2KCVA

Solution nmr structure of tetratricopeptide repeat domain protein sru_0103 from salinibacter ruber, northeast structural genomics consortium (nesg) target srr115c
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
b'EDPEDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQKDLSELQDAKLKAEGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetratricopeptide repeat domain protein
publication title Solution nmr structure of tetratricopeptide repeat domain protein sru_0103 from salinibacter ruber, northeast structural genomics consortium (nesg) target srr115c
rcsb
source organism Salinibacter ruber dsm 13855
molecule tags Structural genomics, unknown function
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kcvA00
4KXKB 2WPVA 4YVOA 2HO1A 1XNFA 3CK9A 5G04C 2VSNA 5A7DB 4UI9C 2Q7FA 3FP3A 5ARFA 4J8DA 1Y8MA 5CHEE 4J0UA 2HYZA 5JJTA 1E96B 3URZA 2V5FA 5LCWJ 3GZ2A 3ESKA 3OXFA 3RJVA 2IFUA 3LY8A 3Q47B 2DBAA 3PDNA 3TAXA 4IN3B 2KC7A 4U07A 3MEKA 1B89A 1A17A 5JJ6A 4KYOB 3FWVA 3CVQA 1ELRA 4XIFA 4NRHB 1TJCA 3RKVA 4U04A 5A6CA 4HOQA 2YQ8A 2I6HA 4YVQC 2Y4TA 3LPZA 3CK7A 3CEQA 3ZN3A 2OOEA 3GYZA 1PC2A 4YNDA 3VTYA 4APOA 2J9QA 2XGSA 3JYSA 5DIZA 4GA2A 3EDTB 2IF4A 5G05J 4G24A 3GZ1A 4I1AA 5EX0A 3CK8A 3HYMB 3LKUA 1QZ2A 3LYAA 3ZGQA 3Q15A 4HOSA 3AS8A 4N2QA 4WNFA 4JA9A 2PL2A 4GA1A 4GCNA 3QKYA 4BT8A 3MV3B 1IHGA 4U0SA 1QQEA 4U0ZA 3QOUA 5D0QD 3N71A 3TGOA 4GYYA 4GYOA 2QFCA 2MHKA 4F3VA 5CCLA 5M72A 1WAO1 2R5SA 2PZIA 3RO3A 4XI9A 4G1TA 3ZFWA 1HZ4A 4A1SA 3LCAA 4I2WA 2P58C 2XPIA 2ONDA 4WNGA 1ZU2A 4H7XA 2FO7A 4UI9K 2AVPA 1NZNA 2KATA 4NQ0A 4I9CA 4HOTA 2C0MA 2VGYA 3QDNA 3MA5A 2Y4UA 3WXXA 1W3BA 3KD7A 3FFLA 3KS2A 3PE3A 3S7FA 2PQRA 3SF4A 3QWWA 4GZ5A 4WUYA 4B94A 2E2EA 2XGOA 3U3WA 4G26A 3AS4A 1ELWA 4G25A 3O48A 4J8EA 2HR2A 2UY1B 3ULQA 3UPVA 4HORA 3ASHA 5HQ8A 3TG4A 3PE4A 3RIBA 3ASGA 3KAEA 2XGMA 5ARGA 3U4TA 1YA0A 4W9RA 2UY1A 4Y6WA 4N3CA 3CVLA 4JL0A 4AM9A 2VQ2A 5AYWD 3VTXA 4HOUA 3ASFA 4WNDA 2L6JA 5KJNA 1WM5A 5G04J 1IYGA 2VSYA 4N39A 3MKRA 4UI9J 2FF4A 1HXIA 4KBQA 2UWJG 3MV2B 4AY6A 3UQ3A 3BEEA 4BT9A 3ZHEB 5KJKA 2BUGA 5HI7A 3ASDA 3K9IA 5FZSA 4I17A 2FBNA 2XCCA 5BT1A 5JJ7A 3SZ7A 2XEVA 4ME2A 4J8FA 3ZHEA 3LY9A 1ZBPA 2XCBA 4UQYA 3CV0A 2LSVA 1NA3A 5KJMA 3E4BA 4U0UA 3TG5A 2PQNA 5D0OD 3S7BA 2NC9A 1KT0A 3S7JA 4AIFA 3RU0A 1P5QA 4BTBA 5G05C 2VYIA 4N5CA 4CDRA 1FCHA 5FZRA 1HH8A 2C2LA 3Q4AB 2FEZA 4O6FA 2GW1A 2KCVA 3GW4A 3CKCA 4WNEA 4GPKA 4JA7A 3UUXA 4G2VA 5EKQD 5DBKA 1KT1A 3ZPJA 1NA0A 4JHRA 4N3BA 2VGXB 4UQXA 2KCKA 4G23A 3AS5A 3NF1A 3CVPA 3CKBA 2FI7A 5KJLA 4GA0A 3Q5MA 4N3AA 2LNIA 2VGXA 4AY5A 2JLBA 4ABNA 4XI0A 5FTPA 5BW8C 4RG9A 3OXGA 4H7YA 3RO2A 3LY7A 4UQZA 4N2SA 1KLXA 5LCWC 3IEGA 4I2ZA 5C1DA 4GYWA 4EQFA 4LEUA 5FZQA 3Q49B 4GCOA 5BNWA 4GZ3A 3S7DA 3CVNA 4BTAA 1OUVA 4BWRA 5FJYA 4CGVA 2YHCA 4GZ6A 5CCMA 5EX3A 4Y6CA 3OXLA 4RG6A 2C0LA 3QWPA 4CGWA 2KCLA 2LSUA 3R9AB 2WQHA 4I9EA 5FT9A 3QWVA
chains in the Genus database with same CATH superfamily
3FTZA 1U3CA 4MRUA 3C98A 4Q96A 4FJYA 3ZEFA 1XNFA 1UN9A 3CK9A 2IQCA 3P2BA 2VSXE 4TXRA 3D9NA 1NFIE 2VSNA 2WXHA 3ML9A 2Q7FA 2QYUA 2P9SG 3PZ3A 4DX7D 2QC9A 3GZ2A 1HX8A 1FVHA 3TWWA 3SD5A 3FULA 3PDNA 2AXUA 4TRQA 2OV8A 4I6JA 2DYRE 3L22A 3ABME 3R7QA 1HU3A 1A17A 3NB2A 4K5BA 4DJAA 3SQVA 2HE0A 4NRHB 3EHRA 4XEIG 3RKVA 2GROB 5A6CA 1Z5SC 1DCQA 1RW2A 2Y4TA 4CT4A 1TNBA 3LPZA 3CK7A 3IKOB 3ZN3A 5KWDA 3UKUG 5J08A 3FH8A 2XS1A 3TWSA 3VTYA 3V79K 4GMJA 2R59A 1E8ZA 5DIZA 4RSYA 1NP7A 1S70B 2QY7A 2P9UG 3ZYQA 1A5EA 1SZAA 2VTBB 3CK8A 3LKUA 5D2MC 3B7BA 1QZ2A 4HOSA 3AS8A 3TL5A 5LOZA 2PL2A 2WXRA 1S64A 4L2YA 4UWFA 4GA1A 3APDA 5KCMA 2PM7A 5ENNA 1FT2A 2ZXWE 2RD0A 1X81A 3TGOA 3RRMB 3UT7A 4I6EA 2VSOE 4HRNA 4EHMA 3T9KA 2ETBA 3Q78A 4P29A 4EBAA 3FUNA 4AJWA 4G1TA 1OXJA 3FTVA 2P58C 2B6CA 3FH5A 2E0IA 1INZA 1KZPA 1ZU2A 5AJLA 3JCKC 4TV3A 2KATA 4LRZA 4G11A 1WDYA 3PUJA 3D9LA 3G2VA 3DEPA 2DZOA 3VLDA 2IEJA 4DK5A 3S7FA 3SF4A 2XEHA 3C72A 3I4GA 3QWWA 3BU8A 4L2LA 2VJ8A 4ZHBA 2XGOA 3U3WA 4DLQA 2KBXA 5AARA 3OAWA 3RK6A 3PS6A 3D3MA 3PZDA 3CHRA 2BF0X 3UPVA 5ANLA 1Z3YA 3UM1A 2H6HA 3KAEA 4Q94A 3EIJA 2WXLA 4YDOA 4BERA 1OCZE 3D9HA 3CHSA 1TNUA 5KNHD 4Y6WA 5CMWA 2L0TB 4AM9A 1N54A 2VQ2A 5AYWD 1AWCB 4U8VD 4JZYA 4HOUA 5HRYA 5LFAA 2P2CP 1IQUA 5G04J 1D8EA 5LX8A 1HXIA 3TWXA 2UWJG 2WXNA 4AY6A 4G8LA 2LAIA 2P9KG 2R02A 4I17A 2IOSA 4ILIA 5ENPD 5JJ7A 4F53A 3SZ7A 4ME2A 3IHYA 3ZHEA 3LY9A 2BKKB 4UQYA 1NA3A 3SI5A 4A3TA 4C9BB 5T3RA 3CHMA 3ABKE 2PQNA 3FU6A 3P1UA 3S7BA 5ENOD 1KT0A 4TUMA 4BSZB 3DSUA 3PVLA 1P5QA 2L6BA 4B89A 3FUKA 4KZCA 2EILE 2VYIA 2EIKE 3W9FA 3AG3E 3CR3A 2GRMA 1UW4B 1O1SA 4JVSA 5CBOA 3PUKA 2C2LA 3Q4AB 4QFVA 4KMOA 3UXGA 2KZTB 2BTDA 5AENA 3GW4A 4BEPA 3APCA 1SQMA 4O60A 4GPKA 4G2VA 3NAWA 3SNXA 1KT1A 2R2LA 4FU3A 4U96D 2GRQB 2XHEA 4GA0A 5JA4D 2VGXA 4ABNA 3SHFA 2CHZA 3UX4A 3OTNA 4LCTA 1K1BA 2Y3AA 3RO2A 3LY7A 4GTTA 4UQZA 4I43A 5LCWC 3NBNB 4I2ZA 1DVPA 5C1DA 4GYWA 3PZ1A 4GCOA 3X2QE 4DI3A 5FQ7A 2ZISA 4BTAA 3TXNA 3I5PA 3JXJA 5FJYA 3MZLB 5CCMA 3D9JA 2V5QC 3FUDA 2C0LA 3JQ1A 1O5MA 3JUIA 3DSWA 4DX6D 2X6KA 2V4HC 3ABLE 3HHMA 4XZ4A 5FT9A 1K3ZD 1MYOA 4PS7A 3DSTA 3LEWA 3PNTB 4WWPA 3Q7AA 3Q7FA 1FPPA 2YNQA 5ENSD 3ZYMA 3E33A 4FP7A 2RFMA 1FT1A 1JUQA 4MS6A 3PZ4A 1E8YA 2XRYA 2J4BA 4O1PA 3ZYKA 4OAUC 1TEZA 4JEUA 1Y6IA 4J0UA 2HYZA 1KZOA 5CEDB 5JJTA 1E96B 2IJGX 3MGBA 2WVIA 2H6FA 3FEXA 3IBEA 3ESKA 3V2OA 3OXFA 3RJVA 5E75A 4AEZC 3Q47B 2IO3C 4GPMA 3V31A 1LF8A 4HRMB 