2KD0A

Nmr solution structure of o64736 protein from arabidopsis thaliana. northeast structural genomics consortium mega target ar3445a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
MGHHHHHHSHSTIKLTVKFGGKSIPLSVSPDCTVKDLKSQLQPITNVLPRGQKLIFKGKVLVETSTLKQSDVGSGAKLMLMASQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of O64736 protein from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
molecule keywords LRR repeats and ubiquitin-like domain-containing protein At2
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2008-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kd0A01
2R2OA 2K8CA 2DX5B 4EZLA 4PYUA 2KXJA 2WX1A 3C0RB 4A20A 4KDLB 1SIFA 2KFKA 3IHPC 2L76A 2NBUA 4MGIE 2CR5A 1E7UA 1NDDA 5LXIB 4A3OA 2LGXA 1V2YA 1EF1A 2LUEA 2ZVNA 3ZTDA 2KX0A 1P1AA 2KLGA 2K6QA 1XT9B 3UIPB 1WJ6A 2NPTB 1WGYA 1UBQA 3VDZA 1GG3A 1TGZB 5AZHA 1WIAA 1WY8A 1MG8A 3LDZE 4EZKA 2C60A 3VH3B 1Q1OA 4WAAA 1GUAB 4JL9A 3CSFA 2XK5B 4NPNA 2FIDA 4MELA 3TMPB 4E3CA 2MBBB 3DVGX 3ZKJC 3MJWA 3A9JB 1WZ3A 1YD8U 2FIFA 2LGDA 3DBSA 4M8MA 1YJ1A 3Q3FA 1K8RB 4HLEA 2XBBC 3DBLI 5D2MB 2EMTA 4FULA 3JSVB 1WXAA 2DAJA 1YX6B 1H4RA 3H9DA 1WI0A 3WAOA 2ZZPB 2JVCA 3H6NA 2MQJA 3MHSD 1V9JA 2IZVB 1IPGA 2NPTA 2O2VB 2DAFA 4K7WA 2D2QA 3APFA 3W1SC 2N1WA 4HCNB 3VXWA 2EMSA 2JXXA 4MSQB 3VTUA 2ZNVC 4BKSD 5JHBA 2L00B 1WX8A 4HK2A 2O2VA 2N9EB 4B95A 2IYDB 2KFKB 3ZNID 2I1JA 3UGBB 3JSVA 2DZMA 4II2B 2L0FA 2G45B 2NVUI 2GBRA 1WM2A 3HK0A 3L54A 4W9IA 4KSLC 4MEMA 3QK0A 2ZEQA 4BBNC 1RRBA 1XQQA 5J18A 2QHOA 1M94A 1V5OA 1YIWA 4ASWC 2DYBA 1YQBA 5EDSA 1GJZA 4IW0A 1OQYA 1WRDB 2GMIC 3K9PB 2O6VB 1P98A 4IUMB 2OOBB 2ZVOA 3ZVVA 1WFYA 4B9KA 1WMHB 2KHWB 4KVGB 5AZFA 4DBGA 4NY0A 3ALBA 1WGDA 4K7UA 2BYEA 2CS4A 3IBEA 3IVFA 3N3KB 1G6JA 4WQOB 2HJ8A 1WE7A 2PE6B 1WXSA 1P3QU 3EHVA 3QAQA 3QIJA 3KW5B 1E8WA 2G3QB 1ZGUB 2KX3A 4GU2A 2ASQA 2ZCBA 1WJ4A 2LJ5A 4FLHA 2Z59B 2L0TA 2RD0A 3JYUA 4I6LB 4IWQA 2LI5A 4HDOA 2JRIB 3ZLZA 3NHEB 1WX7A 4GDLB 3VAWA 3AU5A 4XX5A 3T9LA 2IBIB 4URKA 2MSED 1LFDA 3PLVA 1QZEA 4ANXA 2Z0DB 3NS8A 1UGMA 2L05A 4ANWA 3WIMA 1OTRB 3VH4B 1WGGA 1V81A 2KWVB 3CMMB 4ICVA 3TIXA 1ZKHA 1A5RA 1E8YA 5E6NA 1OEYA 2KKCA 2NS5A 1CMXB 3M62B 4HDQA 3NOBA 2KDEB 3SU8X 3U30A 5L95C 1UZXB 2GBKA 4EOYA 3M95A 2K8HA 3DQVA 3ZNHB 3NY5A 2DYMA 3R3MA 3L16A 3QCAA 5CTRC 3SD5A 3PT2B 5D6JB 1TZ1A 2J0MA 4FHJA 4WWOA 1HE8A 2FCQA 2L8JA 2LXAA 2ZJDA 3V6CB 2KDIA 2N9XA 2M8SA 2WX0A 4AOFA 2RR9A 2AEHA 4GN1A 4NAWB 3ZDTA 5C1ZA 1J19A 1VCBA 2CKHB 2KANA 2KJ6A 2GBJA 2MP2A 3VTWA 4FBJB 2C7NB 1J8CA 3BINA 1X1MA 4ANVA 4DK5A 4GGQA 4G50A 5JH5C 1H8CA 3R66C 4BKGA 3A4RA 4EKUA 4GIVA 2R2QA 3KUZA 3EECA 3OJ3A 4RMAA 4RM8A 3ZNZB 4DXAB 1C3TA 2BWFA 1S3SG 2KWUB 2LWPA 4M8NA 2KOXA 3PS6A 3QHTA 3X0WA 4II3B 1UH6A 2KNBA 3SHQA 4WWPA 2KFJA 4EFOA 2VRRB 4GDLA 2ZPNA 3HM3A 1S1QB 1E8ZA 1JRUA 3HIZA 2MCNB 2DZIA 3RZFA 4CYEA 2PJHA 1L7YA 3M3JA 5CHFA 3V62A 2PPHA 2MX2A 3DDCB 4KDIC 4HJKA 4NJ7A 1D3ZA 3ZUNA 3IFWB 3PLUA 3PRMB 2AYOB 2N7DA 2MA9B 2K8BA 2UYZB 3KYCD 3A33B 3PVLA 4K1RB 2IY0B 1Q5WB 2IO3B 1GNUA 3N32A 3RD2A 4NAWA 3QJZA 4F8CB 2YLMA 2JT4B 3B1LX 2MP2B 3H7SA 3ZTCA 1WE6A 4DHZB 5DPTA 3WALA 3H1UA 2LRWA 1WXVA 4LDTD 2MLBA 2KO3A 4KV2A 3A1QB 2KC2A 1WZ0A 1Y8RC 4IWOA 2J0JA 2AL3A 2KD0A 3AULA 2CHZA 4RM9A 2MBHA 5L83A 4MJSB 2RPQA 4I6NB 4MGYE 1SGHA 3KYDD 4W9JA 3QWZB 2KTRB 2LVOA 2KJRA 3APCA 4E71A 2KC1A 1WGHA 3B08A 2KN5A 4PS3A 4JIOU 3APDA 1EUVB 2L7RA 4M0WB 3DCGA 4ZYNA 3AU4A 3QC8B 4TV3A 3T8MA 4GDKB 1ISNA 1SE9A 1WXMA 3TJPA 4G3XB 4K81A 3UQAA 4KIKB 3DPDA 5CHVC 2M4NA 3VQIA 1J0GA 2JWZA 1XD3B 2YVCA 2G4SA 1UD7A 3RCZA 2BWES 4AUQC 2HTHA 2CHWA 3PRZA 3M63B 2K39A 4W9KA 1Z5SB 3QX1A 5DCNA 4IG7B 2W9NA 3L17A 5KHOA 4FJZA 3UQBA 4W9HA 4EZJA 4XC2A 2B3AA 5AZGA 5TR5A 2Z0EB 3KUDB 4HXDA 2FNJB 2HE7A 4ZRJA 2LZ6A 3OLMD 2IO1B 3AXCA 3O65B 4LJPB 2N1VA 2MRPA 4NJ6A 2JZZA 3DVGY 1YX5B 3PV1A 3TL5A 2UWQA 3RUIB 4TQ0A 2KZRA 2DHZA 3L10B 1Q0WB 3V60A 3W1SA 4MGKE 4ZRIA 4KZCA 5IA7A 2BKRB 1TTNA 2FAZA 5G55A 3ZDMC 3NZSA 1V49A 2N4FA 3ONSA 3HHMA 2GOWA 2MW5A 4LDTB 1VD2A 1ZW7A 1UBIA 3RULA 4F1SA 1I35A 4MSMB 3OJ4B 1UELA 2BF8B 4IM0A 1OGWA 4FJVB 3ML9A 5FR6A 1BT0A 2L3ZA 4MDKE 4PS8A 5DPRA 3WA0A 4WJQA 1WM3A 2KJHB 4MH0E 3PHXB 3R7RA 2J0KA 2BPSA 2KWCA 3DBHI 4IWPA 3GZNI 1FXTB 4FADA 4K7SA 3CSTA 3U7DA 4LCDE 4ANUA 2C7HA 2WYQA 4WJOA 4BKSA 3EFUA 2M0XA 4X57B 2N9PC 2IO0B 2IY1B 1WR6E 3R7QA 1KM7A 5LLIA 2Y5BB 3HM6X 3W1YA 5J17A 4ZDVA 1U4AA 1LM8B 2GBNA 3P2BA 3B0AA 3PSEB 4GB9A 4N9F4 3ZNGC 3UINB 3A9KB 3DOWA 4BKTA 1KOTA 4GDKA 3EC8A 4BBNF 1KLVA 3VHTC 3LJ3A 1WGRA 4ZRKA 4WWNA 4BVUC 2LASA 3K9OB 4IC7B 5HKHA 2A5UA 4FN2A 3ZRCA 2MBEA 2WDTB 2KTRA 2OJRA 4IM2A 3PHWB 3SDLC 3CF6E 3NZUA 3MTNB 3PPAA 4IM3A 4A3PA 4AWJA 4AJYB 2V3SA 1NI2A 3A9JA 3L0WB 2KMAA 4KZ0A 2KLCA 3N30A 2C7MB 1V86A 2HD5B 3KUCB 2G4DB 3L13A 3OAWA 2LD9A 4LJOB 2M17A 2DZJA 4W9LA 1RAXA 2LVQA 2REXA 4EUTA 3DVNU 1E5WA 1V80A 4BFRA 4PYZA 4GSWA 3JVZX 2KMCA 3WAMA 4FHKA 1E8XA 1LQBA 4HPLB 1GC7A 5DPWA 3VFKA 4E74A 3WAPA 3VVWB 2D07B 3ZIMA 1KJTA 1RFAA 4I6PA 1WYWB 1Z2MA 1P9DU 2NBWB 3D32A 4P7IA 5J2RA 1WF9A 4WJPA 4MM3A 4DHZE 2D3GA 3GOEA 4NQLB 3H7PB 2AL6A 1IYFA 1OEYJ 2JZ3B 4FA6A 1WJUA 2J7QB 3PRPB 3S2AA 2MBQA 3BY4B 4W9EA 3KH0A 3PTFC 4W9GA 5DPSA 3VUYA 3VUWA 5G2NA 4DDID 4MGZE 3TCAA 4JQWC 4BOZB 5GMVA 2JUOA 5JZEB 4HPMB 1LXDA 1EO6A 2O6VD 1TBEA 4TUUA 2JF5A 2CU1A 3PREA 1C1YB 3VTVA 4DWFA 1WMHA 2K25A 3DBRI 3X23A 3V6EB 4W9CA 2FCSA 2RGFA 2KQ7A 2EKEC 3QARA 3WANA 4DHJB 2LVPA 2PEAA 3V61A 4GOCA 4ICUA 5D7GA 3I3TB 5C23A 3QQ8B 2LGYA 2RSUA 4GMVA 2FUHB 2M1MA 4J6IA 1R4NI 3RT3B 2BYFA 1V6EA 2NR2A 5BO4B 3A1QA 5CX3A 4DDGD 4TKNA 4G11A 4AP4C 4TQ1A 2XK5A 1IP9A 3A4SC 3RYTA 2A4ZA 4W9DA 2JPHA 4GXBA 2V1YA 4G0NB 4B6WA 2IO2B 4CO7A 3ZRFA 2JRHA 1P0RA 4OVUA 4AJWA 1RLFA 4XZ4A 4PS7A 2C5LC 3PZDA 4HWIB 2MWSB 4JGHB 1I42A 4JLCA 5IAAC 2GBMA 2WWZA 2DZKA 1EF5A 2O6VA 4EEWA 1PQSA 4HVBA 2I1KA 4YL8A 5E6PA 3RZWC 2D10A 2JY6A 4OVVA 2KK8A 2PE9A 3AI5A 3ECIA 2FCNA 4KSKC 4MJSA 1E7VA 2KTFA 3KVFB 3IG3A 2KVRA 3UF8A 3UIOB 2BGFA 2KQSA 3ML8A 3ZW3A 1T0YA 3VUXA 3DVNV 2N7EA 3Q3JA 2ZCCA 3U8ZA 2ZPYA 1WJNA 3PGEA 1WX9A 3ZO5B 2CHXA 4WJNA 3A9KA 2BKFA 4KIKA 4F7ZA 2AWTA 2NBVB 2DYOA 4NQKE 4CHKA 1WH3A 1L2NA 4DHJD 5KHQA 2K6DB 2KDFB 3QA8A 2V4LA 3JW0X 4HCPB 4BOSC 5E6OA 1GC6A 2XEWA 2ZNVB 1E90A 1F9JA 2LXCA 2LRUA 1NBFC 5D94A 5AEKB 1AARA 2MBOA 1V5TA 3L08A 5JHAA 2C9WB 5LXHA 2FCMA 2KDBA 2NCNA 4NNJB 2BYVE 1R4MI 4W9FA 2D11A 3H7PA 4FJYA 2K1FA 2DENB 3ENEA 3TBLD 1WR1A 5CHWA
