2KCXA

Solution nmr structure of kazal-1 domain of human follistatin-related protein 3 (fstl-3). northeast structural genomics target hr6186a.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
74
structure length
74
Chain Sequence
b'SDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Follistatin-related protein 3
publication title Solution NMR Structure of Kazal-1 Domain of Human Follistatin-related protein 3 (FSTL-3). Northeast Structural Genomics Target HR6186A.
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 14
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2kcxA00
1R0RI 3SEKC 1CGII 2M5XA 2BUSA 1UVFA 1IW4A 2GKRI 1OMUA 1TURA 1CT2I 3TJQA 1OYVI 1M8CA 1TUSA 2JYYA 3HH2C 2KCXA 1TGSI 1IY6A 1MT1A 2P6AC 1UVGA 1H0ZA 1HPTA 1OMTA 1CE3A 1PCEA 1SGQI 1N13A 4SGBI 2KMRA 1Y1CA 1YU6C 2NU3I 2JZMA 1Z7KB 2QQDA 1YTPA 2XRCA 1PJUA 1SGNI 3OVOA 2JXDA 2NU0I 1TBQR 1LR9A 2GKVA 1CGJI 2KMPA 2NU4I 1NUBA 2N71A 3B4VC 2SGFI 2SGEI 1HJAI 1KMAA 2KMQA 1CT4I 1AN1I 1CT0I 3QTLD 1DS2I 1SGRI 2OVOA 2NU1I 1SGEI 2WCYA 1HDLA 4HGUA 1TBRR 1SGYI 5DAEA 4GI3C 3SGBI 1DS3I 1CHOI 2V53A 2N52A 1UUCA 1FYBA 1M8BA 1SGPI 2SGQI 1PPFI 1IY5A 1Y1BA 1SGDI 2NU2I 1OVOA 1TIHA 1LR7A 4OVOA 2QQCA 1BUSA 2ARPF 2ERWA 1LR8A 2F3CI 2SGDI 1BMOA 5JHWC 3SGQI 2N17A 1CSOI 2KMOA 2SGPI 2LEOA 2GKTI 2B0UC
chains in the Genus database with same CATH superfamily
3KY9A 3TO7A 5CCMA 1KBFA 4E1PA 3VDUA 2QQEA 1R0RI 2JA1A 3SEKC 1ULNA 2GIVA 1CGII 3OL0A 2M5XA 2BUSA 1UVFA 1IW4A 2GKRI 1MJ9A 1OMUA 2UZ3A 1TURA 1W4RA 3R5AA 7WGAA 2L7XA 3TO6A 1CT2I 3TJQA 3MEKA 5EX0A 1OYVI 1M8CA 1TUSA 2JYYA 2OU2A 3HH2C 1WTJA 2KCXA 1IY6A 3UGIA 2OZUA 1MT1A 4JCVE 2P6AC 1UVGA 5EX3A 1HPTA 1OMTA 1K7VA 5E3PA 1H0ZA 1P9ZA 4AMLA 2ORWA 1CE3A 1ULKA 1KBEA 3BJIA 4B6DA 1PCEA 5CCLA 1SGQI 1N13A 1R79A 2WGCA 4SGBI 2KMRA 1Y1CA 1YU6C 2NU3I 1PTQA 1P9GA 3UEJA 5J8CA 1V1HA 2JZMA 3GOXA 1S20A 1Z7KB 5FUXA 2QQ0A 2QQDA 2RIJA 1YTPA 3RU0A 2XRCA 3PDNA 1PJUA 1SGNI 3UGLA 3OVOA 2JXDA 5FUVA 2NU0I 3UFFA 1TBQR 3TO9A 3VE5A 1LR9A 2J9RA 2GKVA 3R5DA 2RC4A 1CGJI 1TBNA 2CJSC 2KMPA 3D00A 5E3RA 2N1AB 3TOBA 5HQ8A 