4PUCA 2XENA 4IN3B 3FU0A 3CVUA 2WXJA 2YINA 5ENTD 4UUCA 1UOHA 4U07A 3FTSA 3ONLA 2WXFA 5JJ6A 3QB2A 3CVQA 1WY6A 2IY0C 1ELRA 5E76A 1TNOA 1TJCA 4U04A 3Q9UC 2MYOA 3FTXA 2YQ8A 4YVQC 3JQ0A 4EZJA 2OOEA 3GYZA 3ASNE 5FQ6A 3HDXA 1JCSA 4OVUA 1N0QA 4ACKA 5CRVA 4J6IA 4APOA 5FQ4A 3AG2E 3JYSA 4L23A 1YCSB 3EDTB 3EU9A 3SFZA 4CDNA 3GZ1A 3CSTA 5EX0A 3HYMB 2KM4A 2JABA 2GGFA 3ZGQA 4J8YA 1O1TA 3Q15A 4N2QA 4WNFA 4JA9A 2VTBA 4B8CB 4JC8A 3CIAA 1V54E 2LXMA 1MX4A 3QKYA 1S63A 1H6OA 1IHGA 3FUMA 3I4RB 1JWGA 2LUHA 4HNAD 4U0ZA 2LAHA 3ZVVA 4GYYA 4I1OB 2MHKA 5CCLA 3RRUA 4MLPA 5M72A 1WAO1 2R5SA 3FUEA 4DUIA 1MJ0A 2J8SD 3TWVA 3O4ZA 4XI9A 4A1SA 1N4RA 4M7CA 3Q75A 4LG6A 3V2XA 4CYMD 2A5UA 3LVQE 4UI9K 3CHQA 4I6GA 2C0MA 5CMYA 4URKA 3MA5A 3ONKA 3SBTB 3KD7A 3UI2A 4CT0A 3FFLA 3IV0A 3PE3A 3QNKA 4LNGA 5BXOA 3QJZA 1IXVA 3ESLA 2E2EA 5CECB 3FTYA 1H2TC 2X6HA 3HXFA 3FH7A 4G26A 1OY3D 3HRAA 3AS4A 4HLEA 3FU3A 4J8EA 2HR2A 2CHWA 4Q69A 3ULQA 3CHPA 2XRZA 4AXHA 1DNPA 3JXIA 2I1KA 1SZ9A 3ASGA 4EECA 4FJZA 3CQGB 3FTUA 4WWNA 4W9RA 1N4SA 4HRLA 3EHQA 3JUEA 3VTXA 4ATZD 2A5EA 2BEDA 1U2VG 1WM5A 3EJNA 2VSYA 4N39A 3T8MA 4UI9J 4OYSA 3ZXSA 4KBQA 4TXPA 3LDZA 4HVBA 3KSQA 4BY6A 3K9IA 5G2NA 5FZSA 2WXIA 2XCCA 1EYHA 2EQXA 2IONA 2XEVA 4B0ZA 2ZIRA 1OWLA 4J8FA 4L9PA 1ZBPA 3C3QA 2LSVA 3LJ3A 3NOGD 5KJMA 4IRUA 3E4BA 4A63B 3TWQA 3J5QB 5T4YA 4NACA 4GZCA 5ENRD 3QK0A 2J4DA 1ELKA 1H2UA 5BXUA 1K1AA 4DI4A 1OWMA 3KEAA 2R05A 4N5CA 1TNZA 2X38A 3CVYA 5FZRA 1LTXA 4GB9A 3EIQC 4NIKA 4DX5D 4FLBA 2FEZA 4CEMA 2GW1A 4HS2A 1SVXA 2DZNA 4JA7A 4JHRA 4KVMA 4N3BA 2KZTA 3L17A 3NF1A 1MHQA 3CVPA 4DX1A 4O1OA 5CBNA 4KZ0A 4N3AA 3DRAA 2JLBA 5J90A 3D9MA 4XI0A 5FTPA 2J49A 2L9BA 3HXDA 5BUZA 3Q73A 4HQDA 1HE8A 3CVWA 3LVRE 5CERB 1DC2A 2RFAA 1KLXA 2P9LG 4XX5A 3DWLG 3RSEG 2L0IA 4ANUA 4LNUD 4LEUA 2XPZA 2IO2C 2YHEA 2IU1A 2EINE 3Q49B 2NXPA 5BV1A 3FY4A 3CVNA 1SA4A 1OUVA 4E6HA 1BLXB 2P9IG 3SBSA 4K5AB 3AU5A 3ZYLA 5A23A 1GW6A 4F1SA 3ENEA 3Q79A 3QWPA 2KCLA 2LSUA 3PH0C 2WQHA 5FIOA 4ATGA 4J7WA 4GTVA 3AU4A 2WPVA 1ZB1A 4CRWA 2HO1A 2WXPA 3TWTA 4M3OA 1D8DA 3TJPA 1TYQG 2JEKA 4IULA 2X6IA 5G04C 5AAOA 5A7DB 4UWKA 5ENQD 3FP3A 5ARFA 1Y8MA 5EYLA 3U64A 5CHEE 4F1PA 4RQIA 3URZA 3G2SA 2J09A 2V5FA 2DYSE 3B7RL 3E34A 5LCWJ 4YDYA 3TXMA 4FULA 3AG4E 2IFUA 3LY8A 3UM3A 2DBAA 4U8HA 1DCEA 5T8IA 4F7AA 1TN8A 3MYVA 4BFRA 2CFUA 3PNLB 3RAUA 2DVWA 3EU5A 1KPSB 4FLHA 4KYOB 3DPDA 4GTQA 5B1BE 4K5CA 4HOQA 2J07A 3EUVA 3CEQA 4HBDA 3HG0D 3J5PA 4YNDA 4B93B 3B13A 1N9AA 2XPYA 2LXLA 5CEAA 1MX6A 2J9QA 2XGSA 3GZSA 1U3DA 2GRRB 2B0OE 5EN5D 1E90A 1N11A 2IF4A 5G05J 4CZ2D 4G24A 5AN8A 4I1AA 2NYJA 2F8XK 3VLFA 5BPPA 4HFGA 4JEHA 3LYAA 4I1MA 3ASOE 2OEVA 3DXMG 2Y69E 2XQ0A 3ZW3A 5AQAA 4GCNA 4UWHA 5FQ8A 3MV3B 1QQEA 2WMNA 3UT8A 1SW6A 2QYJA 3N71A 2FULA 5D66A 4GYOA 3T5XA 3UIOC 3D9PA 2WXGA 4F3VA 3W9GA 3QARA 3DXKG 2PZIA 4QQIA 3HXCA 3RO3A 3IXEA 1MQSA 4K0RA 3UIPC 3DSVA 5ITZF 3FUHA 4E85A 4ILGA 2X3MA 1WG0A 2DIWA 3L54A 4RLYA 2FO1E 2FO7A 2AVPA 1NZNA 2BKGA 2ILRA 4NQ0A 4PS3A 4TUUA 1W3BA 1H6PA 2PQRA 3DBSA 2DCPA 1VDYA 2OVBA 4GZ5A 4NURA 3PREA 3D9KA 3ULYA 1IKND 1ELWA 4G25A 2UY1B 4HORA 3TG4A 3PE4A 3RIBA 5JHAA 1PY1A 2XGMA 5ARGA 4ZFHA 1YA0A 2CG2A 3KSLA 4UWLA 3V30A 3CVLA 4OAVB 3DPYA 3DEOA 3G2TA 1N52A 2M63A 1OT8A 3FDHA 1IYGA 3B95A 3CHOA 2ETAA 3D9OA 2HM8A 4GTOA 3LJNA 2AXVA 3ZRHA 1RZ4A 3R9MA 5KJKA 2BUGA 3PEUB 5HI7A 3ASDA 2V8SE 1N4QA 1UG3A 4DRXE 1YYHA 4CDMA 3KEZA 4BETA 2XCBA 4HLLA 4IYPA 4HI9A 3MJWA 4U0UA 3BG0B 3TG5A 2NC9A 4U8YD 3ZNGA 4AIFA 4DLOA 5EIDA 4GMRA 4UWGA 1H2VC 3E32A 4JD2G 4BTBA 3HXBA 3ZU7B 3UM2A 4CDRA 5ANRA 2H6IA 2ZU6B 2PM6A 3L82A 2RKKA 1FVFA 1HH8A 3F6QA 3E30A 2GRPB 3FTWA 4ANXA 4XKCA 5EDSA 3BG1B 3SFYA 3L6AA 3B7UX 4N5QA 4EZLA 1HS6A 4WNEA 1BU9A 2I2OA 3CGHA 1SA5A 3ZPJA 4PH4B 4UQXA 4G23A 3AS5A 3CKBA 4LERA 1QBQA 2FI7A 3ML8A 1QYMA 4EPZA 4TXQA 2XZTG 3QAQA 5JHBA 3C3OA 5EYPF 3CVXA 1K8KG 4RG9A 3CLJA 4K03A 2QZAA 3MKQB 5IY5E 2OCCE 4ILHB 4MBGA 1QNFA 4JPSA 1N0RA 1E7VA 1TNYA 4YDEA 4R7LA 3IHVA 3L9TA 4EQFA 2WXKA 3HVEB 5FZQA 4JHJA 2AJAA 2R17C 5B3SE 5BNWA 2VGEA 4GZ3A 4GTPA 4HXIA 2CG3A 4JXTA 4BWRA 1TJFA 3L13A 3SGHA 2XZDG 5AQBA 1UN8A 4CGVA 4U95D 1OWOA 4GTMA 4PS8A 1BPOA 3OXLA 2NSZA 1XGWA 4KT6B 5G55A 3FUIA 4CGWA 4GZDA 2WXMA 5EILA 3ZXPA 3QWVA 4KXKB 2V0PA 1E7UA 3HXEA 4YVOA 2CFZA 3T5VA 1IHBA 3R7RA 3VLEA 2Y0BG 2CHXA 2AXZA 1EDUA 4A55A 3NZUA 5BV0A 2ZGDA 4UI9C 4BX9A 1LD8A 3LXUX 4J8DA 2MRIA 4HI8A 4FA6A 3UMVA 2X6JA 3ZKJA 2XEEA 4D10C 3SY2A 1Z6TA 2Y1LE 3TAXA 1OCCE 4JHKA 2KC7A 3PRZA 4GU5A 3MEKA 1B89A 3FHEA 1OWPA 3FWVA 3C5RA 1BI7B 4XIFA 4JW1A 3U66A 4LUNU 4KVOA 3Q9NC 2R03A 3NQPA 5FWQA 2I6HA 2RG8A 2WQ6A 5AIJA 4EZKA 1PC2A 2X6FA 2WXQA 4U63A 2WQ7A 5HKPA 2WXOA 1IQRA 3ULEG 4GA2A 2I1JA 1BI8B 3B7TA 3NZSA 1MX2A 3C3RA 3I3NA 3CVVA 3QC1A 2KXPC 5LP0A 3FUJA 1HO8A 1E8XA 3PZ2A 3HIZA 4MKTA 4BT8A 4U0SA 4A3VA 4C0EA 3SO8A 4CCAA 3QOUA 5D0QD 5B1AE 3T8KA 1PAQA 4GTRA 2QFCA 3UKRG 3L08A 5KBAA 4FHJA 3AAAC 2GRNB 3AJIA 3DSXA 3ZFWA 1HZ4A 3LCAA 4I2WA 2XPIA 4B8AA 2ONDA 4AVXA 4WNGA 3G2WA 1AP7A 3FU5A 1E8WA 4H7XA 5AQ9A 3ZUVB 4L7TA 4I9CA 4HOTA 4WAFA 3DSSA 2VGYA 3QDNA 2Y4UA 3WXXA 1OWNA 3WG7E 3KS2A 2J08A 1UJKA 4JB8P 1EPUA 1N94A 4WUYA 1UJJA 4J8SA 4B94A 1BD8A 1TN6A 1JPLA 4GTSA 3MX3A 4FHKA 3FUFA 3FEYA 2EIJE 4WWOA 1TR4A 1MZCA 3O48A 4YDWA 4DPRA 1HG5A 1D9SA 2OVFA 4BESA 3ASHA 5HQ8A 4ANWA 4BX8A 4L1BA 3S2AA 3E37A 3U4TA 4ACLA 1HFAA 4A1GA 2UY1A 2F0YA 2LO6A 4N3CA 1JCQA 4JL0A 2WM9A 1X5BA 3PEVB 3ASFA 2F37A 4GAAA 4WNDA 2P9PG 