chains in the Genus database with same CATH superfamily
4B0MA 2PMVA 3NRZA 1ZXIA 2KFKA 3IHPC 2L76A 2N9LA 2CR5A 3BVGA 1NDDA 3NG0A 4A3OA 2LUEA 3ZTDA 1P1AA 1XT9B 3VDZA 1HZ6A 1WIAA 3N20C 3HRDD 3LDZE 2RDGA 3VH3B 1Q1OA 4JL9A 4QAYA 4NZLB 4MELA 3U7ZA 3MJWA 3A9JB 1FCLA 4M8MA 4FULA 3JSVB 1WXAA 3H6NA 2NPTA 2X38A 2N1WA 1QOBA 2J42A 4HCNB 4MSQB 2ZNVC 1JQ4A 2L00B 1WX8A 2N9EB 4B95A 2IYDB 1VR9A 3UGBB 4M00A 3H8HA 3JSVA 4R3DA 3HK0A 4O1NA 2QHOA 3ABVB 1YIWA 4ASWC 2DYBA 4RFBA 2MJEA 1R4MB 1AN8A 5EDSA 1OQYA 1WRDB 1GJZA 3K9PB 3BZDB 3KWLA 2KQ4X 3IXSA 3ZVVA 1WMHB 1STEA 3HVDA 3IVFA 4WQOB 2HJ8A 4N6EB 2WHIA 3EHVA 3QIJA 1WGKA 2KX3A 2ICIA 2ASQA 3HVZA 4C4VB 4BAXA 4IWQA 3ZLZA 3NHEB 2I2YA 3AU5A 3T9LA 3PLVA 1UWXA 4ANXA 2PLPA 4EE2A 2IJ0A 2L05A 1WGGA 2KWVB 1ZKHA 2KWDA 1YJJA 1ZXHA 2RPVA 1OEYA 2KKCA 4HDQA 3U30A 1OFFA 3M95A 2K8HA 3DQVA 3ZGZA 2DYMA 3QCAA 2TSSA 5D6JB 2GI9A 2WNMA 2VH2A 2L8JA 2LXAA 1Q10A 4GLSC 3AE2B 2M8SA 4AS1A 4GN1A 5C1ZA 1VCBA 2KJ6A 3VTWA 2MP2A 4FBJB 3BINA 1DGJA 2RMMA 3R66C 4BKGA 1L6UA 2R2QA 3OJ3A 1C3TA 3T3OA 1S3SG 1R7SA 2KT7A 3QHTA 3AM9A 2ZPNA 4KKJA 1E8ZA 1TS4A 2L32A 2PJHA 1L7YA 1KTKA 5CHFA 3AE4B 1AYFA 2MX2A 1PYWD 4RGNA 1ET9A 3ZUNA 2N7DA 2NTSA 2MA9B 2R61A 3P4PB 3RD2A 3N32A 2JT4B 1ZDXA 1L5PA 4L2YA 4DHZB 4RF0A 3BYYB 3WALA 1ET6A 2KO3A 2WU5B 4KV2A 2PVGC 2PIAA 1WZ0A 1Y8RC 2KD0A 3AULA 2KACA 2MBHA 1CJEA 2WXHA 3KYDD 4W9JA 4RH6A 2EKIA 2KJRA 3APCA 2KC1A 1XO3A 2KN5A 2K5PA 3VRBB 3APDA 4ZYNA 4TV3A 4GDKB 1VLBA 3NVYA 4KIKB 3VQIA 3ZQ4A 1J0GA 2QCZA 2YVCA 1UD7A 1YN3A 1SJED 3M63B 3AE1B 4W9KA 4ARCA 2WXPA 3RPFC 4IG7B 3IT4B 2D3AA 2WDQB 3RNAC 1ZPSA 1P7FA 4W9HA 4EZJA 4JWSC 5AZGA 5TR5A 4HXDA 1XLNA 2IO1B 3IAS1 4P1CC 4NJ6A 1IGCA 1J7AA 2DHZA 3V60A 4ZRIA 2FAZA 5G55A 1YNTE 3ONSA 5BMIA 1XLOA 4F1SA 4MSMB 3OJ4B 5FR6A 1XLQA 4MDKE 5E6JA 1WM3A 4MH0E 2BPSA 3Q8FA 3W5UB 4IWPA 4K7SA 3U7DA 2IGDA 2C7HA 3IAM1 5H8YE 2IO0B 1KH0A 5LLIA 1LM8B 3RNEC 3B0AA 3Q8BA 3ZNGC 3NJTA 3DOWA 1KOTA 3VHTC 3LJ3A 4WWNA 2LASA 4IC7B 3ZRCA 4HRSA 2WDTB 1XLPA 2KTRA 3SDLC 3PHWB 1TS5A 4IM3A 1HZ5A 1SB3C 1UNSA 3AEDB 1NI2A 3L0WB 2KLCA 3OAWA 2LD9A 2M17A 2DZJA 1WSPA 4EUTA 2JSVX 5GXGB 1NI3A 4BFRA 1FIQA 4P16A 2VH1A 4HPLB 1JALA 4P7IA 5J2RA 1WF9A 3AEGB 4MM3A 3N9YC 1I4PA 4DHZE 1SE2A 4NQLB 2AL6A 1OEYJ 2JZ3B 2J7QB 2MBQA 5DPSA 3VUYA 2QJLA 3PTFC 1HXYD 1MI0A 3Q8EA 1LXDA 2O6VD 2L1AA 2HDEA 5IOIA 3V6EB 2FCSA 2H89B 2EKEC 1ENFA 2LUMA 3QQ8B 4GMVA 4J6IA 2FUHB 2BYFA 5CX3A 4DDGD 1MFWA 4AP4C 2VZKD 2BB5A 3RYTA 1FFVA 2JPHA 4GXBA 4AJWA 4OVUA 2N0SB 2C5LC 3PZDA 3I9V1 1KRHA 4WH4A 1EWCA 1I42A 5LNK1 5IAAC 1FRRA 1NYRA 1EF5A 3MJ5A 3V3XA 3P4SB 2QMTA 1TKGA 5E6PA 4KSKC 3UF8A 3IG3A 2BGFA 3ZW3A 1T0YA 1XEEA 2N7EA 3Q3JA 2ZCCA 1PGAA 4RF1A 3MC0B 3PGEA 1FEHA 4WJNA 1F0ZA 2AWTA 1WH3A 1L2NA 4S0RA 2KDFB 5BMGA 3JW0X 4YWGG 3TEZA 2ZNVB 1E90A 1D5XC 4DXGA 2KDBA 4ZRPA 2BYVE 2D11A 2DENB 1HQRD 1IYFA 2INPE 2K8CA 2DX5B 1JRPA 4PYUA 4KDLB 4KGRA 1TKEA 1XF5L 2NBUA 1E7UA 1WRIA 4JE3B 3GP7A 2K6QA 1WYGA 1WJ6A 2NPTB 1GG3A 2D3CA 4L23A 1WY8A 4EZKA 1T3QA 1JW9D 1GUAB 2XK5B 1KLGD 1L0XB 2MBBB 4IDIA 1WZ3A 1QLBB 3GZNB 1YJ1A 3EA6A 4HLEA 1YX6B 4KKIA 3URYA 3H9DA 1VDVA 2K0PA 5FR3A 2IZVB 1IPGA 3BVZA 2XNAC 3I5JC 4BKSD 2JXXA 5JHBA 2WXOA 4HK2A 2KFKB 1MJDA 3ZNID 2J53A 1E7PB 2DZMA 4II2B 3L54A 2G45B 4W9IA 4C56C 1WM2A 4N58A 5J18A 4IW0A 3WCQA 2OOBB 2ZVOA 1WFYA 4B9KA 3Q69A 2KHWB 5AZFA 4KVGB 4DBGA 3ALBA 2BYEA 2CS4A 3IBEA 1G6JA 2J4XA 3KW5B 2W55A 2ZCBA 5IO9A 2Z59B 3JYUA 1TKYA 3L4PA 3OG5A 1N5XA 4XX5A 4URKA 4K3BA 1UGMA 4ANWA 2INNE 1SE4A 1BMLC 3WIMA 4ARIA 2DWQA 3IT6B 3TIXA 1A5RA 3DWMA 4TMAB 2INDC 2G9HD 2JXTA 5E6NA 2NS5A 5HG2A 5L95C 4EOYA 1RFKA 3AB5A 1ZOYB 3UI3A 5CTRC 1ZP0B 3SD5A 2JU6X 1Y56A 3E56A 4FHJA 5D3DA 1JWMD 3V6CB 2N9XA 3AEBB 4AOFA 3AH7A 1J19A 4LNIA 2KANA 2GBJA 4G50A 5JH5C 1H8CA 4ITKA 3A4RA 3KUZA 3EECA 1UUPA 2BWFA 4M8NA 2KWUB 2LWPA 1I4QA 1YN5A 3X0WA 4II3B 1UH6A 2KNBA 3SHQA 1ACCA 2DZIA 4CYEA 4C4VA 2PPHA 3DDCB 2AQ3B 4KDIC 2WDRB 4RGTA 3W9CB 2PTLA 3AECB 4C00A 3PRMB 4K3CA 2I38A 2UYZB 1LGRA 2IO3B 3NVWA 4RCOA 4F8CB 3LB8C 2MP2B 3H7SA 3ZTCA 1WWTA 3U52E 2V9HA 3DBHB 3A1QB 2KC2A 1EU3A 2J0JA 2AL3A 2CHZA 5H92C 5L83A 4I6NB 2D5GA 3QWZB 2KTRB 2LGIA 2YEPB 5BMHA 5HFYA 4E71A 3B08A 1ROEA 1EUVB 4M0WB 3DCGA 3T8MA 1ISNA 1WXMA 2WQYB 2JWZA 4ZHPA 1C76A 3SFEB 2Y3AA 4AUQC 2HTHA 1Z5SB 3QX1A 2BT6A 2W9NA 3L17A 4FJZA 2JYTA 2MJDA 5G5HA 1YQ3B 1SXTA 2Z0EB 3KUDB 3BK2A 3AE5B 3AXCA 3BYTB 3O65B 2JYEA 2MRPA 2JZZA 3TL5A 1YX5B 3PV1A 2UWQA 4ZRQA 2KZRA 4MH8A 3J9CA 3ZXRA 2D3BA 4KZCA 5IA7A 2BKRB 1V49A 2GOWA 1VD2A 4M02A 3RULA 4YTNB 2WXGA 2WXRA 1N60A 1UELA 2V3PA 2QILA 1OGWA 4FJVB 1BT0A 2L3ZA 5DPRA 4WJQA 2KJHB 3DBHI 2J52A 1VZ8A 1J7BA 3GZNI 1FXTB 3CSTA 4LCDE 4BKSA 2CU3A 1C78A 3EFUA 5T8IA 4X57B 2V3NA 1WR6E 2QDFA 3U4EG 2GBNA 3NS1A 4GB9A 4N9F4 4GDKA 3BWUD 3EC8A 4BBNF 1GB1A 1YQ4B 4ZRKA 2WDVB 2LEKA 4FN2A 2MBEA 1R4NB 1DOYA 4HJGE 3PPAA 1GB4A 4A3PA 1N6ZA 1IBXB 3A9JA 