2KCXA

Solution nmr structure of kazal-1 domain of human follistatin-related protein 3 (fstl-3). northeast structural genomics target hr6186a.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
74
structure length
74
Chain Sequence
SDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Follistatin-related protein 3
publication title Solution NMR Structure of Kazal-1 Domain of Human Follistatin-related protein 3 (FSTL-3). Northeast Structural Genomics Target HR6186A.
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 14
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2kcxA00
1SGRI 1BUSA 1BMOA 3SGBI 1NUBA 1CGII 1CSOI 1TURA 4OVOA 1YU6C 1LR9A 1TIHA 1SGYI 2SGDI 1HJAI 2N71A 2SGFI 1MT1A 1OMTA 1UVFA 2M5XA 3HH2C 1UUCA 1N13A 5JHWC 4HGUA 2NU2I 2JZMA 1Y1CA 1IY5A 1SGNI 3SGQI 3QTLD 1TUSA 1DS3I 1FYBA 1CT2I 1UVGA 2JXDA 1CT4I 1Z7KB 1Y1BA 5DAEA 1PPFI 1SGEI 1CHOI 3OVOA 2JYYA 1SGDI 1SGPI 1KMAA 1LR8A 1OMUA 2N52A 2NU4I 2GKVA 2NU1I 2QQCA 2GKTI 2QQDA 1YTPA 2P6AC 1H0ZA 1PCEA 2KMPA 3SEKC 1CE3A 2SGPI 1CT0I 2XRCA 2ERWA 2GKRI 2F3CI 2KCXA 1AN1I 2KMRA 2NU3I 1SGQI 2ARPF 1CGJI 1OYVI 1LR7A 1M8CA 1HDLA 2B0UC 1IW4A 2BUSA 1R0RI 2V53A 1DS2I 2LEOA 1TBRR 2OVOA 4GI3C 2WCYA 1IY6A 2SGQI 4SGBI 1M8BA 3TJQA 2NU0I 1PJUA 1TGSI 2N17A 2SGEI 1OVOA 3B4VC 2KMOA 1TBQR 1HPTA 2KMQA
chains in the Genus database with same CATH superfamily
3OXLA 1SGRI 1WGCA 1BUSA 1TBNA 1BMOA 3SGBI 3TOBA 1NUBA 1CGII 1CSOI 2V1CC 1TURA 3UEYA 1RFHA 5FUVA 2PQ8A 3MEKA 1XX6A 4OVOA 1W3SA 1YU6C 3OXFA 4E1RA 1LR9A 1TIHA 1SGYI 3R5DA 2SGDI 3VE5A 1ULKA 1HJAI 5FUYA 2N71A 2ROWA 2SGFI 1MT1A 1OMTA 2L8EA 1UVFA 2M5XA 1FY7A 2GVIA 1HEVA 3HH2C 1UUCA 1K7TA 1N13A 5JHWC 2OU2A 3R5AA 2DIPA 2JA1A 3TO7A 4HGUA 4A24A 2CWHA 2NU2I 3R5BA 2ENZA 2JZMA 2J9RA 4JCVE 1Y1CA 1IY5A 2A20A 2ENNA 1SGNI 2N1AB 3SGQI 3FSYA 2QPOA 3QTLD 1TUSA 1DS3I 1FYBA 1CT2I 1UVGA 3VDPA 3UEJA 4MPIA 2JXDA 2K9HA 3KY9A 2QQ0A 1CT4I 4AMLA 1Z7KB 1Y1BA 3TO6A 5DAEA 3FC3A 2DB6A 2ORVA 2FNFX 1PPFI 5HQ8A 1SGEI 2UVOA 1X74A 3E59A 1CHOI 3PDNA 2X3TA 7WGAA 1PTRA 2JW6A 3D00A 2CWGA 2WGCA 3OVOA 3UOEA 3E2IA 2JYYA 