2L6JA 5KJNA 3MKRA 4F6RD 2FF4A 3MV2B 3BQOA 3SFXA 3UQ3A 3TWUA 3BEEA 4BT9A 3ZHEB 4AP2A 2FBNA 1G3NB 4GMLA 5BT1A 3ZIMA 1JWFA 4DX2A 3CV0A 4PDXA 3UINC 5JMND 4X8QA 5D0OD 1H6KA 2GRLA 3S7JA 2WB2A 3RU0A 1S0PA 1Q2ZA 5G05C 1L5JA 4AOFA 1YMPA 1FCHA 4LSZE 1HF8A 5KNGA 4Z68A 4APFA 3LS8A 3CSFA 4XE0A 1N95A 1OCOE 2EIME 4U7EB 2I9CA 1Z3XA 4O6FA 3MCXA 4C0MA 2KCVA 3CKCA 3UUXA 3U9WA 5EKQD 5DBKA 1LD7A 1NA0A 3CQCB 1HG2A 2VGXB 2KCKA 5AQ7A 3EHMA 4RVBA 4FADA 3D9IA 3NOCD 4FC8A 3TWRA 2IOLA 1V55E 3BUAA 5KJLA 2DWZA 3UTMA 1H0AA 5EIBE 5FINA 3UM0A 3Q5MA 2LNIA 2P9NG 4XKBA 4AV7A 1H19A 4AY5A 5BW8C 2WMOA 2F8YA 3OXGA 5H7PA 4H7YA 3UT4A 3EHNA 5CRUA 2A4ZA 2H6GA 4N2SA 3IEGA 1OCRE 4LNBA 2OEWA 1NI1A 4ANVA 3MKQA 3ISMC 2MOWA 2XS8A 5AJDA 2AW6A 3AG1E 1NL4A 4OVVA 3G2UA 3S7DA 3B7SA 1TN7A 2PNNA 3RRNB 1O1RA 2ZGGA 3APFA 3HVEA 3L16A 2YHCA 4BSXA 4V3IA 4GZ6A 1N4PA 5HS0A 5EX3A 4Y6CA 4EBAG 1JCRA 2V4LA 4RG6A 2ETCA 4G8KA 5C2YA 1EF1C 4HB5A 3R9AB 4C48B 2AWIA 4I9EA
chains in the Genus database with same CATH topology
3FTZA 1U3CA 4KXKB 2V0PA 1E7UA 4MRUA 3AU4A 4PS7A 2WPVA 3LEWA 2CFZA 3PNTB 4WWPA 4YVOA 4CRWA 3C98A 4Q96A 3T5VA 2HO1A 2WXPA 2YNQA 4FJYA 3R7RA 3VLEA 3ZEFA 3ZYMA 2CHXA 4FP7A 1XNFA 1UN9A 2AXZA 1JUQA 4MS6A 3CK9A 1E8YA 1EDUA 4M3OA 2XRYA 2J4BA 2IQCA 3P2BA 3TJPA 2VSXE 2JEKA 4IULA 3D9NA 2X6IA 4A55A 5G04C 2VSNA 3ZYKA 2WXHA 3NZUA 5BV0A 3ML9A 5A7DB 4UI9C 4UWKA 2Q7FA 3FP3A 4BX9A 5ARFA 1TEZA 3LXUX 4J8DA 1Y8MA 2MRIA 3U64A 4JEUA 5CHEE 4FA6A 1Y6IA 4J0UA 2HYZA 5JJTA 1E96B 3UMVA 2IJGX 2X6JA 3G2SA 3URZA 2J09A 2V5FA 3MGBA 2WVIA 3B7RL 3FEXA 5LCWJ 3GZ2A 1HX8A 3ESKA 1FVHA 3IBEA 4D10C 3TXMA 3OXFA 3RJVA 5E75A 4AEZC 4FULA 1Z6TA 2IFUA 3LY8A 3Q47B 2DBAA 3SD5A 4U8HA 3FULA 4HLEA 1LF8A 3PDNA 4PUCA 3TAXA 2AXUA 4TRQA 5T8IA 4F7AA 4IN3B 3MYVA 2OV8A 3FU0A 4I6JA 2WXJA 4BFRA 3L22A 3CVUA 4JHKA 2KC7A 2CFUA 2YINA 3PNLB 3PRZA 4GU5A 3R7QA 4U07A 4FLHA 3MEKA 1B89A 1HU3A 3FTSA 3ONLA 2WXFA 1A17A 4DJAA 3FHEA 5JJ6A 1OWPA 3QB2A 4KYOB 3FWVA 3CVQA 1WY6A 3DPDA 1ELRA 5E76A 4XIFA 4NRHB 1TJCA 3RKVA 4JW1A 4U04A 3U66A 4LUNU 4KVOA 5A6CA 3FTXA 4HOQA 2J07A 3NQPA 2YQ8A 5FWQA 2I6HA 4YVQC 2Y4TA 4CT4A 2RG8A 3JQ0A 3LPZA 2WQ6A 3CK7A 4EZJA 3CEQA 3IKOB 3ZN3A 2OOEA 3GYZA 5AIJA 4EZKA 1PC2A 2X6FA 5J08A 2WXQA 5FQ6A 3HDXA 4YNDA 3B13A 4U63A 4OVUA 2XPYA 3FH8A 2WQ7A 4ACKA 3VTYA 2WXOA 4J6IA 4APOA 1IQRA 5FQ4A 4GMJA 2J9QA 2XGSA 3GZSA 1U3DA 2R59A 3JYSA 1E8ZA 4L23A 5DIZA 4GA2A 2I1JA 3EDTB 4RSYA 1E90A 1NP7A 2IF4A 5G05J 3SFZA 2QY7A 4CDNA 4G24A 3ZYQA 1SZAA 3B7TA 3NZSA 3GZ1A 2VTBB 3CSTA 4I1AA 5EX0A 3CK8A 3VLFA 3HYMB 3LKUA 2KM4A 3I3NA 3CVVA 3QC1A 4HFGA 5BPPA 1QZ2A 2GGFA 4JEHA 3LYAA 3ZGQA 4I1MA 3Q15A 5LP0A 4HOSA 3AS8A 4N2QA 4WNFA 3FUJA 3TL5A 4JA9A 2XQ0A 1HO8A 5LOZA 2VTBA 4B8CB 2PL2A 1E8XA 2WXRA 4L2YA 4JC8A 3ZW3A 3HIZA 3CIAA 4UWFA 4MKTA 4GA1A 3APDA 4GCNA 4UWHA 5FQ8A 3QKYA 5KCMA 4BT8A 3MV3B 2PM7A 1IHGA 3FUMA 4U0SA 5ENNA 1QQEA 3I4RB 1JWGA 2WMNA 3UT8A 4A3VA 4U0ZA 4C0EA 4CCAA 3QOUA 2LAHA 5D0QD 3N71A 2FULA 2RD0A 3TGOA 1PAQA 4GYYA 4GYOA 3RRMB 3UT7A 3ZVVA 3T5XA 4I6EA 2QFCA 3D9PA 2MHKA 4I1OB 2WXGA 2VSOE 4F3VA 5CCLA 3RRUA 3QARA 3L08A 4MLPA 5M72A 1WAO1 2R5SA 2PZIA 3FUEA 4FHJA 4P29A 4EBAA 3O4ZA 3FUNA 3RO3A 4AJWA 4XI9A 4G1TA 3ZFWA 1HZ4A 1MQSA 3FTVA 4K0RA 4A1SA 3LCAA 4I2WA 2P58C 3FUHA 2XPIA 4E85A 4ILGA 4B8AA 3FH5A 2E0IA 1INZA 2ONDA 4AVXA 2X3MA 4WNGA 3G2WA 2DIWA 3L54A 3FU5A 1E8WA 1ZU2A 2A5UA 2FO7A 3LVQE 4H7XA 5AJLA 3JCKC 4UI9K 2AVPA 3CHQA 4TV3A 1NZNA 2ILRA 4L7TA 2KATA 4NQ0A 4I9CA 4I6GA 4LRZA 4PS3A 4G11A 2C0MA 4TUUA 4HOTA 3PUJA 5CMYA 4URKA 4WAFA 3D9LA 3G2VA 2VGYA 3QDNA 3MA5A 2Y4UA 3ONKA 3WXXA 1W3BA 3SBTB 3KD7A 3VLDA 1OWNA 4CT0A 3FFLA 3KS2A 2J08A 3IV0A 3PE3A 4DK5A 3S7FA 1UJKA 2PQRA 3SF4A 3DBSA 3QNKA 2DCPA 1VDYA 3I4GA 1EPUA 2OVBA 3QWWA 3QJZA 4GZ5A 4WUYA 1UJJA 4NURA 3ESLA 4J8SA 4L2LA 2E2EA 3PREA 1JPLA 2VJ8A 4B94A 3MX3A 4FHKA 2XGOA 3U3WA 3FTYA 4DLQA 3D9KA 3FUFA 1H2TC 3FEYA 2X6HA 3OAWA 3FH7A 4G26A 4WWOA 3RK6A 3PS6A 3AS4A 1ELWA 3D3MA 4G25A 3FU3A 3O48A 3PZDA 4J8EA 2HR2A 4DPRA 2CHWA 1HG5A 2UY1B 2OVFA 3CHRA 3ULQA 4Q69A 3CHPA 2XRZA 2BF0X 3UPVA 4HORA 3ASHA 1Z3YA 1DNPA 5ANLA 4AXHA 5HQ8A 4ANWA 4BX8A 2I1KA 3TG4A 3PE4A 3RIBA 1SZ9A 4L1BA 3S2AA 5JHAA 3ASGA 4EECA 1PY1A 3KAEA 2XGMA 4Q94A 5ARGA 3U4TA 4FJZA 3CQGB 2WXLA 3EIJA 1YA0A 3FTUA 1HFAA 4ACLA 4A1GA 4WWNA 4W9RA 2UY1A 2CG2A 4UWLA 3CHSA 2LO6A 4Y6WA 4N3CA 5CMWA 3CVLA 2L0TB 4JL0A 4AM9A 2WM9A 1X5BA 1N54A 2VQ2A 5AYWD 3G2TA 3VTXA 4JZYA 4HOUA 3PEVB 1N52A 2M63A 3ASFA 4GAAA 4WNDA 5LFAA 2L6JA 3FDHA 5KJNA 1IQUA 1WM5A 3EJNA 5G04J 2VSYA 4N39A 1IYGA 3MKRA 3T8MA 3CHOA 4UI9J 2FF4A 4OYSA 3ZXSA 3D9OA 5LX8A 1HXIA 4KBQA 2HM8A 2UWJG 3MV2B 2WXNA 4AY6A 3UQ3A 3LDZA 2AXVA 4HVBA 3BEEA 3ZRHA 4BT9A 2LAIA 4BY6A 3ZHEB 5KJKA 2BUGA 3PEUB 5HI7A 3ASDA 3K9IA 5G2NA 5FZSA 4AP2A 2V8SE 2WXIA 4I17A 2FBNA 2IOSA 4ILIA 4GMLA 2XCCA 1EYHA 5BT1A 5JJ7A 2EQXA 2IONA 4F53A 3SZ7A 1UG3A 2XEVA 4ME2A 4CDMA 3KEZA 4B0ZA 3ZIMA 1JWFA 3IHYA 1OWLA 4J8FA 3ZHEA 3LY9A 1ZBPA 2XCBA 4UQYA 3CV0A 4PDXA 2LSVA 3LJ3A 1NA3A 3SI5A 4A3TA 4C9BB 5T3RA 4IRUA 5KJMA 3E4BA 4IYPA 3CHMA 3MJWA 4U0UA 3BG0B 3TG5A 2PQNA 3FU6A 4NACA 3P1UA 4GZCA 1H6KA 5D0OD 2GRLA 2NC9A 5T4YA 3S7BA 3QK0A 1KT0A 2J4DA 3S7JA 4AIFA 1ELKA 1H2UA 2WB2A 4DLOA 3RU0A 3PVLA 4UWGA 1H2VC 1P5QA 4DI4A 1S0PA 1OWMA 4BTBA 5G05C 4B89A 1L5JA 4AOFA 3FUKA 4KZCA 2VYIA 4N5CA 4CDRA 1FCHA 1HF8A 5ANRA 2ZU6B 2X38A 3CR3A 4APFA 3LS8A 3CSFA 2GRMA 1UW4B 2PM6A 4XE0A 4JVSA 3CVYA 3PUKA 5FZRA 1FVFA 