2LB7A 1PTRA 2B8TA 2NU4I 1V1IA 3UEYA 1NUBA 2N71A 3B4VC 2SGFI 1UHAA 1WKXA 2SGEI 1HJAI 1KMAA 1W3SA 2KMQA 9WGAA 1Y8FA 1CT4I 2K9HA 4MPIA 4UXIA 1AN1I 2DB6A 1CT0I 2W0TA 2ENNA 3CXLA 1XBTA 1WGTA 3QTLD 5HI7A 2DKVA 1MJBA 1DS2I 1SGRI 2OVOA 2ROWA 2NU1I 1SGEI 2WCYA 3QAHA 4UXJA 1WGCA 2YQPA 3QWPA 1HDLA 4HGUA 3OXGA 2ODDA 4FKDA 2V1CC 5J8FA 3OXLA 2GKTI 3R5BA 1ULMA 2OD1A 2ORVA 1TBRR 1SGYI 3OXFA 5DAEA 2J87A 5FUWA 2X52A 2Y0MA 2CWHA 2UVOA 4GI3C 3SGBI 3UGDA 2CWFA 1DS3I 3E2IA 4WP4A 2B0UC 1CHOI 1FY7A 2V53A 2N52A 1K7TA 1UUCA 1M8BA 1NXUA 5FUYA 1FYBA 1XA6A 1SGPI 2E73A 3UOEA 2V1CA 1XX6A 1FARA 2SGQI 2A20A 3FSYA 1PPFI 2ELIA 3FC3A 1IY5A 1Y1BA 1SGDI 1HEVA 2ENZA 1TBOA 1OVOA 2GVIA 1TIHA 1LR7A 2NU2I 2VRWB 4UXHA 1X4SA 4L9MA 4OVOA 2X3TA 2PQ8A 1RFHA 3E59A 2QQCA 1BUSA 1FAQA 2E5RA 2ARPF 2ERWA 2QPOA 2YUUA 5E3QA 3TOAA 3R5CA 1LR8A 2F3CI 1K7UA 2SGDI 1BMOA 1X74A 1VDDA 5JHWC 1Z2IA 4E1RA 1TOTA 2JW6A 1U5KA 2LUYA 2WVJA 1MJAA 3SGQI 2FNFX 2N17A 1Q9BA 4DNCA 1CSOI 3VDPA 2DIPA 2KMOA 2L8EA 2SGPI 2LEOA 4A24A 2CWGA 3FSXA 1TGSI
chains in the Genus database with same CATH topology
3KY9A 5CCMA 1KBFA 4E1PA 3VDUA 2QQEA 1R0RI 2JA1A 3SEKC 1CGII 3OL0A 2M5XA 2BUSA 1UVFA 1IW4A 2GKRI 1OMUA 2UZ3A 1TURA 1W4RA 2L7XA 1CT2I 3TJQA 3MEKA 5EX0A 1OYVI 1M8CA 1TUSA 2JYYA 3HH2C 1TGSI 2KCXA 3UGIA 1IY6A 1MT1A 4JCVE 2P6AC 1UVGA 5EX3A 1HPTA 1OMTA 1H0ZA 2ORWA 1CE3A 3BJIA 1KBEA 4B6DA 1PCEA 5CCLA 1SGQI 1N13A 1R79A 4SGBI 2KMRA 1Y1CA 1YU6C 2NU3I 1PTQA 3UEJA 1V1HA 2JZMA 3GOXA 1Z7KB 5FUXA 2QQ0A 2QQDA 1YTPA 3RU0A 2XRCA 3PDNA 1PJUA 1SGNI 3UGLA 3OVOA 2JXDA 5FUVA 2NU0I 3UFFA 1TBQR 3VE5A 1LR9A 2J9RA 2GKVA 1CGJI 1TBNA 2CJSC 2KMPA 3D00A 5HQ8A 2N1AB 1PTRA 2B8TA 2NU4I 1V1IA 3UEYA 1NUBA 2N71A 3B4VC 2SGFI 2SGEI 1HJAI 1KMAA 1W3SA 2KMQA 1Y8FA 1CT4I 2K9HA 4UXIA 1AN1I 2DB6A 1CT0I 2W0TA 2ENNA 3CXLA 1XBTA 3QTLD 5HI7A 1DS2I 1SGRI 2OVOA 2ROWA 2NU1I 1SGEI 2WCYA 4UXJA 1HDLA 2YQPA 3QWPA 4HGUA 3OXGA 2ODDA 4FKDA 2V1CC 3OXLA 2OD1A 2ORVA 1TBRR 1SGYI 3OXFA 5DAEA 2J87A 5FUWA 3UGDA 4GI3C 3SGBI 1DS3I 3E2IA 1CHOI 2V53A 2N52A 1UUCA 1FYBA 1M8BA 5FUYA 1XA6A 1SGPI 2E73A 2V1CA 1XX6A 1FARA 