1SGDI 1XA6A 5FUWA 1SGPI 4UXJA 3QAHA 1KMAA 2L7XA 4UXIA 1LR8A 1Y8FA 1OMUA 1WKXA 2N52A 2NU4I 2UZ3A 2X52A 2RIJA 3VDUA 1Q9BA 5CCMA 2GKVA 2NU1I 5E3RA 5HI7A 2LB7A 2QQCA 3UFFA 3UGDA 2ELIA 2GKTI 2J87A 1UHAA 1P9GA 4FKDA 2QQDA 3TO9A 1WGTA 5E3QA 1NXUA 1YTPA 2E5RA 2P6AC 1PCEA 5EX3A 2KMPA 3SEKC 3GOXA 1H0ZA 1CE3A 2SGPI 4WP4A 1CT0I 2XRCA 2ERWA 2GKRI 1FARA 2F3CI 1TOTA 2KCXA 1AN1I 1U5KA 9WGAA 2KMRA 5J8FA 2NU3I 5EX0A 1WTJA 1MJAA 1SGQI 1W4RA 2ARPF 4E1PA 1V1HA 1CGJI 1OYVI 1LR7A 3FSXA 3OL0A 1X4SA 2YUUA 3TOAA 1M8CA 4DNCA 1VDDA 2E73A 2WVJA 1HDLA 3CXLA 3R5CA 1MJ9A 4B6DA 2B0UC 5E3PA 1IW4A 3OXGA 5CCLA 2OD1A 2BUSA 1R0RI 2V53A 2ODDA 1PTQA 2Y0MA 3QWPA 1DS2I 4L9MA 2B8TA 2LEOA 3BJIA 4UXHA 1S20A 1TBRR 5J8CA 2OVOA 3UGLA 4GI3C 5FUXA 1FAQA 1Z2IA 2VRWB 2WCYA 1IY6A 2OZUA 1KBFA 2YQPA 1K7UA 2RC4A 1M8BA 2SGQI 2W0TA 4SGBI 3TJQA 1KBEA 3UGIA 3RU0A 1PJUA 2N17A 1TBOA 1TGSI 2NU0I 2ORWA 1ULNA 2V1CA 1P9ZA 1XBTA 2CJSC 1K7VA 1R79A 1ULMA 2LUYA 1OVOA 1MJBA 2CWFA 2GIVA 2QQEA 2SGEI 3B4VC 2DKVA 2KMOA 1V1IA 1TBQR 1HPTA 2KMQA
chains in the Genus database with same CATH topology
3OXLA 1SGRI 1BUSA 1TBNA 1BMOA 3SGBI 1NUBA 1CGII 1CSOI 2V1CC 1TURA 3UEYA 1RFHA 5FUVA 3MEKA 1XX6A 4OVOA 1W3SA 1YU6C 3OXFA 4E1RA 1LR9A 1TIHA 1SGYI 2SGDI 3VE5A 5FUYA 1HJAI 2N71A 2ROWA 2SGFI 1MT1A 1OMTA 2L8EA 1UVFA 2M5XA 2GVIA 3HH2C 1UUCA 1N13A 5JHWC 4A24A 2DIPA 2JA1A 4HGUA 2NU2I 2ENZA 2JZMA 2J9RA 4JCVE 1Y1CA 1IY5A 2A20A 2ENNA 1SGNI 2N1AB 3SGQI 2QPOA 3QTLD 1TUSA 1DS3I 1FYBA 1CT2I 1UVGA 3VDPA 3UEJA 2JXDA 2K9HA 3KY9A 2QQ0A 1CT4I 1Z7KB 1Y1BA 5DAEA 3FC3A 2DB6A 2ORVA 2FNFX 1PPFI 5HQ8A 1SGEI 1X74A 3E59A 1CHOI 3PDNA 1PTRA 2JW6A 3D00A 3OVOA 3E2IA 2JYYA 1SGDI 1XA6A 5FUWA 1SGPI 4UXJA 1KMAA 2L7XA 4UXIA 1LR8A 1Y8FA 1OMUA 2N52A 2NU4I 2UZ3A 5CCMA 3VDUA 2GKVA 2NU1I 5HI7A 2QQCA 3UFFA 3UGDA 2ELIA 2GKTI 2J87A 4FKDA 2QQDA 1YTPA 2E5RA 2P6AC 1PCEA 5EX3A 2KMPA 3SEKC 3GOXA 1H0ZA 1CE3A 2SGPI 1CT0I 2XRCA 2ERWA 2GKRI 1FARA 2F3CI 1TOTA 2KCXA 1AN1I 1U5KA 2KMRA 2NU3I 4E1PA 1SGQI 1W4RA 2ARPF 1V1HA 1CGJI 1OYVI 1LR7A 3OL0A 1X4SA 2YUUA 1M8CA 1VDDA 2E73A 2WVJA 1HDLA 3CXLA 4B6DA 2B0UC 