1HH8A 2C2LA 3FTWA 4GB9A 4ANXA 3Q4AB 3EIQC 4QFVA 4XKCA 2I9CA 5EDSA 4KMOA 3BG1B 1Z3XA 4FLBA 2FEZA 2KZTB 4CEMA 3L6AA 4O6FA 3MCXA 3B7UX 2GW1A 2BTDA 4HS2A 4C0MA 1HS6A 2KCVA 3GW4A 4EZLA 5AENA 3CKCA 3APCA 4WNEA 1SQMA 4GPKA 4JA7A 2I2OA 3CGHA 3UUXA 3U9WA 4G2VA 5EKQD 5DBKA 3SNXA 1KT1A 3ZPJA 1NA0A 4JHRA 3CQCB 1HG2A 4FU3A 4KVMA 2VGXB 2KZTA 4N3BA 4PH4B 4UQXA 2KCKA 4G23A 3EHMA 4RVBA 4FADA 3D9IA 3AS5A 3L17A 3NF1A 4FC8A 1MHQA 3CVPA 3CKBA 4LERA 2FI7A 3ML8A 2IOLA 4EPZA 2XHEA 5KJLA 1H0AA 4GA0A 3QAQA 5JHBA 4KZ0A 3Q5MA 4N3AA 2LNIA 2VGXA 4XKBA 4AV7A 1H19A 4AY5A 2JLBA 4ABNA 5J90A 3SHFA 3CVXA 3D9MA 4XI0A 5FTPA 5BW8C 2CHZA 2WMOA 2J49A 4RG9A 3UX4A 3CLJA 3OXGA 2L9BA 3OTNA 4K03A 4H7YA 4LCTA 2Y3AA 3RO2A 3MKQB 3UT4A 5BUZA 3EHNA 3LY7A 1HE8A 4UQZA 4ILHB 1QNFA 2A4ZA 3CVWA 3LVRE 4I43A 4N2SA 1KLXA 4XX5A 5LCWC 4JPSA 3IEGA 1E7VA 4I2ZA 2L0IA 1DVPA 3IHVA 4R7LA 4ANVA 4ANUA 5C1DA 4GYWA 3MKQA 4EQFA 2MOWA 2WXKA 4LEUA 2XPZA 2YHEA 3HVEB 5FZQA 5AJDA 4JHJA 2IU1A 3Q49B 4GCOA 2AW6A 2R17C 5BNWA 2NXPA 4DI3A 4OVVA 5BV1A 3G2UA 3FY4A 4GZ3A 3S7DA 3B7SA 3CVNA 3RRNB 5FQ7A 4HXIA 4BTAA 1OUVA 3TXNA 4E6HA 2CG3A 4JXTA 3APFA 3I5PA 3HVEA 3SBSA 1TJFA 4BWRA 3L13A 3SGHA 5FJYA 3AU5A 1UN8A 3ZYLA 3MZLB 4CGVA 3L16A 2YHCA 5A23A 4BSXA 1OWOA 4PS8A 4GZ6A 4V3IA 5CCMA 5EX3A 1GW6A 1BPOA 4Y6CA 4EBAG 4F1SA 3OXLA 2NSZA 3D9JA 3ENEA 1XGWA 2V4LA 4RG6A 5C2YA 4KT6B 3FUDA 1EF1C 5G55A 2C0LA 3JQ1A 3QWPA 3FUIA 4CGWA 2KCLA 2LSUA 4GZDA 3JUIA 3PH0C 2WXMA 3R9AB 2WQHA 2AWIA 4ATGA 2X6KA 4I9EA 3HHMA 4XZ4A 5FT9A 3QWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KXK B;  2WPV A;  4YVO A;  2HO1 A;  1XNF A;  3CK9 A;  5G04 C;  2VSN A;  5A7D B;  4UI9 C;  2Q7F A;  3FP3 A;  5ARF A;  4J8D A;  1Y8M A;  5CHE E;  4J0U A;  2HYZ A;  5JJT A;  1E96 B;  3URZ A;  2V5F A;  5LCW J;  3GZ2 A;  3ESK A;  3OXF A;  3RJV A;  2IFU A;  3LY8 A;  3Q47 B;  2DBA A;  3PDN A;  3TAX A;  4IN3 B;  2KC7 A;  4U07 A;  3MEK A;  1B89 A;  1A17 A;  5JJ6 A;  4KYO B;  3FWV A;  3CVQ A;  1ELR A;  4XIF A;  4NRH B;  1TJC A;  3RKV A;  4U04 A;  5A6C A;  4HOQ A;  2YQ8 A;  2I6H A;  4YVQ C;  2Y4T A;  3LPZ A;  3CK7 A;  3CEQ A;  3ZN3 A;  2OOE A;  3GYZ A;  1PC2 A;  4YND A;  3VTY A;  4APO A;  2J9Q A;  2XGS A;  3JYS A;  5DIZ A;  4GA2 A;  3EDT B;  2IF4 A;  5G05 J;  4G24 A;  3GZ1 A;  4I1A A;  5EX0 A;  3CK8 A;  3HYM B;  3LKU A;  1QZ2 A;  3LYA A;  3ZGQ A;  3Q15 A;  4HOS A;  3AS8 A;  4N2Q A;  4WNF A;  4JA9 A;  2PL2 A;  4GA1 A;  4GCN A;  3QKY A;  4BT8 A;  3MV3 B;  1IHG A;  4U0S A;  1QQE A;  4U0Z A;  3QOU A;  5D0Q D;  3N71 A;  3TGO A;  4GYY A;  4GYO A;  2QFC A;  2MHK A;  4F3V A;  5CCL A;  5M72 A;  1WAO 1;  2R5S A;  2PZI A;  3RO3 A;  4XI9 A;  4G1T A;  3ZFW A;  1HZ4 A;  4A1S A;  3LCA A;  4I2W A;  2P58 C;  2XPI A;  2OND A;  4WNG A;  1ZU2 A;  4H7X A;  2FO7 A;  4UI9 K;  2AVP A;  1NZN A;  2KAT A;  4NQ0 A;  4I9C A;  4HOT A;  2C0M A;  2VGY A;  3QDN A;  3MA5 A;  2Y4U A;  3WXX A;  1W3B A;  3KD7 A;  3FFL A;  3KS2 A;  3PE3 A;  3S7F A;  2PQR A;  3SF4 A;  3QWW A;  4GZ5 A;  4WUY A;  4B94 A;  2E2E A;  2XGO A;  3U3W A;  4G26 A;  3AS4 A;  1ELW A;  4G25 A;  3O48 A;  4J8E A;  2HR2 A;  2UY1 B;  3ULQ A;  3UPV A;  4HOR A;  3ASH A;  5HQ8 A;  3TG4 A;  3PE4 A;  3RIB A;  3ASG A;  3KAE A;  2XGM A;  5ARG A;  3U4T A;  1YA0 A;  4W9R A;  2UY1 A;  4Y6W A;  4N3C A;  3CVL A;  4JL0 A;  4AM9 A;  2VQ2 A;  5AYW D;  3VTX A;  4HOU A;  3ASF A;  4WND A;  2L6J A;  5KJN A;  1WM5 A;  5G04 J;  1IYG A;  2VSY A;  4N39 A;  3MKR A;  4UI9 J;  2FF4 A;  1HXI A;  4KBQ A;  2UWJ G;  3MV2 B;  4AY6 A;  3UQ3 A;  3BEE A;  4BT9 A;  3ZHE B;  5KJK A;  2BUG A;  5HI7 A;  3ASD A;  3K9I A;  5FZS A;  4I17 A;  2FBN A;  2XCC A;  5BT1 A;  5JJ7 A;  3SZ7 A;  2XEV A;  4ME2 A;  4J8F A;  3ZHE A;  3LY9 A;  1ZBP A;  2XCB A;  4UQY A;  3CV0 A;  2LSV A;  1NA3 A;  5KJM A;  3E4B A;  4U0U A;  3TG5 A;  2PQN A;  5D0O D;  3S7B A;  2NC9 A;  1KT0 A;  3S7J A;  4AIF A;  3RU0 A;  1P5Q A;  4BTB A;  5G05 C;  2VYI A;  4N5C A;  4CDR A;  1FCH A;  5FZR A;  1HH8 A;  2C2L A;  3Q4A B;  2FEZ A;  4O6F A;  2GW1 A;  2KCV A;  3GW4 A;  3CKC A;  4WNE A;  4GPK A;  4JA7 A;  3UUX A;  4G2V A;  5EKQ D;  5DBK A;  1KT1 A;  3ZPJ A;  1NA0 A;  4JHR A;  4N3B A;  2VGX B;  4UQX A;  2KCK A;  4G23 A;  3AS5 A;  3NF1 A;  3CVP A;  3CKB A;  2FI7 A;  5KJL A;  4GA0 A;  3Q5M A;  4N3A A;  2LNI A;  2VGX A;  4AY5 A;  2JLB A;  4ABN A;  4XI0 A;  5FTP A;  5BW8 C;  4RG9 A;  3OXG A;  4H7Y A;  3RO2 A;  3LY7 A;  4UQZ A;  4N2S A;  1KLX A;  5LCW C;  3IEG A;  4I2Z A;  5C1D A;  4GYW A;  4EQF A;  4LEU A;  5FZQ A;  3Q49 B;  4GCO A;  5BNW A;  4GZ3 A;  3S7D A;  3CVN A;  4BTA A;  1OUV A;  4BWR A;  5FJY A;  4CGV A;  2YHC A;  4GZ6 A;  5CCM A;  5EX3 A;  4Y6C A;  3OXL A;  4RG6 A;  2C0L A;  3QWP A;  4CGW A;  2KCL A;  2LSU A;  3R9A B;  2WQH A;  4I9E A;  5FT9 A;  3QWV A; 
#chains in the Genus database with same CATH topology