2KMAA 2W3SA 4KZ0A 2C7MB 1QQRA 3KUCB 3L13A 4JX1C 4W9LA 2LVQA 2BS2B 1HA5A 1F1HA 3WAMA 4FHKA 1FM0D 4LNFA 2PVOD 3VFKA 1KJTA 1JWBD 1P9DU 2NBWB 4ACFA 1FFUA 1KLUD 4YTMB 4FA6A 1WJUA 3ETRA 2XN9C 4W9GA 3W5VB 3VUWA 4DDID 4JQWC 4BOZB 5GMVA 1SE3A 2JUOA 4C7YA 1FO4A 1EO6A 1TBEA 1UWMA 1T5XD 2JF5A 3PREA 3ZXVA 1C1YB 1L0YB 4YSYB 1WMHA 3DBRI 4US8A 3P42A 3WANA 4DHJB 1SF0A 2LVPA 4ICUA 3I3TB 3GE8C 4L1BA 2M1MA 3FILB 5BO4B 4TKNA 4P6VF 3TSSA 2XK5A 1FPYA 2M19A 3AV8A 4B6WA 4LTUA 2FE8A 3ZJVA 4PS7A 4HWIB 1N5WA 4JGHB 3P4QB 3NVZA 4A6QA 1FCCC 1UF0A 4EEWA 4IKGA 3T3NA 2D10A 2WP9B 5EE3A 3ECIA 2FCNA 4MJSA 1E7VA 2KTFA 2LMCA 4P1BC 1KF6B 1WX9A 3ZO5B 1YN4A 2NBVB 4NQKE 3QA8A 3DHGC 4YSZB 2L52A 2JX5A 2V4LA 2AX5A 1TYGB 4HCPB 4BOSC 5E6OA 1GC6A 1EWYC 3MC8A 1NBFC 3R8BA 5JHAA 1AARA 2MBOA 1V5TA 3L08A 1OQRA 1T0SC 1R4MI 4A9AA 3H7PA 4N59A 5CHWA 2HJ1A 2KXJA 2WX1A 2ZW1A 1SIFA 4MGIE 5LXIB 1FMAD 1C77A 1EF1A 5BYRA 2ZVNA 2KX0A 3UIPB 1WGYA 1UBQA 5AZHA 4AQ7A 3CSFA 2FIDA 3TMPB 2DLBA 4US9A 3DVGX 3ZKJC 2WU2B 5D3IB 1YD8U 3DHIC 2W3RA 3DBLI 5D2MB 2EMTA 3WAOA 3MHSD 2JVCA 1V9JA 2CJOA 2O2VB 3B2GA 2WS3B 4PK1A 3Q3OC 3APFA 3W1SC 1E10A 2FBWB 4MT5A 4LNKA 2I1JA 2L0FA 2NVUI 4KSLC 4C7ZA 1PDXA 3MHZA 1TZOA 5HI1A 4OZBA 1YQBA 1P98A 1QKZA 4XYCA 4NY0A 4K7UA 3N1ZC 2PE6B 3I63C 1QOGA 1RYJA 3ZJUA 1MG4A 2ONQA 1E8WA 1ZE3D 1ZGUB 4GU2A 3BVMA 1SSNA 4FLHA 3SR6A 2RD0A 2N7JA 3I57A 2JRIB 1WX7A 1FD6A 2BW2A 2IBIB 2MJ3A 5EE9A 2EELA 1T0QC 3NS8A 2NMQA 5C2TB 2KMMA 4RGOS 1OTRB 1QT9A 4OZCA 3CMMB 3B2FA 2RDBC 4YXDB 4NAMA 2IGHA 2Z8LA 1CMXB 3SU8X 2KDEB 1UZXB 2GBKA 3NY5A 2WXIA 4S17A 1TS3A 3PT2B 1YMHE 2INCC 2J0MA 2PKOA 4WWOA 2FCQA 4J3OD 2ZJDA 1P7EA 2QIEB 1SEBD 1FNUA 3B9JA 2RR9A 2AEHA 3ZDTA 4NAWB 2VZKB 2CKHB 3KLSX 3LXFA 2C7NB 4OVZA 1JROA 4DK5A 4GGQA 4GIVA 4UDUC 4RMAA 1E6EB 5TSSA 1XXGA 1FRDA 4CQNA 3PS6A 4RGMA 4WWPA 4EFOA 2JQRB 4GDLA 3HM3A 1S1QB 3HIZA 2MCNB 1T6BX 3RZFA 1NYQA 2OEDA 3M3JA 3Q6BA 3W2DA 1L4DB 1C79A 1UGJA 4NJ7A 1D3ZA 1GOZA 1HTQA 1WXQA 1Q5WB 2JZPA 1GNUA 2BB6A 3QJZA 3MP9A 3AEFB 4PT5A 5DPTA 2ON8A 4LDTD 4IWOA 1RM6C 4DXFA 1DYQA 2W82A 5BYSA 4MJSB 2RPQA 4MGYE 4LNOA 3R2IA 4PS3A 4JIOU 5FKAC 1SE9A 3TJPA 4G3XB 3DPDA 1PUTA 3RCZA 2LHDA 4M0WA 3Q2AC 2CHWA 3DHHC 3EFCA 1JCKB 5DCNA 1B1ZA 3FAHA 5KHOA 1V97A 4MM3B 5I4DA 4XC2A 2B3AA 2LJIA 2FNJB 2HE7A 4ZRJA 1FNVA 4LJPB 2N1VA 5EE0A 3RUIB 2E3TA 1JWUD 1Q0WB 1GPXA 4MGKE 1TTNA 3ZDMC 3AE7B 4XWWA 2KAJA 2N4FA 2MW5A 1JMLA 2QC8A 5AUIA 3ZJTA 2MH7A 1UBIA 4ZOHC 1OQQA 2N9KA 3ML9A 3WA0A 4WQMA 3PHXB 4M01A 2J0KA 2KWCA 3AE9B 4FADA 4ANUA 2WYQA 3GE3C 1TIFA 3AEEB 2M0XA 2N9PC 2IY1B 3R7QA 3W1YA 2Y5BB 1U4AA 3Q8CA 1T0RC 3P2BA 3PSEB 2WXQA 3MC9A 1KLVA 1WGRA 1GAQB 4BVUC 3K9OB 3AEAB 4IM2A 1CZPA 2OJRA 2GB1A 1FNWA 1CQVA 1IGDA 3MTNB 4AWJA 3GB1A 4AJYB 5C3JB 2OJWA 3Q3MC 2G4DB 5AUKA 2REXA 3U2SC 3PZ8A 2LFIA 4BZAA 4PYZA 4XE0A 2IDYA 3JVZX 2KMCA 2SEBD 4GSWA 1V1OA 1GC7A 5DPWA 3RFZB 3WAPA 3VVWB 3NZ3A 2D07B 1FXIA 4I6PA 2X8XX 2MEKA 1SBBB 3GOEA 1N62A 1I4RA 3PRPB 2Y5CA 3S2AA 1PFDA 4B0EA 2CJNA 1SJHD 4KGTA 1K51A 1NENB 5JZEB 4HPMB 1QF6A 3DBLB 4TUUA 2KDMA 2CU1A 2K22A 4DWFA 3RI7C 2NTTA 3PO0A 2K25A 3X23A 3BK1A 5BYQA 3P4RB 4TSSA 2RGFA 2KQ7A 2PEAA 3V61A 4GOCA 3Q3NC 4HEA1 5D7GA 5C23A 3RT3B 1V6EA 2WXLA 2IPKD 3Q8AA 3A1QA 3AE8B 1VJKA 4G11A 4TQ1A 2BBCA 5FK9C 3A4SC 4XDDA 2V1YA 2IO2B 1VZ6A 4CO7A 2JRHA 1P0RA 4XZ4A 3RNCC 2MWSB 4YSXB 1NEKB 1ESFA 1C4CA 1TY2A 2GBMA 4HVBA 2I1KA 1VRAB 4YL8A 2GRIA 3P1MA 3RZWC 4KX6B 5MPOA 2KK8A 1TJEA 3KVFB 1L0VB 3C19A 1N61A 3DVNV 3U8ZA 2OHFA 4D2KA 1WJNA 2YEPF 2K9XA 3A9KA 2BKFA 1HEZE 1LO5D 1IUEA 1ZDVA 5KHQA 4JPSA 3VR8B 1F9JA 3RMKC 2LRUA 1V1PB 2KYWA 5D94A 3RNFC 5AEKB 4XDCA 2C9WB 2LHEA 2NCNA 4W9FA 4HKZE 3BIID 3TBLD 2R2OA 4EZLA 3C0RB 4A20A 2SAKA 4A90A 1I4XA 1ZUD2 2LGXA 5IP4D 1V2YA 1XCQL 3KWVA 4A55A 2KLGA 2DBYA 3P63A 3AE6B 1TGZB 1HTOA 1L4ZB 1MG8A 3VRAB 1D5ZC 2WLBA 2C60A 4WAAA 1N63A 4NPNA 4E3CA 1QOFA 2LGDA 2FIFA 1K52A 3DBSA 1JWAD 3Q3FA 1K8RB 2KVZA 2XBBC 1MHXA 2DAJA 1E9MA 1L6VA 1H4RA 1WI0A 2LGSA 2ZZPB 2MQJA 4K7WA 3C8YA 2DAFA 2W54A 2D2QA 1QILA 4ZYSA 3VXWA 2EMSA 3VTUA 2O2VA 4NJCA 2WXJA 2PW9A 2GBRA 1RWSA 2V4IB 4MEMA 3QK0A 5IKCM 2ZEQA 1QOAA 4BBNC 1RRBA 1XQQA 2MHJA 1M94A 1V5OA 2GMIC 2ZW0A 2O6VB 4IUMB 3AE3B 3MFGA 1WGDA 3AMZA 3N3KB 2WXKA 1WE7A 1WXSA 1P3QU 4LK0M 3QAQA 1BUIC 2G3QB 4OW0A 1WJ4A 2LJ5A 2L0TA 4I6LB 1MPEA 4WURA 2LI5A 4HDOA 1F77A 3VAWA 4GDLB 3TEXA 2MSED 1LFDA 1QZEA 2Z0DB 4DQOC 3VH4B 2M0AA 1V81A 4ICVA 1XCTL 1E8YA 1B9RA 4YTPB 3M62B 3NOBA 2DNFA 3HUIA 2HTME 3ZNHB 3R3MA 3L16A 2QEJC 1IBXA 1TZ1A 3GS2A 1HE8A 2JWUA 2KDIA 2WX0A 2L83A 4H2AA 4XWTA 3TUOA 1J8CA 1X1MA 4ANVA 4EKUA 2UU7A 3ZNZB 4RM8A 4HROA 4DXAB 2KOXA 2BYTA 1VZ7A 2KFJA 4WAFA 1C4AA 1F52A 2VRRB 1JRUA 1F2RC 2G1EA 1PGBA 3FKYA 1PGXA 4REZA 3E9SA 3V62A 1JWSD 1V8CA 4HJKA 3ZYYX 3IFWB 3PLUA 3EGRA 1NVID 2AYOB 2BS4B 2K8BA 3KYCD 3A33B 3PVLA 4K1RB 2IY0B 4NAWA 4LNNA 2YLMA 1F2RI 3B1LX 1EM7A 1SIJA 1WE6A 1YOVB 3CWIA 3SFDB 3H1UA 2LRWA 1WXVA 1KFYB 2MLBA 1A70A 1MVKA 4RM9A 5G5GA 3LYYA 3OWEB 3O13A 2B76B 1SGHA 3SEBA 2LVOA 4LLGM 4YT0B 1WGHA 1MHHE 2KN4A 2L7RA 3AU4A 3QC8B 1AWDA 4K81A 3UQAA 5CHVC 2AQ1B 2M4NA 1XD3B 2G4SA 2BWES 3PRZA 2K39A 3RNGC 2WGSA 3UQBA 3N1YC 1I4GA 2LZ6A 3OLMD 1J7CA 2V0GA 2M56B 4WWMA 3DVGY 4TQ0A 3L10B 4RNAA 3W1SA 1TY0A 2IGGA 3NZSA 4LDTB 3HHMA 3FC4A 1ZW7A 4USAA 4MACA 1I35A 1C9FA 1DOIA 4Q2JA 2BF8B 1DOXA 4IM0A 1K50A 4PS8A 1D6EC 3NUHB 1C4PA 3Q14C 3CIRB 3R7RA 5JXVA 1YJIA 4WJOA 2Y5PA 4XGAB 1BXTA 3RNBC 1KM7A 5J17A 3HM6X 1M4VA 4ZDVA 3UINB 3A9KB 5HHDG 4BKTA 5EE1A 3DWGC 4A8XC 4FXCA 5HKHA 1FXAA 2A5UA 2RDHA 3CF6E 3NZUA 1D4BA 2V3SA 3N30A 1V86A 3V05A 2HD5B 4KGSA 4LJOB 1RAXA 3DVNU 1E5WA 1V80A 1E8XA 3DBRB 1LQBA 4E74A 2BTEA 3ZIMA 1RFAA 1WYWB 1Z2MA 3D32A 4WJPA 2K3UA 2WXNA 2D3GA 3H7PB 3FILA 1AW7A 1V1PA 3AN1A 3BY4B 2FUG1 4W9EA 3KH0A 5G2NA 4MGZE 3TCAA 4IOIE 3VTVA 4HPPA 4ZHOA 1K53A 3R2TA 1E0ZA 4W9CA 2Q5WD 1CK1A 2BS3B 3QARA 2WXMA 2AQ2B 2LGYA 2RSUA 1R4NI 4WIPA 2NR2A 1I7HA 1TS2A 1IP9A 2BQQA 2A4ZA 4W9DA 4G0NB 3ZRFA 3TEYA 1I4HA 1RLFA 2E6XA 3N1XC 2BVCA 4HKQA 4OZAA 4JLCA 3KQ4A 4OHJA 2WWZA 2DZKA 2O6VA 2ACZB 1PQSA 3VR9B 3RN9C 2JY6A 4OVVA 2PE9A 3AI5A 2KVRA 3UIOB 2KQSA 3ML8A 2QSDA 1TT5B 3VUXA 2ZPYA 4JWUC 2CHXA 4KIKA 3TEWA 4F7ZA 2GLSA 2DYOA 4CHKA 4DHJD 2K6DB 5IN7A 4C80A 3NVVA 2XEWA 2LXCA 1D5MC 5LXHA 2FCMA 4NNJB 1EU4A 2WXFA 2K1FA 3ENEA 4FJYA 1WR1A 3EUB2 2H88B 3PZ7A
