  3CKC A;  3ZYM A;  1Z3Y A;  1KT1 A;  2WVI A;  4IUL A;  5KCM A;  3U9W A;  4ATG A;  3CVL A;  3LPZ A;  3CLJ A;  3IKO B;  1PC2 A;  3MEK A;  4I17 A;  5C2Y A;  4N2Q A;  3GZS A;  1FCH A;  2IF4 A;  2KC7 A;  5BNW A;  3JQ1 A;  4L2Y A;  5FZS A;  2FBN A;  3FTY A;  2WXI A;  4C0E A;  3SI5 A;  2NXP A;  4FA6 A;  5J90 A;  2YHC A;  3K9I A;  4JXT A;  4MKT A;  5ARG A;  4G26 A;  3GW4 A;  4UQZ A;  2C0L A;  3TXM A;  4CDR A;  4RVB A;  3RO3 A;  3HVE B;  3NZS A;  5E76 A;  3DPD A;  4IRU A;  2FEZ A;  3CIA A;  2OOE A;  2PL2 A;  4LUN U;  4UQY A;  5LX8 A;  3FHE A;  1KT0 A;  3D9L A;  3G2S A;  3PDN A;  1UN8 A;  3LY8 A;  3AU5 A;  4EZK A;  4CEM A;  2V4L A;  2J4B A;  3CEQ A;  3ULQ A;  2WXL A;  2WXP A;  4R7L A;  3NZU A;  3FUK A;  4DK5 A;  3SFZ A;  5LP0 A;  4PDX A;  2BF0 X;  4LEU A;  5T8I A;  3D9M A;  3CQC B;  2QY7 A;  2A4Z A;  3FU5 A;  2VSY A;  3TJP A;  3ZEF A;  4WUY A;  2Y4U A;  3GZ1 A;  3FWV A;  5E75 A;  2XRZ A;  2OV8 A;  1E90 A;  1HX8 A;  3CGH A;  4NQ0 A;  5BT1 A;  5KJL A;  2KCK A;  3MCX A;  4JA7 A;  4I2Z A;  2AWI A;  1Y8M A;  3MA5 A;  2P58 C;  3ZYL A;  1PY1 A;  2IOS A;  3TG5 A;  3FY4 A;  4Q94 A;  2L0I A;  4JA9 A;  1E8Y A;  4P29 A;  3ZRH A;  3ZYQ A;  2VSX E;  2OVB A;  4HOR A;  3HHM A;  3MKR A;  3S7F A;  3LEW A;  4WWP A;  2C0M A;  3QAR A;  4JEU A;  2I9C A;  4JEH A;  4LCT A;  1HE8 A;  1SZA A;  2MHK A;  2WXM A;  4GZD A;  5AJD A;  1INZ A;  4J8F A;  2L6J A;  2JEK A;  1N52 A;  3FUJ A;  4L1B A;  4WNG A;  1PAQ A;  1QNF A;  2L0T B;  3AS4 A;  1UG3 A;  4WNF A;  4XI9 A;  3FUD A;  3ML8 A;  3CV0 A;  3QC1 A;  4U8H A;  5A7D B;  4TUU A;  4ILG A;  3JCK C;  2X38 A;  4HLE A;  5ANR A;  1JPL A;  3B7U X;  2E0I A;  2WXF A;  3L17 A;  3MKQ B;  2YNQ A;  3APF A;  2VGY A;  3IV0 A;  3D9N A;  3OAW A;  3CHQ A;  2UY1 B;  4GYY A;  4WAF A;  1H2U A;  2ZU6 B;  4J6I A;  2KCL A;  1EPU A;  1IHG A;  5ANL A;  4UWF A;  5G2N A;  4EBA A;  2UWJ G;  4W9R A;  4N3C A;  3KAE A;  4WWN A;  4H7Y A;  3MYV A;  3MJW A;  4O6F A;  1E7V A;  1HU3 A;  3PS6 A;  1SZ9 A;  2CG3 A;  3L16 A;  3PE4 A;  5DBK A;  1QQE A;  4KZC A;  2MRI A;  2GRM A;  2ILR A;  2Y3A A;  3ZHE B;  4I43 A;  2WXN A;  5LCW C;  3JUI A;  3UT8 A;  2AXV A;  2XGM A;  4WNE A;  4AM9 A;  4J0U A;  3MZL B;  2LO6 A;  4GA1 A;  4UI9 C;  2X6I A;  5EX0 A;  4BSX A;  4ANV A;  3R7R A;  4GA0 A;  2ION A;  3R9A B;  1OWP A;  4I6E A;  1Z3X A;  5JHA A;  1HFA A;  3AU4 A;  5LOZ A;  4N2S A;  2NC9 A;  2M63 A;  3P1U A;  3QWW A;  3LJ3 A;  4GU5 A;  3FH8 A;  3KD7 A;  3L13 A;  3RO2 A;  4B8A A;  