 3FTZ A;  1U3C A;  4MRU A;  3C98 A;  4Q96 A;  4FJY A;  3ZEF A;  1XNF A;  1UN9 A;  3CK9 A;  2IQC A;  3P2B A;  2VSX E;  4TXR A;  3D9N A;  1NFI E;  2VSN A;  2WXH A;  3ML9 A;  2Q7F A;  2QYU A;  2P9S G;  3PZ3 A;  4DX7 D;  2QC9 A;  3GZ2 A;  1HX8 A;  1FVH A;  3TWW A;  3SD5 A;  3FUL A;  3PDN A;  2AXU A;  4TRQ A;  2OV8 A;  4I6J A;  2DYR E;  3L22 A;  3ABM E;  3R7Q A;  1HU3 A;  1A17 A;  3NB2 A;  4K5B A;  4DJA A;  3SQV A;  2HE0 A;  4NRH B;  3EHR A;  4XEI G;  3RKV A;  2GRO B;  5A6C A;  1Z5S C;  1DCQ A;  1RW2 A;  2Y4T A;  4CT4 A;  1TNB A;  3LPZ A;  3CK7 A;  3IKO B;  3ZN3 A;  5KWD A;  3UKU G;  5J08 A;  3FH8 A;  2XS1 A;  3TWS A;  3VTY A;  3V79 K;  4GMJ A;  2R59 A;  1E8Z A;  5DIZ A;  4RSY A;  1NP7 A;  1S70 B;  2QY7 A;  2P9U G;  3ZYQ A;  1A5E A;  1SZA A;  2VTB B;  3CK8 A;  3LKU A;  5D2M C;  3B7B A;  1QZ2 A;  4HOS A;  3AS8 A;  3TL5 A;  5LOZ A;  2PL2 A;  2WXR A;  1S64 A;  4L2Y A;  4UWF A;  4GA1 A;  3APD A;  5KCM A;  2PM7 A;  5ENN A;  1FT2 A;  2ZXW E;  2RD0 A;  1X81 A;  3TGO A;  3RRM B;  3UT7 A;  4I6E A;  2VSO E;  4HRN A;  4EHM A;  3T9K A;  2ETB A;  3Q78 A;  4P29 A;  4EBA A;  3FUN A;  4AJW A;  4G1T A;  1OXJ A;  3FTV A;  2P58 C;  2B6C A;  3FH5 A;  2E0I A;  1INZ A;  1KZP A;  1ZU2 A;  5AJL A;  3JCK C;  4TV3 A;  2KAT A;  4LRZ A;  4G11 A;  1WDY A;  3PUJ A;  3D9L A;  3G2V A;  3DEP A;  2DZO A;  3VLD A;  2IEJ A;  4DK5 A;  3S7F A;  3SF4 A;  2XEH A;  3C72 A;  3I4G A;  3QWW A;  3BU8 A;  4L2L A;  2VJ8 A;  4ZHB A;  2XGO A;  3U3W A;  4DLQ A;  2KBX A;  5AAR A;  3OAW A;  3RK6 A;  3PS6 A;  3D3M A;  3PZD A;  3CHR A;  2BF0 X;  3UPV A;  5ANL A;  1Z3Y A;  3UM1 A;  2H6H A;  3KAE A;  4Q94 A;  3EIJ A;  2WXL A;  4YDO A;  4BER A;  1OCZ E;  3D9H A;  3CHS A;  1TNU A;  5KNH D;  4Y6W A;  5CMW A;  2L0T B;  4AM9 A;  1N54 A;  2VQ2 A;  5AYW D;  1AWC B;  4U8V D;  4JZY A;  4HOU A;  5HRY A;  5LFA A;  2P2C P;  1IQU A;  5G04 J;  1D8E A;  5LX8 A;  1HXI A;  3TWX A;  2UWJ G;  2WXN A;  4AY6 A;  4G8L A;  2LAI A;  2P9K G;  2R02 A;  4I17 A;  2IOS A;  4ILI A;  5ENP D;  5JJ7 A;  4F53 A;  3SZ7 A;  4ME2 A;  3IHY A;  3ZHE A;  3LY9 A;  2BKK B;  4UQY A;  1NA3 A;  3SI5 A;  4A3T A;  4C9B B;  5T3R A;  3CHM A;  3ABK E;  2PQN A;  3FU6 A;  3P1U A;  3S7B A;  5ENO D;  1KT0 A;  4TUM A;  4BSZ B;  3DSU A;  3PVL A;  1P5Q A;  2L6B A;  4B89 A;  3FUK A;  4KZC A;  2EIL E;  2VYI A;  2EIK E;  3W9F A;  3AG3 E;  3CR3 A;  2GRM A;  1UW4 B;  1O1S A;  4JVS A;  5CBO A;  3PUK A;  2C2L A;  3Q4A B;  4QFV A;  4KMO A;  3UXG A;  2KZT B;  2BTD A;  5AEN A;  3GW4 A;  4BEP A;  3APC A;  1SQM A;  4O60 A;  4GPK A;  4G2V A;  3NAW A;  3SNX A;  1KT1 A;  2R2L A;  4FU3 A;  4U96 D;  2GRQ B;  2XHE A;  4GA0 A;  5JA4 D;  2VGX A;  4ABN A;  3SHF A;  2CHZ A;  3UX4 A;  3OTN A;  4LCT A;  1K1B A;  2Y3A A;  3RO2 A;  3LY7 A;  4GTT A;  4UQZ A;  4I43 A;  5LCW C;  3NBN B;  4I2Z A;  1DVP A;  5C1D A;  4GYW A;  3PZ1 A;  4GCO A;  3X2Q E;  4DI3 A;  5FQ7 A;  2ZIS A;  4BTA A;  3TXN A;  3I5P A;  3JXJ A;  5FJY A;  3MZL B;  5CCM A;  3D9J A;  2V5Q C;  3FUD A;  2C0L A;  3JQ1 A;  1O5M A;  3JUI A;  3DSW A;  4DX6 D;  2X6K A;  2V4H C;  3ABL E;  3HHM A;  4XZ4 A;  5FT9 A;  1K3Z D;  1MYO A;  4PS7 A;  3DST A;  3LEW A;  3PNT B;  4WWP A;  3Q7A A;  3Q7F A;  1FPP A;  2YNQ A;  5ENS D;  3ZYM A;  3E33 A;  4FP7 A;  2RFM A;  1FT1 A;  1JUQ A;  4MS6 A;  3PZ4 A;  1E8Y A;  2XRY A;  2J4B A;  4O1P A;  3ZYK A;  4OAU C;  1TEZ A;  4JEU A;  1Y6I A;  4J0U A;  2HYZ A;  1KZO A;  5CED B;  5JJT A;  1E96 B;  2IJG X;  3MGB A;  2WVI A;  2H6F A;  3FEX A;  3IBE A;  3ESK A;  3V2O A;  3OXF A;  3RJV A;  5E75 A;  4AEZ C;  3Q47 B;  2IO3 C;  4GPM A;  3V31 A;  1LF8 A;  4HRM B;  4PUC A;  2XEN A;  4IN3 B;  3FU0 A;  3CVU A;  2WXJ A;  2YIN A;  5ENT D;  4UUC A;  1UOH A;  4U07 A;  3FTS A;  3ONL A;  2WXF A;  5JJ6 A;  3QB2 A;  3CVQ A;  1WY6 A;  2IY0 C;  1ELR A;  5E76 A;  1TNO A;  1TJC A;  4U04 A;  3Q9U C;  2MYO A;  3FTX A;  2YQ8 A;  4YVQ C;  3JQ0 A;  4EZJ A;  2OOE A;  3GYZ A;  3ASN E;  5FQ6 A;  3HDX A;  1JCS A;  4OVU A;  1N0Q A;  4ACK A;  5CRV A;  4J6I A;  4APO A;  5FQ4 A;  3AG2 E;  3JYS A;  4L23 A;  1YCS B;  3EDT B;  3EU9 A;  3SFZ A;  4CDN A;  3GZ1 A;  3CST A;  5EX0 A;  3HYM B;  2KM4 A;  2JAB A;  2GGF A;  3ZGQ A;  4J8Y A;  1O1T A;  3Q15 A;  4N2Q A;  4WNF A;  4JA9 A;  2VTB A;  4B8C B;  4JC8 A;  3CIA A;  1V54 E;  2LXM A;  1MX4 A;  3QKY A;  1S63 A;  1H6O A;  1IHG A;  3FUM A;  3I4R B;  1JWG A;  2LUH A;  4HNA D;  4U0Z A;  2LAH A;  3ZVV A;  4GYY A;  4I1O B;  2MHK A;  5CCL A;  3RRU A;  4MLP A;  5M72 A;  1WAO 1;  2R5S A;  3FUE A;  4DUI A;  1MJ0 A;  2J8S D;  3TWV A;  3O4Z A;  4XI9 A;  4A1S A;  1N4R A;  4M7C A;  3Q75 A;  4LG6 A;  3V2X A;  4CYM D;  2A5U A;  3LVQ E;  4UI9 K;  3CHQ A;  4I6G A;  2C0M A;  5CMY A;  4URK A;  3MA5 A;  3ONK A;  3SBT B;  3KD7 A;  3UI2 A;  4CT0 A;  3FFL A;  3IV0 A;  3PE3 A;  3QNK A;  4LNG A;  5BXO A;  3QJZ A;  1IXV A;  3ESL A;  2E2E A;  5CEC B;  3FTY A;  1H2T C;  2X6H A;  3HXF A;  3FH7 A;  4G26 A;  1OY3 D;  3HRA A;  3AS4 A;  4HLE A;  3FU3 A;  4J8E A;  2HR2 A;  2CHW A;  4Q69 A;  3ULQ A;  3CHP A;  2XRZ A;  4AXH A;  1DNP A;  3JXI A;  2I1K A;  1SZ9 A;  3ASG A;  4EEC A;  4FJZ A;  3CQG B;  3FTU A;  4WWN A;  4W9R A;  1N4S A;  4HRL A;  3EHQ A;  3JUE A;  3VTX A;  4ATZ D;  2A5E A;  2BED A;  1U2V G;  1WM5 A;  3EJN A;  2VSY A;  4N39 A;  3T8M A;  4UI9 J;  4OYS A;  3ZXS A;  4KBQ A;  4TXP A;  3LDZ A;  4HVB A;  3KSQ A;  4BY6 A;  3K9I A;  5G2N A;  5FZS A;  2WXI A;  2XCC A;  1EYH A;  2EQX A;  2ION A;  2XEV A;  4B0Z A;  2ZIR A;  1OWL A;  4J8F A;  4L9P A;  1ZBP A;  3C3Q A;  2LSV A;  3LJ3 A;  3NOG D;  5KJM A;  4IRU A;  3E4B A;  4A63 B;  3TWQ A;  3J5Q B;  5T4Y A;  4NAC A;  4GZC A;  5ENR D;  3QK0 A;  2J4D A;  1ELK A;  1H2U A;  5BXU A;  1K1A A;  4DI4 A;  1OWM A;  3KEA A;  2R05 A;  4N5C A;  1TNZ A;  2X38 A;  3CVY A;  5FZR A;  1LTX A;  4GB9 A;  3EIQ C;  4NIK A;  4DX5 D;  4FLB A;  2FEZ A;  4CEM A;  2GW1 A;  4HS2 A;  1SVX A;  2DZN A;  4JA7 A;  4JHR A;  