chains in the Genus database with same CATH topology
2R2OA 2K8CA 2DX5B 4EZLA 4PYUA 2KXJA 2WX1A 3C0RB 4A20A 4KDLB 1SIFA 2KFKA 3IHPC 2L76A 2NBUA 4MGIE 2CR5A 1E7UA 1NDDA 5LXIB 4A3OA 2LGXA 1V2YA 1EF1A 2LUEA 2ZVNA 3ZTDA 2KX0A 1P1AA 2KLGA 2K6QA 1XT9B 3UIPB 1WJ6A 2NPTB 1WGYA 1UBQA 3VDZA 1GG3A 1TGZB 5AZHA 1WIAA 1WY8A 1MG8A 3LDZE 4EZKA 2C60A 3VH3B 1Q1OA 4WAAA 1GUAB 4JL9A 3CSFA 2XK5B 4NPNA 2FIDA 4MELA 3TMPB 4E3CA 2MBBB 3DVGX 3ZKJC 3MJWA 3A9JB 1WZ3A 1YD8U 2FIFA 2LGDA 3DBSA 4M8MA 1YJ1A 3Q3FA 1K8RB 4HLEA 2XBBC 3DBLI 5D2MB 2EMTA 4FULA 3JSVB 1WXAA 2DAJA 1YX6B 1H4RA 3H9DA 1WI0A 3WAOA 2ZZPB 2JVCA 3H6NA 2MQJA 3MHSD 1V9JA 2IZVB 1IPGA 2NPTA 2O2VB 2DAFA 4K7WA 2D2QA 3APFA 3W1SC 2N1WA 4HCNB 3VXWA 2EMSA 2JXXA 4MSQB 3VTUA 2ZNVC 4BKSD 5JHBA 2L00B 1WX8A 4HK2A 2O2VA 2N9EB 4B95A 2IYDB 2KFKB 3ZNID 2I1JA 3UGBB 3JSVA 2DZMA 4II2B 2L0FA 2G45B 2NVUI 2GBRA 1WM2A 3HK0A 3L54A 4W9IA 4KSLC 4MEMA 3QK0A 2ZEQA 4BBNC 1RRBA 1XQQA 5J18A 2QHOA 1M94A 1V5OA 1YIWA 4ASWC 2DYBA 1YQBA 5EDSA 1GJZA 4IW0A 1OQYA 1WRDB 2GMIC 3K9PB 2O6VB 1P98A 4IUMB 2OOBB 2ZVOA 3ZVVA 1WFYA 4B9KA 1WMHB 2KHWB 4KVGB 5AZFA 4DBGA 4NY0A 3ALBA 1WGDA 4K7UA 2BYEA 2CS4A 3IBEA 3IVFA 3N3KB 1G6JA 4WQOB 2HJ8A 1WE7A 2PE6B 1WXSA 1P3QU 3EHVA 3QAQA 3QIJA 3KW5B 1E8WA 2G3QB 1ZGUB 2KX3A 4GU2A 2ASQA 2ZCBA 1WJ4A 2LJ5A 4FLHA 2Z59B 2L0TA 2RD0A 3JYUA 4I6LB 4IWQA 2LI5A 4HDOA 2JRIB 3ZLZA 3NHEB 1WX7A 4GDLB 3VAWA 3AU5A 4XX5A 3T9LA 2IBIB 4URKA 2MSED 1LFDA 3PLVA 1QZEA 4ANXA 2Z0DB 3NS8A 1UGMA 2L05A 4ANWA 3WIMA 1OTRB 3VH4B 1WGGA 1V81A 2KWVB 3CMMB 4ICVA 3TIXA 1ZKHA 1A5RA 1E8YA 5E6NA 1OEYA 2KKCA 2NS5A 1CMXB 3M62B 4HDQA 3NOBA 2KDEB 3SU8X 3U30A 5L95C 1UZXB 2GBKA 4EOYA 3M95A 2K8HA 3DQVA 3ZNHB 3NY5A 2DYMA 3R3MA 3L16A 3QCAA 5CTRC 3SD5A 3PT2B 5D6JB 1TZ1A 2J0MA 4FHJA 4WWOA 1HE8A 2FCQA 2L8JA 2LXAA 2ZJDA 3V6CB 2KDIA 2N9XA 2M8SA 2WX0A 4AOFA 2RR9A 2AEHA 4GN1A 4NAWB 3ZDTA 5C1ZA 1J19A 1VCBA 2CKHB 2KANA 2KJ6A 2GBJA 2MP2A 3VTWA 4FBJB 2C7NB 1J8CA 3BINA 1X1MA 4ANVA 4DK5A 4GGQA 4G50A 5JH5C 1H8CA 3R66C 4BKGA 3A4RA 4EKUA 4GIVA 2R2QA 3KUZA 3EECA 3OJ3A 4RMAA 4RM8A 3ZNZB 4DXAB 1C3TA 2BWFA 1S3SG 2KWUB 2LWPA 4M8NA 2KOXA 3PS6A 3QHTA 3X0WA 4II3B 1UH6A 2KNBA 3SHQA 4WWPA 2KFJA 4EFOA 2VRRB 4GDLA 2ZPNA 3HM3A 1S1QB 1E8ZA 1JRUA 3HIZA 2MCNB 2DZIA 3RZFA 4CYEA 2PJHA 1L7YA 3M3JA 5CHFA 3V62A 2PPHA 2MX2A 3DDCB 4KDIC 4HJKA 4NJ7A 1D3ZA 3ZUNA 3IFWB 3PLUA 3PRMB 2AYOB 2N7DA 2MA9B 2K8BA 2UYZB 3KYCD 3A33B 3PVLA 4K1RB 2IY0B 1Q5WB 2IO3B 1GNUA 3N32A 3RD2A 4NAWA 3QJZA 4F8CB 2YLMA 2JT4B 3B1LX 2MP2B 3H7SA 3ZTCA 1WE6A 4DHZB 5DPTA 3WALA 3H1UA 2LRWA 1WXVA 4LDTD 2MLBA 2KO3A 4KV2A 3A1QB 2KC2A 1WZ0A 1Y8RC 4IWOA 2J0JA 2AL3A 2KD0A 3AULA 2CHZA 4RM9A 2MBHA 5L83A 4MJSB 2RPQA 4I6NB 4MGYE 1SGHA 3KYDD 4W9JA 3QWZB 2KTRB 2LVOA 2KJRA 3APCA 4E71A 2KC1A 1WGHA 3B08A 2KN5A 4PS3A 4JIOU 3APDA 1EUVB 2L7RA 4M0WB 3DCGA 4ZYNA 3AU4A 3QC8B 4TV3A 3T8MA 4GDKB 1ISNA 1SE9A 1WXMA 3TJPA 4G3XB 4K81A 3UQAA 4KIKB 3DPDA 5CHVC 2M4NA 3VQIA 1J0GA 2JWZA 1XD3B 2YVCA 2G4SA 1UD7A 3RCZA 2BWES 4AUQC 2HTHA 2CHWA 3PRZA 3M63B 2K39A 4W9KA 1Z5SB 3QX1A 5DCNA 4IG7B 2W9NA 3L17A 5KHOA 4FJZA 3UQBA 4W9HA 4EZJA 4XC2A 2B3AA 5AZGA 5TR5A 2Z0EB 3KUDB 4HXDA 2FNJB 2HE7A 4ZRJA 2LZ6A 3OLMD 2IO1B 3AXCA 3O65B 4LJPB 2N1VA 2MRPA 4NJ6A 2JZZA 3DVGY 1YX5B 3PV1A 3TL5A 2UWQA 3RUIB 4TQ0A 2KZRA 2DHZA 3L10B 1Q0WB 3V60A 3W1SA 4MGKE 4ZRIA 4KZCA 5IA7A 2BKRB 1TTNA 2FAZA 5G55A 3ZDMC 3NZSA 1V49A 2N4FA 3ONSA 3HHMA 2GOWA 2MW5A 4LDTB 1VD2A 1ZW7A 1UBIA 3RULA 4F1SA 1I35A 4MSMB 3OJ4B 1UELA 2BF8B 4IM0A 1OGWA 4FJVB 3ML9A 5FR6A 1BT0A 2L3ZA 4MDKE 4PS8A 5DPRA 3WA0A 4WJQA 1WM3A 2KJHB 4MH0E 3PHXB 3R7RA 2J0KA 2BPSA 2KWCA 3DBHI 4IWPA 3GZNI 1FXTB 4FADA 4K7SA 3CSTA 3U7DA 4LCDE 4ANUA 2C7HA 2WYQA 4WJOA 4BKSA 3EFUA 2M0XA 4X57B 2N9PC 2IO0B 2IY1B 1WR6E 3R7QA 1KM7A 5LLIA 2Y5BB 3HM6X 3W1YA 5J17A 4ZDVA 1U4AA 1LM8B 2GBNA 3P2BA 3B0AA 3PSEB 4GB9A 4N9F4 3ZNGC 3UINB 3A9KB 3DOWA 4BKTA 1KOTA 4GDKA 3EC8A 4BBNF 1KLVA 3VHTC 3LJ3A 1WGRA 4ZRKA 4WWNA 4BVUC 2LASA 3K9OB 4IC7B 5HKHA 2A5UA 4FN2A 3ZRCA 2MBEA 2WDTB 2KTRA 2OJRA 4IM2A 3PHWB 3SDLC 3CF6E 3NZUA 3MTNB 3PPAA 4IM3A 4A3PA 4AWJA 4AJYB 2V3SA 1NI2A 3A9JA 3L0WB 2KMAA 4KZ0A 2KLCA 3N30A 2C7MB 1V86A 2HD5B 3KUCB 2G4DB 3L13A 3OAWA 2LD9A 4LJOB 2M17A 2DZJA 4W9LA 1RAXA 2LVQA 2REXA 4EUTA 3DVNU 1E5WA 1V80A 4BFRA 4PYZA 4GSWA 3JVZX 2KMCA 3WAMA 4FHKA 1E8XA 1LQBA 4HPLB 1GC7A 5DPWA 3VFKA 4E74A 3WAPA 3VVWB 2D07B 3ZIMA 1KJTA 1RFAA 4I6PA 1WYWB 1Z2MA 1P9DU 2NBWB 3D32A 4P7IA 5J2RA 1WF9A 4WJPA 4MM3A 4DHZE 2D3GA 3GOEA 4NQLB 3H7PB 2AL6A 1IYFA 1OEYJ 2JZ3B 4FA6A 1WJUA 2J7QB 3PRPB 3S2AA 2MBQA 3BY4B 4W9EA 3KH0A 3PTFC 4W9GA 5DPSA 3VUYA 3VUWA 5G2NA 4DDID 4MGZE 3TCAA 4JQWC 4BOZB 5GMVA 2JUOA 5JZEB 4HPMB 1LXDA 1EO6A 2O6VD 1TBEA 4TUUA 2JF5A 2CU1A 3PREA 1C1YB 3VTVA 4DWFA 1WMHA 2K25A 3DBRI 3X23A 3V6EB 4W9CA 2FCSA 2RGFA 2KQ7A 2EKEC 3QARA 3WANA 4DHJB 2LVPA 2PEAA 3V61A 4GOCA 4ICUA 5D7GA 3I3TB 5C23A 3QQ8B 2LGYA 2RSUA 4GMVA 2FUHB 2M1MA 4J6IA 1R4NI 3RT3B 2BYFA 1V6EA 2NR2A 5BO4B 3A1QA 