4FLB A;  4KVO A;  4APF A;  4JL0 A;  2HO1 A;  2V0P A;  2KZT B;  4GZ3 A;  4G23 A;  3IHV A;  3EIQ C;  4IYP A;  1A17 A;  4U0Z A;  5FQ4 A;  4ILI A;  3ZFW A;  3JQ0 A;  3RJV A;  2XCC A;  3QNK A;  4I9C A;  2KM4 A;  4AXH A;  1DVP A;  5JJ7 A;  1N54 A;  1H2T C;  1H6K A;  2OND A;  5HI7 A;  4UQX A;  1E8W A;  3ZYK A;  4F53 A;  1HO8 A;  3LKU A;  4GZ5 A;  4ANU A;  4DLQ A;  4KMO A;  2WXO A;  3ASF A;  2VSN A;  4BX9 A;  3SBT B;  4EZJ A;  4A1S A;  3CSF A;  4U07 A;  4KBQ A;  5JHB A;  2VGX B;  2LNI A;  2I1J A;  3CK8 A;  2PM6 A;  2VTB A;  4JPS A;  5D0O D;  3LDZ A;  2WMO A;  3PRE A;  4OVU A;  4WWO A;  3L22 A;  4GYO A;  4AY5 A;  2WXK A;  4I1O B;  4EPZ A;  4FC8 A;  3P2B A;  4BT8 A;  4N3B A;  4I6G A;  3QK0 A;  3U3W A;  2EQX A;  4I1A A;  3Q47 B;  4FHK A;  1Y6I A;  3RRU A;  3FEY A;  4MLP A;  3D9P A;  1UW4 B;  2OVF A;  2X6F A;  1U3C A;  2VQ2 A;  4PS7 A;  5FWQ A;  4DI4 A;  3TL5 A;  4HVB A;  5BPP A;  5A6C A;  3FUH A;  4HOU A;  4WND A;  2AVP A;  4N39 A;  1H19 A;  4AJW A;  4BX8 A;  5LFA A;  3FTU A;  4C0M A;  2WXQ A;  4G1T A;  1IQR A;  4B8C B;  1JWG A;  2WXG A;  3FU6 A;  4HOS A;  2A5U A;  2DIW A;  2R17 C;  3QOU A;  5CMY A;  1XNF A;  5BUZ A;  3TXN A;  4JVS A;  3CVP A;  2FF4 A;  3G2W A;  3I3N A;  4V3I A;  4ANX A;  4XZ4 A;  4CDM A;  5JJT A;  1NA3 A;  2CHZ A;  4CT4 A;  4XKC A;  2I6H A;  2R59 A;  4F7A A;  2I1K A;  4M3O A;  4H7X A;  3URZ A;  5AEN A;  3LVQ E;  4HS2 A;  1HG2 A;  4K0R A;  4XI0 A;  2IJG X;  3VTY A;  4EZL A;  3D9I A;  3PNT B;  3OTN A;  4GYW A;  4YND A;  1HG5 A;  4CT0 A;  3WXX A;  1WY6 A;  3TG4 A;  3G2U A;  3ZIM A;  1EF1 C;  3IEG A;  4GCN A;  2GGF A;  3RK6 A;  4A3V A;  4YVQ C;  3L6A A;  4CDN A;  2XGO A;  2XGS A;  3QAQ A;  3RU0 A;  3SF4 A;  3CHS A;  3FP3 A;  3O48 A;  2PZI A;  3JYS A;  1E96 B;  4HFG A;  4GCO A;  4URK A;  3B7T A;  4B94 A;  3Q5M A;  4AEZ C;  4RG6 A;  3OXG A;  4L7T A;  1HS6 A;  2GW1 A;  1H0A A;  2JLB A;  3FFL A;  3KEZ A;  2J07 A;  3KS2 A;  4PS3 A;  3U64 A;  3PUJ A;  3L08 A;  3CKB A;  3BG1 B;  4PS8 A;  1LF8 A;  5FZQ A;  4A1G A;  2J4D A;  3AS5 A;  4FUL A;  3B7S A;  4ANW A;  4I2W A;  3VTX A;  3SGH A;  2WXJ A;  3RRM B;  3I5P A;  2WXR A;  5FT9 A;  3ASD A;  4XKB A;  3UT7 A;  5T3R A;  4KT6 B;  1EDU A;  5KJK A;  3Q4A B;  4U04 A;  4A3T A;  3FTX A;  5AJL A;  1NZN A;  2DBA A;  3AS8 A;  4BTA A;  4G2V A;  1W3B A;  2HR2 A;  4BWR A;  5LCW J;  3MGB A;  2J49 A;  4UWK A;  2WQH A;  4KZ0 A;  3FTW A;  4NUR A;  3FDH A;  3EHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...