4KVM A;  4N3B A;  2KZT A;  3L17 A;  3NF1 A;  1MHQ A;  3CVP A;  4DX1 A;  4O1O A;  5CBN A;  4KZ0 A;  4N3A A;  3DRA A;  2JLB A;  5J90 A;  3D9M A;  4XI0 A;  5FTP A;  2J49 A;  2L9B A;  3HXD A;  5BUZ A;  3Q73 A;  4HQD A;  1HE8 A;  3CVW A;  3LVR E;  5CER B;  1DC2 A;  2RFA A;  1KLX A;  2P9L G;  4XX5 A;  3DWL G;  3RSE G;  2L0I A;  4ANU A;  4LNU D;  4LEU A;  2XPZ A;  2IO2 C;  2YHE A;  2IU1 A;  2EIN E;  3Q49 B;  2NXP A;  5BV1 A;  3FY4 A;  3CVN A;  1SA4 A;  1OUV A;  4E6H A;  1BLX B;  2P9I G;  3SBS A;  4K5A B;  3AU5 A;  3ZYL A;  5A23 A;  1GW6 A;  4F1S A;  3ENE A;  3Q79 A;  3QWP A;  2KCL A;  2LSU A;  3PH0 C;  2WQH A;  5FIO A;  4ATG A;  4J7W A;  4GTV A;  3AU4 A;  2WPV A;  1ZB1 A;  4CRW A;  2HO1 A;  2WXP A;  3TWT A;  4M3O A;  1D8D A;  3TJP A;  1TYQ G;  2JEK A;  4IUL A;  2X6I A;  5G04 C;  5AAO A;  5A7D B;  4UWK A;  5ENQ D;  3FP3 A;  5ARF A;  1Y8M A;  5EYL A;  3U64 A;  5CHE E;  4F1P A;  4RQI A;  3URZ A;  3G2S A;  2J09 A;  2V5F A;  2DYS E;  3B7R L;  3E34 A;  5LCW J;  4YDY A;  3TXM A;  4FUL A;  3AG4 E;  2IFU A;  3LY8 A;  3UM3 A;  2DBA A;  4U8H A;  1DCE A;  5T8I A;  4F7A A;  1TN8 A;  3MYV A;  4BFR A;  2CFU A;  3PNL B;  3RAU A;  2DVW A;  3EU5 A;  1KPS B;  4FLH A;  4KYO B;  3DPD A;  4GTQ A;  5B1B E;  4K5C A;  4HOQ A;  2J07 A;  3EUV A;  3CEQ A;  4HBD A;  3HG0 D;  3J5P A;  4YND A;  4B93 B;  3B13 A;  1N9A A;  2XPY A;  2LXL A;  5CEA A;  1MX6 A;  2J9Q A;  2XGS A;  3GZS A;  1U3D A;  2GRR B;  2B0O E;  5EN5 D;  1E90 A;  1N11 A;  2IF4 A;  5G05 J;  4CZ2 D;  4G24 A;  5AN8 A;  4I1A A;  2NYJ A;  2F8X K;  3VLF A;  5BPP A;  4HFG A;  4JEH A;  3LYA A;  4I1M A;  3ASO E;  2OEV A;  3DXM G;  2Y69 E;  2XQ0 A;  3ZW3 A;  5AQA A;  4GCN A;  4UWH A;  5FQ8 A;  3MV3 B;  1QQE A;  2WMN A;  3UT8 A;  1SW6 A;  2QYJ A;  3N71 A;  2FUL A;  5D66 A;  4GYO A;  3T5X A;  3UIO C;  3D9P A;  2WXG A;  4F3V A;  3W9G A;  3QAR A;  3DXK G;  2PZI A;  4QQI A;  3HXC A;  3RO3 A;  3IXE A;  1MQS A;  4K0R A;  3UIP C;  3DSV A;  5ITZ F;  3FUH A;  4E85 A;  4ILG A;  2X3M A;  1WG0 A;  2DIW A;  3L54 A;  4RLY A;  2FO1 E;  2FO7 A;  2AVP A;  1NZN A;  2BKG A;  2ILR A;  4NQ0 A;  4PS3 A;  4TUU A;  1W3B A;  1H6P A;  2PQR A;  3DBS A;  2DCP A;  1VDY A;  2OVB A;  4GZ5 A;  4NUR A;  3PRE A;  3D9K A;  3ULY A;  1IKN D;  1ELW A;  4G25 A;  2UY1 B;  4HOR A;  3TG4 A;  3PE4 A;  3RIB A;  5JHA A;  1PY1 A;  2XGM A;  5ARG A;  4ZFH A;  1YA0 A;  2CG2 A;  3KSL A;  4UWL A;  3V30 A;  3CVL A;  4OAV B;  3DPY A;  3DEO A;  3G2T A;  1N52 A;  2M63 A;  1OT8 A;  3FDH A;  1IYG A;  3B95 A;  3CHO A;  2ETA A;  3D9O A;  2HM8 A;  4GTO A;  3LJN A;  2AXV A;  3ZRH A;  1RZ4 A;  3R9M A;  5KJK A;  2BUG A;  3PEU B;  5HI7 A;  3ASD A;  2V8S E;  1N4Q A;  1UG3 A;  4DRX E;  1YYH A;  4CDM A;  3KEZ A;  4BET A;  2XCB A;  4HLL A;  4IYP A;  4HI9 A;  3MJW A;  4U0U A;  3BG0 B;  3TG5 A;  2NC9 A;  4U8Y D;  3ZNG A;  4AIF A;  4DLO A;  5EID A;  4GMR A;  4UWG A;  1H2V C;  3E32 A;  4JD2 G;  4BTB A;  3HXB A;  3ZU7 B;  3UM2 A;  4CDR A;  5ANR A;  2H6I A;  2ZU6 B;  2PM6 A;  3L82 A;  2RKK A;  1FVF A;  1HH8 A;  3F6Q A;  3E30 A;  2GRP B;  3FTW A;  4ANX A;  4XKC A;  5EDS A;  3BG1 B;  3SFY A;  3L6A A;  3B7U X;  4N5Q A;  4EZL A;  1HS6 A;  4WNE A;  1BU9 A;  2I2O A;  3CGH A;  1SA5 A;  3ZPJ A;  4PH4 B;  4UQX A;  4G23 A;  3AS5 A;  3CKB A;  4LER A;  1QBQ A;  2FI7 A;  3ML8 A;  1QYM A;  4EPZ A;  4TXQ A;  2XZT G;  3QAQ A;  5JHB A;  3C3O A;  5EYP F;  3CVX A;  1K8K G;  4RG9 A;  3CLJ A;  4K03 A;  2QZA A;  3MKQ B;  5IY5 E;  2OCC E;  4ILH B;  4MBG A;  1QNF A;  4JPS A;  1N0R A;  1E7V A;  1TNY A;  4YDE A;  4R7L A;  3IHV A;  3L9T A;  4EQF A;  2WXK A;  3HVE B;  5FZQ A;  4JHJ A;  2AJA A;  2R17 C;  5B3S E;  5BNW A;  2VGE A;  4GZ3 A;  4GTP A;  4HXI A;  2CG3 A;  4JXT A;  4BWR A;  1TJF A;  3L13 A;  3SGH A;  2XZD G;  5AQB A;  1UN8 A;  4CGV A;  4U95 D;  1OWO A;  4GTM A;  4PS8 A;  1BPO A;  3OXL A;  2NSZ A;  1XGW A;  4KT6 B;  5G55 A;  3FUI A;  4CGW A;  4GZD A;  2WXM A;  5EIL A;  3ZXP A;  3QWV A;  4KXK B;  2V0P A;  1E7U A;  3HXE A;  4YVO A;  2CFZ A;  3T5V A;  1IHB A;  3R7R A;  3VLE A;  2Y0B G;  2CHX A;  2AXZ A;  1EDU A;  4A55 A;  3NZU A;  5BV0 A;  2ZGD A;  4UI9 C;  4BX9 A;  1LD8 A;  3LXU X;  4J8D A;  2MRI A;  4HI8 A;  4FA6 A;  3UMV A;  2X6J A;  3ZKJ A;  2XEE A;  4D10 C;  3SY2 A;  1Z6T A;  2Y1L E;  3TAX A;  1OCC E;  4JHK A;  2KC7 A;  3PRZ A;  4GU5 A;  3MEK A;  1B89 A;  3FHE A;  1OWP A;  3FWV A;  3C5R A;  1BI7 B;  4XIF A;  4JW1 A;  3U66 A;  4LUN U;  4KVO A;  3Q9N C;  2R03 A;  3NQP A;  5FWQ A;  2I6H A;  2RG8 A;  2WQ6 A;  5AIJ A;  4EZK A;  1PC2 A;  2X6F A;  2WXQ A;  4U63 A;  2WQ7 A;  5HKP A;  2WXO A;  1IQR A;  3ULE G;  4GA2 A;  2I1J A;  1BI8 B;  3B7T A;  3NZS A;  1MX2 A;  3C3R A;  3I3N A;  3CVV A;  3QC1 A;  2KXP C;  5LP0 A;  3FUJ A;  1HO8 A;  1E8X A;  3PZ2 A;  3HIZ A;  4MKT A;  4BT8 A;  4U0S A;  4A3V A;  4C0E A;  3SO8 A;  4CCA A;  3QOU A;  5D0Q D;  5B1A E;  3T8K A;  1PAQ A;  4GTR A;  2QFC A;  3UKR G;  3L08 A;  5KBA A;  4FHJ A;  3AAA C;  2GRN B;  3AJI A;  3DSX A;  3ZFW A;  1HZ4 A;  3LCA A;  4I2W A;  2XPI A;  4B8A A;  2OND A;  4AVX A;  4WNG A;  3G2W A;  1AP7 A;  3FU5 A;  1E8W A;  4H7X A;  5AQ9 A;  3ZUV B;  4L7T A;  4I9C A;  4HOT A;  4WAF A;  3DSS A;  2VGY A;  3QDN A;  2Y4U A;  3WXX A;  1OWN A;  3WG7 E;  3KS2 A;  2J08 A;  1UJK A;  4JB8 P;  1EPU A;  1N94 A;  4WUY A;  1UJJ A;  4J8S A;  4B94 A;  1BD8 A;  1TN6 A;  1JPL A;  4GTS