5CX3A 4DDGD 4TKNA 4G11A 4AP4C 4TQ1A 2XK5A 1IP9A 3A4SC 3RYTA 2A4ZA 4W9DA 2JPHA 4GXBA 2V1YA 4G0NB 4B6WA 2IO2B 4CO7A 3ZRFA 2JRHA 1P0RA 4OVUA 4AJWA 1RLFA 4XZ4A 4PS7A 2C5LC 3PZDA 4HWIB 2MWSB 4JGHB 1I42A 4JLCA 5IAAC 2GBMA 2WWZA 2DZKA 1EF5A 2O6VA 4EEWA 1PQSA 4HVBA 2I1KA 4YL8A 5E6PA 3RZWC 2D10A 2JY6A 4OVVA 2KK8A 2PE9A 3AI5A 3ECIA 2FCNA 4KSKC 4MJSA 1E7VA 2KTFA 3KVFB 3IG3A 2KVRA 3UF8A 3UIOB 2BGFA 2KQSA 3ML8A 3ZW3A 1T0YA 3VUXA 3DVNV 2N7EA 3Q3JA 2ZCCA 3U8ZA 2ZPYA 1WJNA 3PGEA 1WX9A 3ZO5B 2CHXA 4WJNA 3A9KA 2BKFA 4KIKA 4F7ZA 2AWTA 2NBVB 2DYOA 4NQKE 4CHKA 1WH3A 1L2NA 4DHJD 5KHQA 2K6DB 2KDFB 3QA8A 2V4LA 3JW0X 4HCPB 4BOSC 5E6OA 1GC6A 2XEWA 2ZNVB 1E90A 1F9JA 2LXCA 2LRUA 1NBFC 5D94A 5AEKB 1AARA 2MBOA 1V5TA 3L08A 5JHAA 2C9WB 5LXHA 2FCMA 2KDBA 2NCNA 4NNJB 2BYVE 1R4MI 4W9FA 2D11A 3H7PA 4FJYA 2K1FA 2DENB 3ENEA 3TBLD 1WR1A 5CHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R2O A;  2K8C A;  2DX5 B;  4EZL A;  4PYU A;  2KXJ A;  2WX1 A;  3C0R B;  4A20 A;  4KDL B;  1SIF A;  2KFK A;  3IHP C;  2L76 A;  2NBU A;  4MGI E;  2CR5 A;  1E7U A;  1NDD A;  5LXI B;  4A3O A;  2LGX A;  1V2Y A;  1EF1 A;  2LUE A;  2ZVN A;  3ZTD A;  2KX0 A;  1P1A A;  2KLG A;  2K6Q A;  1XT9 B;  3UIP B;  1WJ6 A;  2NPT B;  1WGY A;  1UBQ A;  3VDZ A;  1GG3 A;  1TGZ B;  5AZH A;  1WIA A;  1WY8 A;  1MG8 A;  3LDZ E;  4EZK A;  2C60 A;  3VH3 B;  1Q1O A;  4WAA A;  1GUA B;  4JL9 A;  3CSF A;  2XK5 B;  4NPN A;  2FID A;  4MEL A;  3TMP B;  4E3C A;  2MBB B;  3DVG X;  3ZKJ C;  3MJW A;  3A9J B;  1WZ3 A;  1YD8 U;  2FIF A;  2LGD A;  3DBS A;  4M8M A;  1YJ1 A;  3Q3F A;  1K8R B;  4HLE A;  2XBB C;  3DBL I;  5D2M B;  2EMT A;  4FUL A;  3JSV B;  1WXA A;  2DAJ A;  1YX6 B;  1H4R A;  3H9D A;  1WI0 A;  3WAO A;  2ZZP B;  2JVC A;  3H6N A;  2MQJ A;  3MHS D;  1V9J A;  2IZV B;  1IPG A;  2NPT A;  2O2V B;  2DAF A;  4K7W A;  2D2Q A;  3APF A;  3W1S C;  2N1W A;  4HCN B;  3VXW A;  2EMS A;  2JXX A;  4MSQ B;  3VTU A;  2ZNV C;  4BKS D;  5JHB A;  2L00 B;  1WX8 A;  4HK2 A;  2O2V A;  2N9E B;  4B95 A;  2IYD B;  2KFK B;  3ZNI D;  2I1J A;  3UGB B;  3JSV A;  2DZM A;  4II2 B;  2L0F A;  2G45 B;  2NVU I;  2GBR A;  1WM2 A;  3HK0 A;  3L54 A;  4W9I A;  4KSL C;  4MEM A;  3QK0 A;  2ZEQ A;  4BBN C;  1RRB A;  1XQQ A;  5J18 A;  2QHO A;  1M94 A;  1V5O A;  1YIW A;  4ASW C;  2DYB A;  1YQB A;  5EDS A;  1GJZ A;  4IW0 A;  1OQY A;  1WRD B;  2GMI C;  3K9P B;  2O6V B;  1P98 A;  4IUM B;  2OOB B;  2ZVO A;  3ZVV A;  1WFY A;  4B9K A;  1WMH B;  2KHW B;  4KVG B;  5AZF A;  4DBG A;  4NY0 A;  3ALB A;  1WGD A;  4K7U A;  2BYE A;  2CS4 A;  3IBE A;  3IVF A;  3N3K B;  1G6J A;  4WQO B;  2HJ8 A;  1WE7 A;  2PE6 B;  1WXS A;  1P3Q U;  3EHV A;  3QAQ A;  3QIJ A;  3KW5 B;  1E8W A;  2G3Q B;  1ZGU B;  2KX3 A;  4GU2 A;  2ASQ A;  2ZCB A;  1WJ4 A;  2LJ5 A;  4FLH A;  2Z59 B;  2L0T A;  2RD0 A;  3JYU A;  4I6L B;  4IWQ A;  2LI5 A;  4HDO A;  2JRI B;  3ZLZ A;  3NHE B;  1WX7 A;  4GDL B;  3VAW A;  3AU5 A;  4XX5 A;  3T9L A;  2IBI B;  4URK A;  2MSE D;  1LFD A;  3PLV A;  1QZE A;  4ANX A;  2Z0D B;  3NS8 A;  1UGM A;  2L05 A;  4ANW A;  3WIM A;  1OTR B;  3VH4 B;  1WGG A;  1V81 A;  2KWV B;  3CMM B;  4ICV A;  3TIX A;  1ZKH A;  1A5R A;  1E8Y A;  5E6N A;  1OEY A;  2KKC A;  2NS5 A;  1CMX B;  3M62 B;  4HDQ A;  3NOB A;  2KDE B;  3SU8 X;  3U30 A;  5L95 C;  1UZX B;  2GBK A;  4EOY A;  3M95 A;  2K8H A;  3DQV A;  3ZNH B;  3NY5 A;  2DYM A;  3R3M A;  3L16 A;  3QCA A;  5CTR C;  3SD5 A;  3PT2 B;  5D6J B;  1TZ1 A;  2J0M A;  4FHJ A;  4WWO A;  1HE8 A;  2FCQ A;  2L8J A;  2LXA A;  2ZJD A;  3V6C B;  2KDI A;  2N9X A;  2M8S A;  2WX0 A;  4AOF A;  2RR9 A;  2AEH A;  4GN1 A;  4NAW B;  3ZDT A;  5C1Z A;  1J19 A;  1VCB A;  2CKH B;  2KAN A;  2KJ6 A;  2GBJ A;  2MP2 A;  3VTW A;  4FBJ B;  2C7N B;  1J8C A;  3BIN A;  1X1M A;  4ANV A;  4DK5 A;  4GGQ A;  4G50 A;  5JH5 C;  1H8C A;  3R66 C;  4BKG A;  3A4R A;  4EKU A;  4GIV A;  2R2Q A;  3KUZ A;  3EEC A;  3OJ3 A;  4RMA A;  4RM8 A;  3ZNZ B;  4DXA B;  1C3T A;  2BWF A;  1S3S G;  2KWU B;  2LWP A;  4M8N A;  2KOX A;  3PS6 A;  3QHT A;  3X0W A;  4II3 B;  1UH6 A;  2KNB A;  3SHQ A;  4WWP A;  2KFJ A;  4EFO A;  2VRR B;  4GDL A;  2ZPN A;  3HM3 A;  1S1Q B;  1E8Z A;  1JRU A;  3HIZ A;  2MCN B;  2DZI A;  3RZF A;  4CYE A;  2PJH A;  1L7Y A;  3M3J A;  5CHF A;  3V62 A;  2PPH A;  2MX2 A;  3DDC B;  4KDI C;  4HJK A;  4NJ7 A;  1D3Z A;  3ZUN A;  3IFW B;  3PLU A;  3PRM B;  2AYO B;  2N7D A;  2MA9 B;  2K8B A;  2UYZ B;  3KYC D;  3A33 B;  3PVL A;  4K1R B;  2IY0 B;  1Q5W B;  2IO3 B;  1GNU A;  3N32 A;  3RD2 A;  4NAW A;  3QJZ A;  4F8C B;  2YLM A;  2JT4 B;  3B1L X;  2MP2 B;  3H7S A;  3ZTC A;  1WE6 A;  4DHZ B;  5DPT A;  3WAL A;  3H1U A;  2LRW A;  1WXV A;  4LDT D;  2MLB A;  2KO3 A;  4KV2 A;  3A1Q B;  2KC2 A;  1WZ0 A;  1Y8R C;  4IWO A;  2J0J A;  2AL3 A;  2KD0 A;  3AUL A;  2CHZ A;  4RM9 A;  2MBH A;  5L83 A;  4MJS B;  2RPQ A;  4I6N B;  4MGY E;  1SGH A;  3KYD D;  4W9J A;  3QWZ B;  2KTR B;  2LVO A;  2KJR A;  3APC A;  4E71 A;  2KC1 A;  1WGH A;  3B08 A;  2KN5 A;  4PS3 A;  4JIO U;  3APD A;  1EUV B;  2L7R A;  4M0W B;  3DCG A;  4ZYN A;  3AU4 A;  3QC8 B;  4TV3 A;  3T8M A;  4GDK B;  1ISN A;  1SE9 A;  1WXM A;  3TJP A;  4G3X B;  4K81 A;  3UQA A;  4KIK B;  3DPD A;  5CHV C;  2M4N A;  3VQI A;  1J0G A;  2JWZ A;  1XD3 B;  2YVC A;  2G4S A;  1UD7 A;  3RCZ A;  2BWE S;  4AUQ C;  2HTH A;  2CHW A;  3PRZ A;  3M63 B;  2K39 A;  4W9K A;  1Z5S B;  3QX1 A;  5DCN A;  4IG7 B;  2W9N A;  3L17 A;  5KHO A;  4FJZ A;  3UQB A;  4W9H A;  4EZJ A;  4XC2 A;  2B3A A;  5AZG A;  5TR5 A;  2Z0E B;  3KUD B;  4HXD A;  2FNJ B;  2HE7 A;  4ZRJ A;  2LZ6 A;  3OLM D;  2IO1 B;  3AXC A;  3O65 