1IW4A 3OXGA 5CCLA 2OD1A 2BUSA 1R0RI 2V53A 2ODDA 1PTQA 3QWPA 1DS2I 4L9MA 2B8TA 2LEOA 3BJIA 4UXHA 1TBRR 2OVOA 3UGLA 4GI3C 5FUXA 1FAQA 2VRWB 2WCYA 1IY6A 1KBFA 2YQPA 2SGQI 2W0TA 1M8BA 4SGBI 3TJQA 1KBEA 3UGIA 3RU0A 1PJUA 2N17A 1TBOA 1TGSI 2NU0I 2ORWA 2V1CA 1XBTA 2CJSC 1R79A 2QQEA 2SGEI 2LUYA 1OVOA 5EX0A 3B4VC 2KMOA 1V1IA 1TBQR 1HPTA 2KMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGR I;  1BUS A;  1BMO A;  3SGB I;  1NUB A;  1CGI I;  1CSO I;  1TUR A;  4OVO A;  1YU6 C;  1LR9 A;  1TIH A;  1SGY I;  2SGD I;  1HJA I;  2N71 A;  2SGF I;  1MT1 A;  1OMT A;  1UVF A;  2M5X A;  3HH2 C;  1UUC A;  1N13 A;  5JHW C;  4HGU A;  2NU2 I;  2JZM A;  1Y1C A;  1IY5 A;  1SGN I;  3SGQ I;  3QTL D;  1TUS A;  1DS3 I;  1FYB A;  1CT2 I;  1UVG A;  2JXD A;  1CT4 I;  1Z7K B;  1Y1B A;  5DAE A;  1PPF I;  1SGE I;  1CHO I;  3OVO A;  2JYY A;  1SGD I;  1SGP I;  1KMA A;  1LR8 A;  1OMU A;  2N52 A;  2NU4 I;  2GKV A;  2NU1 I;  2QQC A;  2GKT I;  2QQD A;  1YTP A;  2P6A C;  1H0Z A;  1PCE A;  2KMP A;  3SEK C;  1CE3 A;  2SGP I;  1CT0 I;  2XRC A;  2ERW A;  2GKR I;  2F3C I;  2KCX A;  1AN1 I;  2KMR A;  2NU3 I;  1SGQ I;  2ARP F;  1CGJ I;  1OYV I;  1LR7 A;  1M8C A;  1HDL A;  2B0U C;  1IW4 A;  2BUS A;  1R0R I;  2V53 A;  1DS2 I;  2LEO A;  1TBR R;  2OVO A;  4GI3 C;  2WCY A;  1IY6 A;  2SGQ I;  4SGB I;  1M8B A;  3TJQ A;  2NU0 I;  1PJU A;  1TGS I;  2N17 A;  2SGE I;  1OVO A;  3B4V C;  2KMO A;  1TBQ R;  1HPT A;  2KMQ A; 
#chains in the Genus database with same CATH topology
 3OXL A;  1SGR I;  1WGC A;  1BUS A;  1TBN A;  1BMO A;  3SGB I;  3TOB A;  1NUB A;  1CGI I;  1CSO I;  2V1C C;  1TUR A;  3UEY A;  1RFH A;  5FUV A;  2PQ8 A;  3MEK A;  1XX6 A;  4OVO A;  1W3S A;  1YU6 C;  3OXF A;  4E1R A;  1LR9 A;  1TIH A;  1SGY I;  3R5D A;  2SGD I;  3VE5 A;  1ULK A;  1HJA I;  5FUY A;  2N71 A;  2ROW A;  2SGF I;  1MT1 A;  1OMT A;  2L8E A;  1UVF A;  2M5X A;  1FY7 A;  2GVI A;  1HEV A;  3HH2 C;  1UUC A;  1K7T A;  1N13 A;  5JHW C;  2OU2 A;  3R5A A;  2DIP A;  2JA1 A;  3TO7 A;  4HGU A;  4A24 A;  2CWH A;  2NU2 I;  3R5B A;  2ENZ A;  2JZM A;  2J9R A;  