2SGQI 2A20A 3FC3A 1PPFI 2ELIA 1IY5A 1Y1BA 1SGDI 2ENZA 1TBOA 1OVOA 2GVIA 1TIHA 1LR7A 2NU2I 2VRWB 4UXHA 1X4SA 4L9MA 4OVOA 1RFHA 3E59A 2QQCA 1BUSA 1FAQA 2E5RA 2ARPF 2ERWA 2QPOA 2YUUA 1LR8A 2F3CI 2SGDI 1BMOA 1X74A 1VDDA 5JHWC 4E1RA 1TOTA 2JW6A 1U5KA 2LUYA 2WVJA 3SGQI 2FNFX 2N17A 1CSOI 3VDPA 2DIPA 2KMOA 2L8EA 2SGPI 2LEOA 4A24A 2GKTI 2B0UC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R0R I;  3SEK C;  1CGI I;  2M5X A;  2BUS A;  1UVF A;  1IW4 A;  2GKR I;  1OMU A;  1TUR A;  1CT2 I;  3TJQ A;  1OYV I;  1M8C A;  1TUS A;  2JYY A;  3HH2 C;  2KCX A;  1TGS I;  1IY6 A;  1MT1 A;  2P6A C;  1UVG A;  1H0Z A;  1HPT A;  1OMT A;  1CE3 A;  1PCE A;  1SGQ I;  1N13 A;  4SGB I;  2KMR A;  1Y1C A;  1YU6 C;  2NU3 I;  2JZM A;  1Z7K B;  2QQD A;  1YTP A;  2XRC A;  1PJU A;  1SGN I;  3OVO A;  2JXD A;  2NU0 I;  1TBQ R;  1LR9 A;  2GKV A;  1CGJ I;  2KMP A;  2NU4 I;  1NUB A;  2N71 A;  3B4V C;  2SGF I;  2SGE I;  1HJA I;  1KMA A;  2KMQ A;  1CT4 I;  1AN1 I;  1CT0 I;  3QTL D;  1DS2 I;  1SGR I;  2OVO A;  2NU1 I;  1SGE I;  2WCY A;  1HDL A;  4HGU A;  1TBR R;  1SGY I;  5DAE A;  4GI3 C;  3SGB I;  1DS3 I;  1CHO I;  2V53 A;  2N52 A;  1UUC A;  1FYB A;  1M8B A;  1SGP I;  2SGQ I;  1PPF I;  1IY5 A;  1Y1B A;  1SGD I;  2NU2 I;  1OVO A;  1TIH A;  1LR7 A;  4OVO A;  2QQC A;  1BUS A;  2ARP F;  2ERW A;  1LR8 A;  2F3C I;  2SGD I;  1BMO A;  5JHW C;  3SGQ I;  2N17 A;  1CSO I;  2KMO A;  2SGP I;  2LEO A;  2GKT I;  2B0U C; 
#chains in the Genus database with same CATH topology
 3KY9 A;  3TO7 A;  5CCM A;  1KBF A;  4E1P A;  3VDU A;  2QQE A;  1R0R I;  2JA1 A;  3SEK C;  1ULN A;  2GIV A;  1CGI I;  3OL0 A;  2M5X A;  2BUS A;  1UVF A;  1IW4 A;  2GKR I;  1MJ9 A;  1OMU A;  2UZ3 A;  1TUR A;  1W4R A;  3R5A A;  7WGA A;  2L7X A;  3TO6 A;  1CT2 I;  3TJQ A;  3MEK A;  5EX0 A;  1OYV I;  1M8C A;  1TUS A;  2JYY A;  2OU2 A;  3HH2 C;  1WTJ A;  2KCX A;  1IY6 A;  3UGI A;  2OZU A;  1MT1 A;  4JCV E;  2P6A C;  1UVG A;  5EX3 A;  1HPT A;  1OMT A;  1K7V A;  5E3P A;  1H0Z A;  1P9Z A;  4AML A;  2ORW A;  1CE3 A;  1ULK A;  1KBE A;  3BJI A;  4B6D A;  1PCE A;  