A;  3MX3 A;  4FHK A;  3FUF A;  3FEY A;  2EIJ E;  4WWO A;  1TR4 A;  1MZC A;  3O48 A;  4YDW A;  4DPR A;  1HG5 A;  1D9S A;  2OVF A;  4BES A;  3ASH A;  5HQ8 A;  4ANW A;  4BX8 A;  4L1B A;  3S2A A;  3E37 A;  3U4T A;  4ACL A;  1HFA A;  4A1G A;  2UY1 A;  2F0Y A;  2LO6 A;  4N3C A;  1JCQ A;  4JL0 A;  2WM9 A;  1X5B A;  3PEV B;  3ASF A;  2F37 A;  4GAA A;  4WND A;  2P9P G;  2L6J A;  5KJN A;  3MKR A;  4F6R D;  2FF4 A;  3MV2 B;  3BQO A;  3SFX A;  3UQ3 A;  3TWU A;  3BEE A;  4BT9 A;  3ZHE B;  4AP2 A;  2FBN A;  1G3N B;  4GML A;  5BT1 A;  3ZIM A;  1JWF A;  4DX2 A;  3CV0 A;  4PDX A;  3UIN C;  5JMN D;  4X8Q A;  5D0O D;  1H6K A;  2GRL A;  3S7J A;  2WB2 A;  3RU0 A;  1S0P A;  1Q2Z A;  5G05 C;  1L5J A;  4AOF A;  1YMP A;  1FCH A;  4LSZ E;  1HF8 A;  5KNG A;  4Z68 A;  4APF A;  3LS8 A;  3CSF A;  4XE0 A;  1N95 A;  1OCO E;  2EIM E;  4U7E B;  2I9C A;  1Z3X A;  4O6F A;  3MCX A;  4C0M A;  2KCV A;  3CKC A;  3UUX A;  3U9W A;  5EKQ D;  5DBK A;  1LD7 A;  1NA0 A;  3CQC B;  1HG2 A;  2VGX B;  2KCK A;  5AQ7 A;  3EHM A;  4RVB A;  4FAD A;  3D9I A;  3NOC D;  4FC8 A;  3TWR A;  2IOL A;  1V55 E;  3BUA A;  5KJL A;  2DWZ A;  3UTM A;  1H0A A;  5EIB E;  5FIN A;  3UM0 A;  3Q5M A;  2LNI A;  2P9N G;  4XKB A;  4AV7 A;  1H19 A;  4AY5 A;  5BW8 C;  2WMO A;  2F8Y A;  3OXG A;  5H7P A;  4H7Y A;  3UT4 A;  3EHN A;  5CRU A;  2A4Z A;  2H6G A;  4N2S A;  3IEG A;  1OCR E;  4LNB A;  2OEW A;  1NI1 A;  4ANV A;  3MKQ A;  3ISM C;  2MOW A;  2XS8 A;  5AJD A;  2AW6 A;  3AG1 E;  1NL4 A;  4OVV A;  3G2U A;  3S7D A;  3B7S A;  1TN7 A;  2PNN A;  3RRN B;  1O1R A;  2ZGG A;  3APF A;  3HVE A;  3L16 A;  2YHC A;  4BSX A;  4V3I A;  4GZ6 A;  1N4P A;  5HS0 A;  5EX3 A;  4Y6C A;  4EBA G;  1JCR A;  2V4L A;  4RG6 A;  2ETC A;  4G8K A;  5C2Y A;  1EF1 C;  4HB5 A;  3R9A B;  4C48 B;  2AWI A;  4I9E A; 
#chains in the Genus database with same CATH homology
 3FTZ A;  1U3C A;  4KXK B;  2V0P A;  1E7U A;  4MRU A;  3AU4 A;  4PS7 A;  2WPV A;  3LEW A;  2CFZ A;  3PNT B;  4WWP A;  4YVO A;  4CRW A;  3C98 A;  4Q96 A;  3T5V A;  2HO1 A;  2WXP A;  2YNQ A;  4FJY A;  3R7R A;  3VLE A;  3ZEF A;  3ZYM A;  2CHX A;  4FP7 A;  1XNF A;  1UN9 A;  2AXZ A;  1JUQ A;  4MS6 A;  3CK9 A;  1E8Y A;  1EDU A;  4M3O A;  2XRY A;  2J4B A;  2IQC A;  3P2B A;  3TJP A;  2VSX E;  2JEK A;  4IUL A;  3D9N A;  2X6I A;  4A55 A;  5G04 C;  2VSN A;  3ZYK A;  2WXH A;  3NZU A;  5BV0 A;  3ML9 A;  5A7D B;  4UI9 C;  4UWK A;  2Q7F A;  3FP3 A;  4BX9 A;  5ARF A;  1TEZ A;  3LXU X;  4J8D A;  1Y8M A;  2MRI A;  3U64 A;  4JEU A;  5CHE E;  4FA6 A;  1Y6I A;  4J0U A;  2HYZ A;  5JJT A;  1E96 B;  3UMV A;  2IJG X;  2X6J A;  3G2S A;  3URZ A;  2J09 A;  2V5F A;  3MGB A;  2WVI A;  3B7R L;  3FEX A;  5LCW J;  3GZ2 A;  1HX8 A;  3ESK A;  1FVH A;  3IBE A;  4D10 C;  3TXM A;  3OXF A;  3RJV A;  5E75 A;  4AEZ C;  4FUL A;  1Z6T A;  2IFU A;  3LY8 A;  3Q47 B;  2DBA A;  3SD5 A;  4U8H A;  3FUL A;  4HLE A;  1LF8 A;  3PDN A;  4PUC A;  3TAX A;  2AXU A;  4TRQ A;  5T8I A;  4F7A A;  4IN3 B;  3MYV A;  2OV8 A;  3FU0 A;  4I6J A;  2WXJ A;  4BFR A;  3L22 A;  3CVU A;  4JHK A;  2KC7 A;  2CFU A;  2YIN A;  3PNL B;  3PRZ A;  4GU5 A;  3R7Q A;  4U07 A;  4FLH A;  3MEK A;  1B89 A;  1HU3 A;  3FTS A;  3ONL A;  2WXF A;  1A17 A;  4DJA A;  3FHE A;  5JJ6 A;  1OWP A;  3QB2 A;  4KYO B;  3FWV A;  3CVQ A;  1WY6 A;  3DPD A;  1ELR A;  5E76 A;  4XIF A;  4NRH B;  1TJC A;  3RKV A;  4JW1 A;  4U04 A;  3U66 A;  4LUN U;  4KVO A;  5A6C A;  3FTX A;  4HOQ A;  2J07 A;  3NQP A;  2YQ8 A;  5FWQ A;  2I6H A;  4YVQ C;  2Y4T A;  4CT4 A;  2RG8 A;  3JQ0 A;  3LPZ A;  2WQ6 A;  3CK7 A;  4EZJ A;  3CEQ A;  3IKO B;  3ZN3 A;  2OOE A;  3GYZ A;  5AIJ A;  4EZK A;  1PC2 A;  2X6F A;  5J08 A;  2WXQ A;  5FQ6 A;  3HDX A;  4YND A;  3B13 A;  4U63 A;  4OVU A;  2XPY A;  3FH8 A;  2WQ7 A;  4ACK A;  3VTY A;  2WXO A;  4J6I A;  4APO A;  1IQR A;  5FQ4 A;  4GMJ A;  2J9Q A;  2XGS A;  3GZS A;  1U3D A;  2R59 A;  3JYS A;  1E8Z A;  4L23 A;  5DIZ A;  4GA2 A;  2I1J A;  3EDT B;  4RSY A;  1E90 A;  1NP7 A;  2IF4 A;  5G05 J;  3SFZ A;  2QY7 A;  4CDN A;  4G24 A;  3ZYQ A;  1SZA A;  3B7T A;  3NZS A;  3GZ1 A;  2VTB B;  3CST A;  4I1A A;  5EX0 A;  3CK8 A;  3VLF A;  3HYM B;  3LKU A;  2KM4 A;  3I3N A;  3CVV A;  3QC1 A;  4HFG A;  5BPP A;  1QZ2 A;  2GGF A;  4JEH A;  3LYA A;  3ZGQ A;  4I1M A;  3Q15 A;  5LP0 A;  4HOS A;  3AS8 A;  4N2Q A;  4WNF A;  3FUJ A;  3TL5 A;  4JA9 A;  2XQ0 A;  1HO8 A;  5LOZ A;  2VTB A;  4B8C B;  2PL2 A;  1E8X A;  2WXR A;  4L2Y A;  4JC8 A;  3ZW3 A;  3HIZ A;  3CIA A;  4UWF A;  4MKT A;  4GA1 A;  3APD A;  4GCN A;  4UWH A;  5FQ8 A;  3QKY A;  5KCM A;  4BT8 A;  3MV3 B;  2PM7 A;  1IHG A;  3FUM A;  4U0S A;  5ENN A;  1QQE A;  3I4R B;  1JWG A;  2WMN A;  3UT8 A;  4A3V A;  4U0Z A;  4C0E A;  4CCA A;  3QOU A;  2LAH A;  5D0Q D;  3N71 A;  2FUL A;  2RD0 A;  3TGO A;  1PAQ A;  4GYY A;  4GYO A;  3RRM B;  3UT7 A;  3ZVV A;  3T5X A;  4I6E A;  2QFC A;  3D9P A;  2MHK A;  4I1O B;  2WXG A;  2VSO E;  4F3V A;  5CCL A;  3RRU A;  3QAR A;  3L08 A;  4MLP A;  5M72 A;  1WAO 1;  2R5S A;  2PZI A;  3FUE A;  4FHJ A;  4P29 A;  4EBA A;  3O4Z A;  3FUN A;  3RO3 A;  4AJW A;  4XI9 A;  4G1T A;  3ZFW A;  1HZ4 A;  1MQS A;  3FTV A;  4K0R A;  4A1S A;  3LCA A;  4I2W A;  2P58 C;  3FUH A;  2XPI A;  4E85 A;  4ILG A;  4B8A A;  3FH5 A;  2E0I A;  1INZ A;  2OND A;  4AVX A;  2X3M A;  4WNG A;  3G2W A;  2DIW A;  3L54 A;  3FU5 A;  1E8W A;  1ZU2 A;  2A5U A;  