B;  4LJP B;  2N1V A;  2MRP A;  4NJ6 A;  2JZZ A;  3DVG Y;  1YX5 B;  3PV1 A;  3TL5 A;  2UWQ A;  3RUI B;  4TQ0 A;  2KZR A;  2DHZ A;  3L10 B;  1Q0W B;  3V60 A;  3W1S A;  4MGK E;  4ZRI A;  4KZC A;  5IA7 A;  2BKR B;  1TTN A;  2FAZ A;  5G55 A;  3ZDM C;  3NZS A;  1V49 A;  2N4F A;  3ONS A;  3HHM A;  2GOW A;  2MW5 A;  4LDT B;  1VD2 A;  1ZW7 A;  1UBI A;  3RUL A;  4F1S A;  1I35 A;  4MSM B;  3OJ4 B;  1UEL A;  2BF8 B;  4IM0 A;  1OGW A;  4FJV B;  3ML9 A;  5FR6 A;  1BT0 A;  2L3Z A;  4MDK E;  4PS8 A;  5DPR A;  3WA0 A;  4WJQ A;  1WM3 A;  2KJH B;  4MH0 E;  3PHX B;  3R7R A;  2J0K A;  2BPS A;  2KWC A;  3DBH I;  4IWP A;  3GZN I;  1FXT B;  4FAD A;  4K7S A;  3CST A;  3U7D A;  4LCD E;  4ANU A;  2C7H A;  2WYQ A;  4WJO A;  4BKS A;  3EFU A;  2M0X A;  4X57 B;  2N9P C;  2IO0 B;  2IY1 B;  1WR6 E;  3R7Q A;  1KM7 A;  5LLI A;  2Y5B B;  3HM6 X;  3W1Y A;  5J17 A;  4ZDV A;  1U4A A;  1LM8 B;  2GBN A;  3P2B A;  3B0A A;  3PSE B;  4GB9 A;  4N9F 4;  3ZNG C;  3UIN B;  3A9K B;  3DOW A;  4BKT A;  1KOT A;  4GDK A;  3EC8 A;  4BBN F;  1KLV A;  3VHT C;  3LJ3 A;  1WGR A;  4ZRK A;  4WWN A;  4BVU C;  2LAS A;  3K9O B;  4IC7 B;  5HKH A;  2A5U A;  4FN2 A;  3ZRC A;  2MBE A;  2WDT B;  2KTR A;  2OJR A;  4IM2 A;  3PHW B;  3SDL C;  3CF6 E;  3NZU A;  3MTN B;  3PPA A;  4IM3 A;  4A3P A;  4AWJ A;  4AJY B;  2V3S A;  1NI2 A;  3A9J A;  3L0W B;  2KMA A;  4KZ0 A;  2KLC A;  3N30 A;  2C7M B;  1V86 A;  2HD5 B;  3KUC B;  2G4D B;  3L13 A;  3OAW A;  2LD9 A;  4LJO B;  2M17 A;  2DZJ A;  4W9L A;  1RAX A;  2LVQ A;  2REX A;  4EUT A;  3DVN U;  1E5W A;  1V80 A;  4BFR A;  4PYZ A;  4GSW A;  3JVZ X;  2KMC A;  3WAM A;  4FHK A;  1E8X A;  1LQB A;  4HPL B;  1GC7 A;  5DPW A;  3VFK A;  4E74 A;  3WAP A;  3VVW B;  2D07 B;  3ZIM A;  1KJT A;  1RFA A;  4I6P A;  1WYW B;  1Z2M A;  1P9D U;  2NBW B;  3D32 A;  4P7I A;  5J2R A;  1WF9 A;  4WJP A;  4MM3 A;  4DHZ E;  2D3G A;  3GOE A;  4NQL B;  3H7P B;  2AL6 A;  1IYF A;  1OEY J;  2JZ3 B;  4FA6 A;  1WJU A;  2J7Q B;  3PRP B;  3S2A A;  2MBQ A;  3BY4 B;  4W9E A;  3KH0 A;  3PTF C;  4W9G A;  5DPS A;  3VUY A;  3VUW A;  5G2N A;  4DDI D;  4MGZ E;  3TCA A;  4JQW C;  4BOZ B;  5GMV A;  2JUO A;  5JZE B;  4HPM B;  1LXD A;  1EO6 A;  2O6V D;  1TBE A;  4TUU A;  2JF5 A;  2CU1 A;  3PRE A;  1C1Y B;  3VTV A;  4DWF A;  1WMH A;  2K25 A;  3DBR I;  3X23 A;  3V6E B;  4W9C A;  2FCS A;  2RGF A;  2KQ7 A;  2EKE C;  3QAR A;  3WAN A;  4DHJ B;  2LVP A;  2PEA A;  3V61 A;  4GOC A;  4ICU A;  5D7G A;  3I3T B;  5C23 A;  3QQ8 B;  2LGY A;  2RSU A;  4GMV A;  2FUH B;  2M1M A;  4J6I A;  1R4N I;  3RT3 B;  2BYF A;  1V6E A;  2NR2 A;  5BO4 B;  3A1Q A;  5CX3 A;  4DDG D;  4TKN A;  4G11 A;  4AP4 C;  4TQ1 A;  2XK5 A;  1IP9 A;  3A4S C;  3RYT A;  2A4Z A;  4W9D A;  2JPH A;  4GXB A;  2V1Y A;  4G0N B;  4B6W A;  2IO2 B;  4CO7 A;  3ZRF A;  2JRH A;  1P0R A;  4OVU A;  4AJW A;  1RLF A;  4XZ4 A;  4PS7 A;  2C5L C;  3PZD A;  4HWI B;  2MWS B;  4JGH B;  1I42 A;  4JLC A;  5IAA C;  2GBM A;  2WWZ A;  2DZK A;  1EF5 A;  2O6V A;  4EEW A;  1PQS A;  4HVB A;  2I1K A;  4YL8 A;  5E6P A;  3RZW C;  2D10 A;  2JY6 A;  4OVV A;  2KK8 A;  2PE9 A;  3AI5 A;  3ECI A;  2FCN A;  4KSK C;  4MJS A;  1E7V A;  2KTF A;  3KVF B;  3IG3 A;  2KVR A;  3UF8 A;  3UIO B;  2BGF A;  2KQS A;  3ML8 A;  3ZW3 A;  1T0Y A;  3VUX A;  3DVN V;  2N7E A;  3Q3J A;  2ZCC A;  3U8Z A;  2ZPY A;  1WJN A;  3PGE A;  1WX9 A;  3ZO5 B;  2CHX A;  4WJN A;  3A9K A;  2BKF A;  4KIK A;  4F7Z A;  2AWT A;  2NBV B;  2DYO A;  4NQK E;  4CHK A;  1WH3 A;  1L2N A;  4DHJ D;  5KHQ A;  2K6D B;  2KDF B;  3QA8 A;  2V4L A;  3JW0 X;  4HCP B;  4BOS C;  5E6O A;  1GC6 A;  2XEW A;  2ZNV B;  1E90 A;  1F9J A;  2LXC A;  2LRU A;  1NBF C;  5D94 A;  5AEK B;  1AAR A;  2MBO A;  1V5T A;  3L08 A;  5JHA A;  2C9W B;  5LXH A;  2FCM A;  2KDB A;  2NCN A;  4NNJ B;  2BYV E;  1R4M I;  4W9F A;  2D11 A;  3H7P A;  4FJY A;  2K1F A;  2DEN B;  3ENE A;  3TBL D;  1WR1 A;  5CHW A; 
#chains in the Genus database with same CATH topology
 4B0M A;  2PMV A;  3NRZ A;  1ZXI A;  2KFK A;  3IHP C;  2L76 A;  2N9L A;  2CR5 A;  3BVG A;  1NDD A;  3NG0 A;  4A3O A;  2LUE A;  3ZTD A;  1P1A A;  1XT9 B;  3VDZ A;  1HZ6 A;  1WIA A;  3N20 C;  3HRD D;  3LDZ E;  2RDG A;  3VH3 B;  1Q1O A;  4JL9 A;  4QAY A;  4NZL B;  4MEL A;  3U7Z A;  3MJW A;  3A9J B;  1FCL A;  4M8M A;  4FUL A;  3JSV B;  1WXA A;  3H6N A;  2NPT A;  2X38 A;  2N1W A;  1QOB A;  2J42 A;  4HCN B;  4MSQ B;  2ZNV C;  1JQ4 A;  2L00 B;  1WX8 A;  2N9E B;  4B95 A;  2IYD B;  1VR9 A;  3UGB B;  4M00 A;  3H8H A;  3JSV A;  4R3D A;  3HK0 A;  4O1N A;  2QHO A;  3ABV B;  1YIW A;  4ASW C;  2DYB A;  4RFB A;  2MJE A;  1R4M B;  1AN8 A;  5EDS A;  1OQY A;  1WRD B;  1GJZ A;  3K9P B;  3BZD B;  3KWL A;  2KQ4 X;  3IXS A;  3ZVV A;  1WMH B;  1STE A;  3HVD A;  3IVF A;  4WQO B;  2HJ8 A;  4N6E B;  2WHI A;  3EHV A;  3QIJ A;  1WGK A;  2KX3 A;  2ICI A;  2ASQ A;  3HVZ A;  4C4V B;  4BAX A;  4IWQ A;  3ZLZ A;  3NHE B;  2I2Y A;  3AU5 A;  3T9L A;  3PLV A;  1UWX A;  4ANX A;  2PLP A;  4EE2 A;  2IJ0 A;  2L05 A;  1WGG A;  2KWV B;  1ZKH A;  2KWD A;  1YJJ A;  1ZXH A;  2RPV A;  1OEY A;  2KKC A;  4HDQ A;  3U30 A;  1OFF A;  3M95 A;  2K8H A;  3DQV A;  3ZGZ A;  2DYM A;  3QCA A;  2TSS A;  5D6J B;  2GI9 A;  2WNM A;  2VH2 A;  2L8J A;  2LXA A;  1Q10 A;  4GLS C;  3AE2 B;  2M8S A;  4AS1 A;  4GN1 A;  5C1Z A;  1VCB A;  2KJ6 A;  3VTW A;  2MP2 A;  4FBJ B;  3BIN A;  1DGJ A;  2RMM A;  3R66 C;  4BKG A;  1L6U A;  2R2Q A;  3OJ3 A;  1C3T A;  3T3O A;  1S3S G;  1R7S A;  2KT7 A;  3QHT A;  3AM9 A;  2ZPN A;  4KKJ A;  1E8Z A;  1TS4 A;  2L32 A;  2PJH A;  1L7Y A;  1KTK A;  5CHF A;  3AE4 B;  1AYF A;  