5CCL A;  1SGQ I;  1N13 A;  1R79 A;  2WGC A;  4SGB I;  2KMR A;  1Y1C A;  1YU6 C;  2NU3 I;  1PTQ A;  1P9G A;  3UEJ A;  5J8C A;  1V1H A;  2JZM A;  3GOX A;  1S20 A;  1Z7K B;  5FUX A;  2QQ0 A;  2QQD A;  2RIJ A;  1YTP A;  3RU0 A;  2XRC A;  3PDN A;  1PJU A;  1SGN I;  3UGL A;  3OVO A;  2JXD A;  5FUV A;  2NU0 I;  3UFF A;  1TBQ R;  3TO9 A;  3VE5 A;  1LR9 A;  2J9R A;  2GKV A;  3R5D A;  2RC4 A;  1CGJ I;  1TBN A;  2CJS C;  2KMP A;  3D00 A;  5E3R A;  2N1A B;  3TOB A;  5HQ8 A;  2LB7 A;  1PTR A;  2B8T A;  2NU4 I;  1V1I A;  3UEY A;  1NUB A;  2N71 A;  3B4V C;  2SGF I;  1UHA A;  1WKX A;  2SGE I;  1HJA I;  1KMA A;  1W3S A;  2KMQ A;  9WGA A;  1Y8F A;  1CT4 I;  2K9H A;  4MPI A;  4UXI A;  1AN1 I;  2DB6 A;  1CT0 I;  2W0T A;  2ENN A;  3CXL A;  1XBT A;  1WGT A;  3QTL D;  5HI7 A;  2DKV A;  1MJB A;  1DS2 I;  1SGR I;  2OVO A;  2ROW A;  2NU1 I;  1SGE I;  2WCY A;  3QAH A;  4UXJ A;  1WGC A;  2YQP A;  3QWP A;  1HDL A;  4HGU A;  3OXG A;  2ODD A;  4FKD A;  2V1C C;  5J8F A;  3OXL A;  2GKT I;  3R5B A;  1ULM A;  2OD1 A;  2ORV A;  1TBR R;  1SGY I;  3OXF A;  5DAE A;  2J87 A;  5FUW A;  2X52 A;  2Y0M A;  2CWH A;  2UVO A;  4GI3 C;  3SGB I;  3UGD A;  2CWF A;  1DS3 I;  3E2I A;  4WP4 A;  2B0U C;  1CHO I;  1FY7 A;  2V53 A;  2N52 A;  1K7T A;  1UUC A;  1M8B A;  1NXU A;  5FUY A;  1FYB A;  1XA6 A;  1SGP I;  2E73 A;  3UOE A;  2V1C A;  1XX6 A;  1FAR A;  2SGQ I;  2A20 A;  3FSY A;  1PPF I;  2ELI A;  3FC3 A;  1IY5 A;  1Y1B A;  1SGD I;  1HEV A;  2ENZ A;  1TBO A;  1OVO A;  2GVI A;  1TIH A;  1LR7 A;  2NU2 I;  2VRW B;  4UXH A;  1X4S A;  4L9M A;  4OVO A;  2X3T A;  2PQ8 A;  1RFH A;  3E59 A;  2QQC A;  1BUS A;  1FAQ A;  2E5R A;  2ARP F;  2ERW A;  2QPO A;  2YUU A;  5E3Q A;  3TOA A;  3R5C A;  1LR8 A;  2F3C I;  1K7U A;  2SGD I;  1BMO A;  1X74 A;  1VDD A;  5JHW C;  1Z2I A;  4E1R A;  1TOT A;  2JW6 A;  1U5K A;  2LUY A;  2WVJ A;  1MJA A;  3SGQ I;  2FNF X;  2N17 A;  1Q9B A;  4DNC A;  1CSO I;  3VDP A;  2DIP A;  2KMO A;  2L8E A;  2SGP I;  2LEO A;  4A24 A;  2CWG A;  3FSX A;  1TGS I; 
#chains in the Genus database with same CATH homology