2FO7 A;  3LVQ E;  4H7X A;  5AJL A;  3JCK C;  4UI9 K;  2AVP A;  3CHQ A;  4TV3 A;  1NZN A;  2ILR A;  4L7T A;  2KAT A;  4NQ0 A;  4I9C A;  4I6G A;  4LRZ A;  4PS3 A;  4G11 A;  2C0M A;  4TUU A;  4HOT A;  3PUJ A;  5CMY A;  4URK A;  4WAF A;  3D9L A;  3G2V A;  2VGY A;  3QDN A;  3MA5 A;  2Y4U A;  3ONK A;  3WXX A;  1W3B A;  3SBT B;  3KD7 A;  3VLD A;  1OWN A;  4CT0 A;  3FFL A;  3KS2 A;  2J08 A;  3IV0 A;  3PE3 A;  4DK5 A;  3S7F A;  1UJK A;  2PQR A;  3SF4 A;  3DBS A;  3QNK A;  2DCP A;  1VDY A;  3I4G A;  1EPU A;  2OVB A;  3QWW A;  3QJZ A;  4GZ5 A;  4WUY A;  1UJJ A;  4NUR A;  3ESL A;  4J8S A;  4L2L A;  2E2E A;  3PRE A;  1JPL A;  2VJ8 A;  4B94 A;  3MX3 A;  4FHK A;  2XGO A;  3U3W A;  3FTY A;  4DLQ A;  3D9K A;  3FUF A;  1H2T C;  3FEY A;  2X6H A;  3OAW A;  3FH7 A;  4G26 A;  4WWO A;  3RK6 A;  3PS6 A;  3AS4 A;  1ELW A;  3D3M A;  4G25 A;  3FU3 A;  3O48 A;  3PZD A;  4J8E A;  2HR2 A;  4DPR A;  2CHW A;  1HG5 A;  2UY1 B;  2OVF A;  3CHR A;  3ULQ A;  4Q69 A;  3CHP A;  2XRZ A;  2BF0 X;  3UPV A;  4HOR A;  3ASH A;  1Z3Y A;  1DNP A;  5ANL A;  4AXH A;  5HQ8 A;  4ANW A;  4BX8 A;  2I1K A;  3TG4 A;  3PE4 A;  3RIB A;  1SZ9 A;  4L1B A;  3S2A A;  5JHA A;  3ASG A;  4EEC A;  1PY1 A;  3KAE A;  2XGM A;  4Q94 A;  5ARG A;  3U4T A;  4FJZ A;  3CQG B;  2WXL A;  3EIJ A;  1YA0 A;  3FTU A;  1HFA A;  4ACL A;  4A1G A;  4WWN A;  4W9R A;  2UY1 A;  2CG2 A;  4UWL A;  3CHS A;  2LO6 A;  4Y6W A;  4N3C A;  5CMW A;  3CVL A;  2L0T B;  4JL0 A;  4AM9 A;  2WM9 A;  1X5B A;  1N54 A;  2VQ2 A;  5AYW D;  3G2T A;  3VTX A;  4JZY A;  4HOU A;  3PEV B;  1N52 A;  2M63 A;  3ASF A;  4GAA A;  4WND A;  5LFA A;  2L6J A;  3FDH A;  5KJN A;  1IQU A;  1WM5 A;  3EJN A;  5G04 J;  2VSY A;  4N39 A;  1IYG A;  3MKR A;  3T8M A;  3CHO A;  4UI9 J;  2FF4 A;  4OYS A;  3ZXS A;  3D9O A;  5LX8 A;  1HXI A;  4KBQ A;  2HM8 A;  2UWJ G;  3MV2 B;  2WXN A;  4AY6 A;  3UQ3 A;  3LDZ A;  2AXV A;  4HVB A;  3BEE A;  3ZRH A;  4BT9 A;  2LAI A;  4BY6 A;  3ZHE B;  5KJK A;  2BUG A;  3PEU B;  5HI7 A;  3ASD A;  3K9I A;  5G2N A;  5FZS A;  4AP2 A;  2V8S E;  2WXI A;  4I17 A;  2FBN A;  2IOS A;  4ILI A;  4GML A;  2XCC A;  1EYH A;  5BT1 A;  5JJ7 A;  2EQX A;  2ION A;  4F53 A;  3SZ7 A;  1UG3 A;  2XEV A;  4ME2 A;  4CDM A;  3KEZ A;  4B0Z A;  3ZIM A;  1JWF A;  3IHY A;  1OWL A;  4J8F A;  3ZHE A;  3LY9 A;  1ZBP A;  2XCB A;  4UQY A;  3CV0 A;  4PDX A;  2LSV A;  3LJ3 A;  1NA3 A;  3SI5 A;  4A3T A;  4C9B B;  5T3R A;  4IRU A;  5KJM A;  3E4B A;  4IYP A;  3CHM A;  3MJW A;  4U0U A;  3BG0 B;  3TG5 A;  2PQN A;  3FU6 A;  4NAC A;  3P1U A;  4GZC A;  1H6K A;  5D0O D;  2GRL A;  2NC9 A;  5T4Y A;  3S7B A;  3QK0 A;  1KT0 A;  2J4D A;  3S7J A;  4AIF A;  1ELK A;  1H2U A;  2WB2 A;  4DLO A;  3RU0 A;  3PVL A;  4UWG A;  1H2V C;  1P5Q A;  4DI4 A;  1S0P A;  1OWM A;  4BTB A;  5G05 C;  4B89 A;  1L5J A;  4AOF A;  3FUK A;  4KZC A;  2VYI A;  4N5C A;  4CDR A;  1FCH A;  1HF8 A;  5ANR A;  2ZU6 B;  2X38 A;  3CR3 A;  4APF A;  3LS8 A;  3CSF A;  2GRM A;  1UW4 B;  2PM6 A;  4XE0 A;  4JVS A;  3CVY A;  3PUK A;  5FZR A;  1FVF A;  1HH8 A;  2C2L A;  3FTW A;  4GB9 A;  4ANX A;  3Q4A B;  3EIQ C;  4QFV A;  4XKC A;  2I9C A;  5EDS A;  4KMO A;  3BG1 B;  1Z3X A;  4FLB A;  2FEZ A;  2KZT B;  4CEM A;  3L6A A;  4O6F A;  3MCX A;  3B7U X;  2GW1 A;  2BTD A;  4HS2 A;  4C0M A;  1HS6 A;  2KCV A;  3GW4 A;  4EZL A;  5AEN A;  3CKC A;  3APC A;  4WNE A;  1SQM A;  4GPK A;  4JA7 A;  2I2O A;  3CGH A;  3UUX A;  3U9W A;  4G2V A;  5EKQ D;  5DBK A;  3SNX A;  1KT1 A;  3ZPJ A;  1NA0 A;  4JHR A;  3CQC B;  1HG2 A;  4FU3 A;  4KVM A;  2VGX B;  2KZT A;  4N3B A;  4PH4 B;  4UQX A;  2KCK A;  4G23 A;  3EHM A;  4RVB A;  4FAD A;  3D9I A;  3AS5 A;  3L17 A;  3NF1 A;  4FC8 A;  1MHQ A;  3CVP A;  3CKB A;  4LER A;  2FI7 A;  3ML8 A;  2IOL A;  4EPZ A;  2XHE A;  5KJL A;  1H0A A;  4GA0 A;  3QAQ A;  5JHB A;  4KZ0 A;  3Q5M A;  4N3A A;  2LNI A;  2VGX A;  4XKB A;  4AV7 A;  1H19 A;  4AY5 A;  2JLB A;  4ABN A;  5J90 A;  3SHF A;  3CVX A;  3D9M A;  4XI0 A;  5FTP A;  5BW8 C;  2CHZ A;  2WMO A;  2J49 A;  4RG9 A;  3UX4 A;  3CLJ A;  3OXG A;  2L9B A;  3OTN A;  4K03 A;  4H7Y A;  4LCT A;  2Y3A A;  3RO2 A;  3MKQ B;  3UT4 A;  5BUZ A;  3EHN A;  3LY7 A;  1HE8 A;  4UQZ A;  4ILH B;  1QNF A;  2A4Z A;  3CVW A;  3LVR E;  4I43 A;  4N2S A;  1KLX A;  4XX5 A;  5LCW C;  4JPS A;  3IEG A;  1E7V A;  4I2Z A;  2L0I A;  1DVP A;  3IHV A;  4R7L A;  4ANV A;  4ANU A;  5C1D A;  4GYW A;  3MKQ A;  4EQF A;  2MOW A;  2WXK A;  4LEU A;  2XPZ A;  2YHE A;  3HVE B;  5FZQ A;  5AJD A;  4JHJ A;  2IU1 A;  3Q49 B;  4GCO A;  2AW6 A;  2R17 C;  5BNW A;  2NXP A;  4DI3 A;  4OVV A;  5BV1 A;  3G2U A;  3FY4 A;  4GZ3 A;  3S7D A;  3B7S A;  3CVN A;  3RRN B;  5FQ7 A;  4HXI A;  4BTA A;  1OUV A;  3TXN A;  4E6H A;  2CG3 A;  4JXT A;  3APF A;  3I5P A;  3HVE A;  3SBS A;  1TJF A;  4BWR A;  3L13 A;  3SGH A;  5FJY A;  3AU5 A;  1UN8 A;  3ZYL A;  3MZL B;  4CGV A;  3L16 A;  2YHC A;  5A23 A;  4BSX A;  1OWO A;  4PS8 A;  4GZ6 A;  4V3I A;  5CCM A;  5EX3 A;  1GW6 A;  1BPO A;  4Y6C A;  4EBA G;  4F1S A;  3OXL A;  2NSZ A;  3D9J A;  3ENE A;  1XGW A;  2V4L A;  4RG6 A;  5C2Y A;  4KT6 B;  3FUD A;  1EF1 C;  5G55 A;  2C0L A;  3JQ1 A;  3QWP A;  3FUI A;  4CGW A;  2KCL A;  2LSU A;  4GZD A;  3JUI A;  3PH0 C;  2WXM A;  3R9A B;  2WQH A;  2AWI A;  4ATG A;  2X6K A;  4I9E A;  3HHM A;  4XZ4 A;  5FT9 A;  3QWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...