4JCV E;  1Y1C A;  1IY5 A;  2A20 A;  2ENN A;  1SGN I;  2N1A B;  3SGQ I;  3FSY A;  2QPO A;  3QTL D;  1TUS A;  1DS3 I;  1FYB A;  1CT2 I;  1UVG A;  3VDP A;  3UEJ A;  4MPI A;  2JXD A;  2K9H A;  3KY9 A;  2QQ0 A;  1CT4 I;  4AML A;  1Z7K B;  1Y1B A;  3TO6 A;  5DAE A;  3FC3 A;  2DB6 A;  2ORV A;  2FNF X;  1PPF I;  5HQ8 A;  1SGE I;  2UVO A;  1X74 A;  3E59 A;  1CHO I;  3PDN A;  2X3T A;  7WGA A;  1PTR A;  2JW6 A;  3D00 A;  2CWG A;  2WGC A;  3OVO A;  3UOE A;  3E2I A;  2JYY A;  1SGD I;  1XA6 A;  5FUW A;  1SGP I;  4UXJ A;  3QAH A;  1KMA A;  2L7X A;  4UXI A;  1LR8 A;  1Y8F A;  1OMU A;  1WKX A;  2N52 A;  2NU4 I;  2UZ3 A;  2X52 A;  2RIJ A;  3VDU A;  1Q9B A;  5CCM A;  2GKV A;  2NU1 I;  5E3R A;  5HI7 A;  2LB7 A;  2QQC A;  3UFF A;  3UGD A;  2ELI A;  2GKT I;  2J87 A;  1UHA A;  1P9G A;  4FKD A;  2QQD A;  3TO9 A;  1WGT A;  5E3Q A;  1NXU A;  1YTP A;  2E5R A;  2P6A C;  1PCE A;  5EX3 A;  2KMP A;  3SEK C;  3GOX A;  1H0Z A;  1CE3 A;  2SGP I;  4WP4 A;  1CT0 I;  2XRC A;  2ERW A;  2GKR I;  1FAR A;  2F3C I;  1TOT A;  2KCX A;  1AN1 I;  1U5K A;  9WGA A;  2KMR A;  5J8F A;  2NU3 I;  5EX0 A;  1WTJ A;  1MJA A;  1SGQ I;  1W4R A;  2ARP F;  4E1P A;  1V1H A;  1CGJ I;  1OYV I;  1LR7 A;  3FSX A;  3OL0 A;  1X4S A;  2YUU A;  3TOA A;  1M8C A;  4DNC A;  1VDD A;  2E73 A;  2WVJ A;  1HDL A;  3CXL A;  3R5C A;  1MJ9 A;  4B6D A;  2B0U C;  5E3P A;  1IW4 A;  3OXG A;  5CCL A;  2OD1 A;  2BUS A;  1R0R I;  2V53 A;  2ODD A;  1PTQ A;  2Y0M A;  3QWP A;  1DS2 I;  4L9M A;  2B8T A;  2LEO A;  3BJI A;  4UXH A;  1S20 A;  1TBR R;  5J8C A;  2OVO A;  3UGL A;  4GI3 C;  5FUX A;  1FAQ A;  1Z2I A;  2VRW B;  2WCY A;  1IY6 A;  2OZU A;  1KBF A;  2YQP A;  1K7U A;  2RC4 A;  1M8B A;  2SGQ I;  2W0T A;  4SGB I;  3TJQ A;  1KBE A;  3UGI A;  3RU0 A;  1PJU A;  2N17 A;  1TBO A;  1TGS I;  2NU0 I;  2ORW A;  1ULN A;  2V1C A;  1P9Z A;  1XBT A;  2CJS C;  1K7V A;  1R79 A;  1ULM A;  2LUY A;  1OVO A;  1MJB A;  2CWF A;  2GIV A;  2QQE A;  2SGE I;  3B4V C;  2DKV A;  2KMO A;  1V1I A;  1TBQ R;  1HPT A;  2KMQ A; 
#chains in the Genus database with same CATH homology