 3KY9 A;  5CCM A;  1KBF A;  4E1P A;  3VDU A;  2QQE A;  1R0R I;  2JA1 A;  3SEK C;  1CGI I;  3OL0 A;  2M5X A;  2BUS A;  1UVF A;  1IW4 A;  2GKR I;  1OMU A;  2UZ3 A;  1TUR A;  1W4R A;  2L7X A;  1CT2 I;  3TJQ A;  3MEK A;  5EX0 A;  1OYV I;  1M8C A;  1TUS A;  2JYY A;  3HH2 C;  1TGS I;  2KCX A;  3UGI A;  1IY6 A;  1MT1 A;  4JCV E;  2P6A C;  1UVG A;  5EX3 A;  1HPT A;  1OMT A;  1H0Z A;  2ORW A;  1CE3 A;  3BJI A;  1KBE A;  4B6D A;  1PCE A;  5CCL A;  1SGQ I;  1N13 A;  1R79 A;  4SGB I;  2KMR A;  1Y1C A;  1YU6 C;  2NU3 I;  1PTQ A;  3UEJ A;  1V1H A;  2JZM A;  3GOX A;  1Z7K B;  5FUX A;  2QQ0 A;  2QQD A;  1YTP A;  3RU0 A;  2XRC A;  3PDN A;  1PJU A;  1SGN I;  3UGL A;  3OVO A;  2JXD A;  5FUV A;  2NU0 I;  3UFF A;  1TBQ R;  3VE5 A;  1LR9 A;  2J9R A;  2GKV A;  1CGJ I;  1TBN A;  2CJS C;  2KMP A;  3D00 A;  5HQ8 A;  2N1A B;  1PTR A;  2B8T A;  2NU4 I;  1V1I A;  3UEY A;  1NUB A;  2N71 A;  3B4V C;  2SGF I;  2SGE I;  1HJA I;  1KMA A;  1W3S A;  2KMQ A;  1Y8F A;  1CT4 I;  2K9H A;  4UXI A;  1AN1 I;  2DB6 A;  1CT0 I;  2W0T A;  2ENN A;  3CXL A;  1XBT A;  3QTL D;  5HI7 A;  1DS2 I;  1SGR I;  2OVO A;  2ROW A;  2NU1 I;  1SGE I;  2WCY A;  4UXJ A;  1HDL A;  2YQP A;  3QWP A;  4HGU A;  3OXG A;  2ODD A;  4FKD A;  2V1C C;  3OXL A;  2OD1 A;  2ORV A;  1TBR R;  1SGY I;  3OXF A;  5DAE A;  2J87 A;  5FUW A;  3UGD A;  4GI3 C;  3SGB I;  1DS3 I;  3E2I A;  1CHO I;  2V53 A;  2N52 A;  1UUC A;  1FYB A;  1M8B A;  5FUY A;  1XA6 A;  1SGP I;  2E73 A;  2V1C A;  1XX6 A;  1FAR A;  2SGQ I;  2A20 A;  3FC3 A;  1PPF I;  2ELI A;  1IY5 A;  1Y1B A;  1SGD I;  2ENZ A;  1TBO A;  1OVO A;  2GVI A;  1TIH A;  1LR7 A;  2NU2 I;  2VRW B;  4UXH A;  1X4S A;  4L9M A;  4OVO A;  1RFH A;  3E59 A;  2QQC A;  1BUS A;  1FAQ A;  2E5R A;  2ARP F;  2ERW A;  2QPO A;  2YUU A;  1LR8 A;  2F3C I;  2SGD I;  1BMO A;  1X74 A;  1VDD A;  5JHW C;  4E1R A;  1TOT A;  2JW6 A;  1U5K A;  2LUY A;  2WVJ A;  3SGQ I;  2FNF X;  2N17 A;  1CSO I;  3VDP A;  2DIP A;  2KMO A;  2L8E A;  2SGP I;  2LEO A;  4A24 A;  2GKT I;  2B0U C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...