2MX2 A;  1PYW D;  4RGN A;  1ET9 A;  3ZUN A;  2N7D A;  2NTS A;  2MA9 B;  2R61 A;  3P4P B;  3RD2 A;  3N32 A;  2JT4 B;  1ZDX A;  1L5P A;  4L2Y A;  4DHZ B;  4RF0 A;  3BYY B;  3WAL A;  1ET6 A;  2KO3 A;  2WU5 B;  4KV2 A;  2PVG C;  2PIA A;  1WZ0 A;  1Y8R C;  2KD0 A;  3AUL A;  2KAC A;  2MBH A;  1CJE A;  2WXH A;  3KYD D;  4W9J A;  4RH6 A;  2EKI A;  2KJR A;  3APC A;  2KC1 A;  1XO3 A;  2KN5 A;  2K5P A;  3VRB B;  3APD A;  4ZYN A;  4TV3 A;  4GDK B;  1VLB A;  3NVY A;  4KIK B;  3VQI A;  3ZQ4 A;  1J0G A;  2QCZ A;  2YVC A;  1UD7 A;  1YN3 A;  1SJE D;  3M63 B;  3AE1 B;  4W9K A;  4ARC A;  2WXP A;  3RPF C;  4IG7 B;  3IT4 B;  2D3A A;  2WDQ B;  3RNA C;  1ZPS A;  1P7F A;  4W9H A;  4EZJ A;  4JWS C;  5AZG A;  5TR5 A;  4HXD A;  1XLN A;  2IO1 B;  3IAS 1;  4P1C C;  4NJ6 A;  1IGC A;  1J7A A;  2DHZ A;  3V60 A;  4ZRI A;  2FAZ A;  5G55 A;  1YNT E;  3ONS A;  5BMI A;  1XLO A;  4F1S A;  4MSM B;  3OJ4 B;  5FR6 A;  1XLQ A;  4MDK E;  5E6J A;  1WM3 A;  4MH0 E;  2BPS A;  3Q8F A;  3W5U B;  4IWP A;  4K7S A;  3U7D A;  2IGD A;  2C7H A;  3IAM 1;  5H8Y E;  2IO0 B;  1KH0 A;  5LLI A;  1LM8 B;  3RNE C;  3B0A A;  3Q8B A;  3ZNG C;  3NJT A;  3DOW A;  1KOT A;  3VHT C;  3LJ3 A;  4WWN A;  2LAS A;  4IC7 B;  3ZRC A;  4HRS A;  2WDT B;  1XLP A;  2KTR A;  3SDL C;  3PHW B;  1TS5 A;  4IM3 A;  1HZ5 A;  1SB3 C;  1UNS A;  3AED B;  1NI2 A;  3L0W B;  2KLC A;  3OAW A;  2LD9 A;  2M17 A;  2DZJ A;  1WSP A;  4EUT A;  2JSV X;  5GXG B;  1NI3 A;  4BFR A;  1FIQ A;  4P16 A;  2VH1 A;  4HPL B;  1JAL A;  4P7I A;  5J2R A;  1WF9 A;  3AEG B;  4MM3 A;  3N9Y C;  1I4P A;  4DHZ E;  1SE2 A;  4NQL B;  2AL6 A;  1OEY J;  2JZ3 B;  2J7Q B;  2MBQ A;  5DPS A;  3VUY A;  2QJL A;  3PTF C;  1HXY D;  1MI0 A;  3Q8E A;  1LXD A;  2O6V D;  2L1A A;  2HDE A;  5IOI A;  3V6E B;  2FCS A;  2H89 B;  2EKE C;  1ENF A;  2LUM A;  3QQ8 B;  4GMV A;  4J6I A;  2FUH B;  2BYF A;  5CX3 A;  4DDG D;  1MFW A;  4AP4 C;  2VZK D;  2BB5 A;  3RYT A;  1FFV A;  2JPH A;  4GXB A;  4AJW A;  4OVU A;  2N0S B;  2C5L C;  3PZD A;  3I9V 1;  1KRH A;  4WH4 A;  1EWC A;  1I42 A;  5LNK 1;  5IAA C;  1FRR A;  1NYR A;  1EF5 A;  3MJ5 A;  3V3X A;  3P4S B;  2QMT A;  1TKG A;  5E6P A;  4KSK C;  3UF8 A;  3IG3 A;  2BGF A;  3ZW3 A;  1T0Y A;  1XEE A;  2N7E A;  3Q3J A;  2ZCC A;  1PGA A;  4RF1 A;  3MC0 B;  3PGE A;  1FEH A;  4WJN A;  1F0Z A;  2AWT A;  1WH3 A;  1L2N A;  4S0R A;  2KDF B;  5BMG A;  3JW0 X;  4YWG G;  3TEZ A;  2ZNV B;  1E90 A;  1D5X C;  4DXG A;  2KDB A;  4ZRP A;  2BYV E;  2D11 A;  2DEN B;  1HQR D;  1IYF A;  2INP E;  2K8C A;  2DX5 B;  1JRP A;  4PYU A;  4KDL B;  4KGR A;  1TKE A;  1XF5 L;  2NBU A;  1E7U A;  1WRI A;  4JE3 B;  3GP7 A;  2K6Q A;  1WYG A;  1WJ6 A;  2NPT B;  1GG3 A;  2D3C A;  4L23 A;  1WY8 A;  4EZK A;  1T3Q A;  1JW9 D;  1GUA B;  2XK5 B;  1KLG D;  1L0X B;  2MBB B;  4IDI A;  1WZ3 A;  1QLB B;  3GZN B;  1YJ1 A;  3EA6 A;  4HLE A;  1YX6 B;  4KKI A;  3URY A;  3H9D A;  1VDV A;  2K0P A;  5FR3 A;  2IZV B;  1IPG A;  3BVZ A;  2XNA C;  3I5J C;  4BKS D;  2JXX A;  5JHB A;  2WXO A;  4HK2 A;  2KFK B;  1MJD A;  3ZNI D;  2J53 A;  1E7P B;  2DZM A;  4II2 B;  3L54 A;  2G45 B;  4W9I A;  4C56 C;  1WM2 A;  4N58 A;  5J18 A;  4IW0 A;  3WCQ A;  2OOB B;  2ZVO A;  1WFY A;  4B9K A;  3Q69 A;  2KHW B;  5AZF A;  4KVG B;  4DBG A;  3ALB A;  2BYE A;  2CS4 A;  3IBE A;  1G6J A;  2J4X A;  3KW5 B;  2W55 A;  2ZCB A;  5IO9 A;  2Z59 B;  3JYU A;  1TKY A;  3L4P A;  3OG5 A;  1N5X A;  4XX5 A;  4URK A;  4K3B A;  1UGM A;  4ANW A;  2INN E;  1SE4 A;  1BML C;  3WIM A;  4ARI A;  2DWQ A;  3IT6 B;  3TIX A;  1A5R A;  3DWM A;  4TMA B;  2IND C;  2G9H D;  2JXT A;  5E6N A;  2NS5 A;  5HG2 A;  5L95 C;  4EOY A;  1RFK A;  3AB5 A;  1ZOY B;  3UI3 A;  5CTR C;  1ZP0 B;  3SD5 A;  2JU6 X;  1Y56 A;  3E56 A;  4FHJ A;  5D3D A;  1JWM D;  3V6C B;  2N9X A;  3AEB B;  4AOF A;  3AH7 A;  1J19 A;  4LNI A;  2KAN A;  2GBJ A;  4G50 A;  5JH5 C;  1H8C A;  4ITK A;  3A4R A;  3KUZ A;  3EEC A;  1UUP A;  2BWF A;  4M8N A;  2KWU B;  2LWP A;  1I4Q A;  1YN5 A;  3X0W A;  4II3 B;  1UH6 A;  2KNB A;  3SHQ A;  1ACC A;  2DZI A;  4CYE A;  4C4V A;  2PPH A;  3DDC B;  2AQ3 B;  4KDI C;  2WDR B;  4RGT A;  3W9C B;  2PTL A;  3AEC B;  4C00 A;  3PRM B;  4K3C A;  2I38 A;  2UYZ B;  1LGR A;  2IO3 B;  3NVW A;  4RCO A;  4F8C B;  3LB8 C;  2MP2 B;  3H7S A;  3ZTC A;  1WWT A;  3U52 E;  2V9H A;  3DBH B;  3A1Q B;  2KC2 A;  1EU3 A;  2J0J A;  2AL3 A;  2CHZ A;  5H92 C;  5L83 A;  4I6N B;  2D5G A;  3QWZ B;  2KTR B;  2LGI A;  2YEP B;  5BMH A;  5HFY A;  4E71 A;  3B08 A;  1ROE A;  1EUV B;  4M0W B;  3DCG A;  3T8M A;  1ISN A;  1WXM A;  2WQY B;  2JWZ A;  4ZHP A;  1C76 A;  3SFE B;  2Y3A A;  4AUQ C;  2HTH A;  1Z5S B;  3QX1 A;  2BT6 A;  2W9N A;  3L17 A;  4FJZ A;  2JYT A;  2MJD A;  5G5H A;  1YQ3 B;  1SXT A;  2Z0E B;  3KUD B;  3BK2 A;  3AE5 B;  3AXC A;  3BYT B;  3O65 B;  2JYE A;  2MRP A;  2JZZ A;  3TL5 A;  1YX5 B;  3PV1 A;  2UWQ A;  4ZRQ A;  2KZR A;  4MH8 A;  3J9C A;  3ZXR A;  2D3B A;  4KZC A;  5IA7 A;  2BKR B;  1V49 A;  2GOW A;  1VD2 A;  4M02 A;  3RUL A;  4YTN B;  2WXG A;  2WXR A;  1N60 A;  1UEL A;  2V3P A;  2QIL A;  1OGW A;  4FJV B;  1BT0 A;  2L3Z A;  5DPR A;  4WJQ A;  2KJH B;  3DBH I;  2J52 A;  1VZ8 A;  1J7B A;  3GZN I;  1FXT B;  3CST A;  4LCD E;  4BKS A;  2CU3 A;  1C78 A;  3EFU A;  5T8I A;  4X57 B;  2V3N A;  1WR6 E;  2QDF A;  3U4E G;  2GBN A;  3NS1 A;  4GB9 A;  4N9F 4;  4GDK A;  3BWU D;  3EC8 A;  4BBN F;  1GB1 A;  1YQ4 B;  4ZRK A;  2WDV B;  2LEK A;  4FN2 A;  2MBE A;  1R4N B;  1DOY A;  4HJG E;  3PPA A;  1GB4 A;  4A3P A;  1N6Z A;  1IBX B;  3A9J A;  2KMA A;  2W3S A;  4KZ0 A;  2C7M B;  1QQR A;  3KUC B;  3L13 A;  