 3OXL A;  1SGR I;  1BUS A;  1TBN A;  1BMO A;  3SGB I;  1NUB A;  1CGI I;  1CSO I;  2V1C C;  1TUR A;  3UEY A;  1RFH A;  5FUV A;  3MEK A;  1XX6 A;  4OVO A;  1W3S A;  1YU6 C;  3OXF A;  4E1R A;  1LR9 A;  1TIH A;  1SGY I;  2SGD I;  3VE5 A;  5FUY A;  1HJA I;  2N71 A;  2ROW A;  2SGF I;  1MT1 A;  1OMT A;  2L8E A;  1UVF A;  2M5X A;  2GVI A;  3HH2 C;  1UUC A;  1N13 A;  5JHW C;  4A24 A;  2DIP A;  2JA1 A;  4HGU A;  2NU2 I;  2ENZ A;  2JZM A;  2J9R A;  4JCV E;  1Y1C A;  1IY5 A;  2A20 A;  2ENN A;  1SGN I;  2N1A B;  3SGQ I;  2QPO A;  3QTL D;  1TUS A;  1DS3 I;  1FYB A;  1CT2 I;  1UVG A;  3VDP A;  3UEJ A;  2JXD A;  2K9H A;  3KY9 A;  2QQ0 A;  1CT4 I;  1Z7K B;  1Y1B A;  5DAE A;  3FC3 A;  2DB6 A;  2ORV A;  2FNF X;  1PPF I;  5HQ8 A;  1SGE I;  1X74 A;  3E59 A;  1CHO I;  3PDN A;  1PTR A;  2JW6 A;  3D00 A;  3OVO A;  3E2I A;  2JYY A;  1SGD I;  1XA6 A;  5FUW A;  1SGP I;  4UXJ A;  1KMA A;  2L7X A;  4UXI A;  1LR8 A;  1Y8F A;  1OMU A;  2N52 A;  2NU4 I;  2UZ3 A;  5CCM A;  3VDU A;  2GKV A;  2NU1 I;  5HI7 A;  2QQC A;  3UFF A;  3UGD A;  2ELI A;  2GKT I;  2J87 A;  4FKD A;  2QQD A;  1YTP A;  2E5R A;  2P6A C;  1PCE A;  5EX3 A;  2KMP A;  3SEK C;  3GOX A;  1H0Z A;  1CE3 A;  2SGP I;  1CT0 I;  2XRC A;  2ERW A;  2GKR I;  1FAR A;  2F3C I;  1TOT A;  2KCX A;  1AN1 I;  1U5K A;  2KMR A;  2NU3 I;  4E1P A;  1SGQ I;  1W4R A;  2ARP F;  1V1H A;  1CGJ I;  1OYV I;  1LR7 A;  3OL0 A;  1X4S A;  2YUU A;  1M8C A;  1VDD A;  2E73 A;  2WVJ A;  1HDL A;  3CXL A;  4B6D A;  2B0U C;  1IW4 A;  3OXG A;  5CCL A;  2OD1 A;  2BUS A;  1R0R I;  2V53 A;  2ODD A;  1PTQ A;  3QWP A;  1DS2 I;  4L9M A;  2B8T A;  2LEO A;  3BJI A;  4UXH A;  1TBR R;  2OVO A;  3UGL A;  4GI3 C;  5FUX A;  1FAQ A;  2VRW B;  2WCY A;  1IY6 A;  1KBF A;  2YQP A;  2SGQ I;  2W0T A;  1M8B A;  4SGB I;  3TJQ A;  1KBE A;  3UGI A;  3RU0 A;  1PJU A;  2N17 A;  1TBO A;  1TGS I;  2NU0 I;  2ORW A;  2V1C A;  1XBT A;  2CJS C;  1R79 A;  2QQE A;  2SGE I;  2LUY A;  1OVO A;  5EX0 A;  3B4V C;  2KMO A;  1V1I A;  1TBQ R;  1HPT A;  2KMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...