4JX1 C;  4W9L A;  2LVQ A;  2BS2 B;  1HA5 A;  1F1H A;  3WAM A;  4FHK A;  1FM0 D;  4LNF A;  2PVO D;  3VFK A;  1KJT A;  1JWB D;  1P9D U;  2NBW B;  4ACF A;  1FFU A;  1KLU D;  4YTM B;  4FA6 A;  1WJU A;  3ETR A;  2XN9 C;  4W9G A;  3W5V B;  3VUW A;  4DDI D;  4JQW C;  4BOZ B;  5GMV A;  1SE3 A;  2JUO A;  4C7Y A;  1FO4 A;  1EO6 A;  1TBE A;  1UWM A;  1T5X D;  2JF5 A;  3PRE A;  3ZXV A;  1C1Y B;  1L0Y B;  4YSY B;  1WMH A;  3DBR I;  4US8 A;  3P42 A;  3WAN A;  4DHJ B;  1SF0 A;  2LVP A;  4ICU A;  3I3T B;  3GE8 C;  4L1B A;  2M1M A;  3FIL B;  5BO4 B;  4TKN A;  4P6V F;  3TSS A;  2XK5 A;  1FPY A;  2M19 A;  3AV8 A;  4B6W A;  4LTU A;  2FE8 A;  3ZJV A;  4PS7 A;  4HWI B;  1N5W A;  4JGH B;  3P4Q B;  3NVZ A;  4A6Q A;  1FCC C;  1UF0 A;  4EEW A;  4IKG A;  3T3N A;  2D10 A;  2WP9 B;  5EE3 A;  3ECI A;  2FCN A;  4MJS A;  1E7V A;  2KTF A;  2LMC A;  4P1B C;  1KF6 B;  1WX9 A;  3ZO5 B;  1YN4 A;  2NBV B;  4NQK E;  3QA8 A;  3DHG C;  4YSZ B;  2L52 A;  2JX5 A;  2V4L A;  2AX5 A;  1TYG B;  4HCP B;  4BOS C;  5E6O A;  1GC6 A;  1EWY C;  3MC8 A;  1NBF C;  3R8B A;  5JHA A;  1AAR A;  2MBO A;  1V5T A;  3L08 A;  1OQR A;  1T0S C;  1R4M I;  4A9A A;  3H7P A;  4N59 A;  5CHW A;  2HJ1 A;  2KXJ A;  2WX1 A;  2ZW1 A;  1SIF A;  4MGI E;  5LXI B;  1FMA D;  1C77 A;  1EF1 A;  5BYR A;  2ZVN A;  2KX0 A;  3UIP B;  1WGY A;  1UBQ A;  5AZH A;  4AQ7 A;  3CSF A;  2FID A;  3TMP B;  2DLB A;  4US9 A;  3DVG X;  3ZKJ C;  2WU2 B;  5D3I B;  1YD8 U;  3DHI C;  2W3R A;  3DBL I;  5D2M B;  2EMT A;  3WAO A;  3MHS D;  2JVC A;  1V9J A;  2CJO A;  2O2V B;  3B2G A;  2WS3 B;  4PK1 A;  3Q3O C;  3APF A;  3W1S C;  1E10 A;  2FBW B;  4MT5 A;  4LNK A;  2I1J A;  2L0F A;  2NVU I;  4KSL C;  4C7Z A;  1PDX A;  3MHZ A;  1TZO A;  5HI1 A;  4OZB A;  1YQB A;  1P98 A;  1QKZ A;  4XYC A;  4NY0 A;  4K7U A;  3N1Z C;  2PE6 B;  3I63 C;  1QOG A;  1RYJ A;  3ZJU A;  1MG4 A;  2ONQ A;  1E8W A;  1ZE3 D;  1ZGU B;  4GU2 A;  3BVM A;  1SSN A;  4FLH A;  3SR6 A;  2RD0 A;  2N7J A;  3I57 A;  2JRI B;  1WX7 A;  1FD6 A;  2BW2 A;  2IBI B;  2MJ3 A;  5EE9 A;  2EEL A;  1T0Q C;  3NS8 A;  2NMQ A;  5C2T B;  2KMM A;  4RGO S;  1OTR B;  1QT9 A;  4OZC A;  3CMM B;  3B2F A;  2RDB C;  4YXD B;  4NAM A;  2IGH A;  2Z8L A;  1CMX B;  3SU8 X;  2KDE B;  1UZX B;  2GBK A;  3NY5 A;  2WXI A;  4S17 A;  1TS3 A;  3PT2 B;  1YMH E;  2INC C;  2J0M A;  2PKO A;  4WWO A;  2FCQ A;  4J3O D;  2ZJD A;  1P7E A;  2QIE B;  1SEB D;  1FNU A;  3B9J A;  2RR9 A;  2AEH A;  3ZDT A;  4NAW B;  2VZK B;  2CKH B;  3KLS X;  3LXF A;  2C7N B;  4OVZ A;  1JRO A;  4DK5 A;  4GGQ A;  4GIV A;  4UDU C;  4RMA A;  1E6E B;  5TSS A;  1XXG A;  1FRD A;  4CQN A;  3PS6 A;  4RGM A;  4WWP A;  4EFO A;  2JQR B;  4GDL A;  3HM3 A;  1S1Q B;  3HIZ A;  2MCN B;  1T6B X;  3RZF A;  1NYQ A;  2OED A;  3M3J A;  3Q6B A;  3W2D A;  1L4D B;  1C79 A;  1UGJ A;  4NJ7 A;  1D3Z A;  1GOZ A;  1HTQ A;  1WXQ A;  1Q5W B;  2JZP A;  1GNU A;  2BB6 A;  3QJZ A;  3MP9 A;  3AEF B;  4PT5 A;  5DPT A;  2ON8 A;  4LDT D;  4IWO A;  1RM6 C;  4DXF A;  1DYQ A;  2W82 A;  5BYS A;  4MJS B;  2RPQ A;  4MGY E;  4LNO A;  3R2I A;  4PS3 A;  4JIO U;  5FKA C;  1SE9 A;  3TJP A;  4G3X B;  3DPD A;  1PUT A;  3RCZ A;  2LHD A;  4M0W A;  3Q2A C;  2CHW A;  3DHH C;  3EFC A;  1JCK B;  5DCN A;  1B1Z A;  3FAH A;  5KHO A;  1V97 A;  4MM3 B;  5I4D A;  4XC2 A;  2B3A A;  2LJI A;  2FNJ B;  2HE7 A;  4ZRJ A;  1FNV A;  4LJP B;  2N1V A;  5EE0 A;  3RUI B;  2E3T A;  1JWU D;  1Q0W B;  1GPX A;  4MGK E;  1TTN A;  3ZDM C;  3AE7 B;  4XWW A;  2KAJ A;  2N4F A;  2MW5 A;  1JML A;  2QC8 A;  5AUI A;  3ZJT A;  2MH7 A;  1UBI A;  4ZOH C;  1OQQ A;  2N9K A;  3ML9 A;  3WA0 A;  4WQM A;  3PHX B;  4M01 A;  2J0K A;  2KWC A;  3AE9 B;  4FAD A;  4ANU A;  2WYQ A;  3GE3 C;  1TIF A;  3AEE B;  2M0X A;  2N9P C;  2IY1 B;  3R7Q A;  3W1Y A;  2Y5B B;  1U4A A;  3Q8C A;  1T0R C;  3P2B A;  3PSE B;  2WXQ A;  3MC9 A;  1KLV A;  1WGR A;  1GAQ B;  4BVU C;  3K9O B;  3AEA B;  4IM2 A;  1CZP A;  2OJR A;  2GB1 A;  1FNW A;  1CQV A;  1IGD A;  3MTN B;  4AWJ A;  3GB1 A;  4AJY B;  5C3J B;  2OJW A;  3Q3M C;  2G4D B;  5AUK A;  2REX A;  3U2S C;  3PZ8 A;  2LFI A;  4BZA A;  4PYZ A;  4XE0 A;  2IDY A;  3JVZ X;  2KMC A;  2SEB D;  4GSW A;  1V1O A;  1GC7 A;  5DPW A;  3RFZ B;  3WAP A;  3VVW B;  3NZ3 A;  2D07 B;  1FXI A;  4I6P A;  2X8X X;  2MEK A;  1SBB B;  3GOE A;  1N62 A;  1I4R A;  3PRP B;  2Y5C A;  3S2A A;  1PFD A;  4B0E A;  2CJN A;  1SJH D;  4KGT A;  1K51 A;  1NEN B;  5JZE B;  4HPM B;  1QF6 A;  3DBL B;  4TUU A;  2KDM A;  2CU1 A;  2K22 A;  4DWF A;  3RI7 C;  2NTT A;  3PO0 A;  2K25 A;  3X23 A;  3BK1 A;  5BYQ A;  3P4R B;  4TSS A;  2RGF A;  2KQ7 A;  2PEA A;  3V61 A;  4GOC A;  3Q3N C;  4HEA 1;  5D7G A;  5C23 A;  3RT3 B;  1V6E A;  2WXL A;  2IPK D;  3Q8A A;  3A1Q A;  3AE8 B;  1VJK A;  4G11 A;  4TQ1 A;  2BBC A;  5FK9 C;  3A4S C;  4XDD A;  2V1Y A;  2IO2 B;  1VZ6 A;  4CO7 A;  2JRH A;  1P0R A;  4XZ4 A;  3RNC C;  2MWS B;  4YSX B;  1NEK B;  1ESF A;  1C4C A;  1TY2 A;  2GBM A;  4HVB A;  2I1K A;  1VRA B;  4YL8 A;  2GRI A;  3P1M A;  3RZW C;  4KX6 B;  5MPO A;  2KK8 A;  1TJE A;  3KVF B;  1L0V B;  3C19 A;  1N61 A;  3DVN V;  3U8Z A;  2OHF A;  4D2K A;  1WJN A;  2YEP F;  2K9X A;  3A9K A;  2BKF A;  1HEZ E;  1LO5 D;  1IUE A;  1ZDV A;  5KHQ A;  4JPS A;  3VR8 B;  1F9J A;  3RMK C;  2LRU A;  1V1P B;  2KYW A;  5D94 A;  3RNF C;  5AEK B;  4XDC A;  2C9W B;  2LHE A;  2NCN A;  4W9F A;  4HKZ E;  3BII D;  3TBL D;  2R2O A;  4EZL A;  3C0R B;  4A20 A;  2SAK A;  4A90 A;  1I4X A;  1ZUD 2;  2LGX A;  5IP4 D;  1V2Y A;  1XCQ L;  3KWV A;  4A55 A;  2KLG A;  2DBY A;  3P63 A;  3AE6 B;  1TGZ B;  1HTO A;  1L4Z B;  1MG8 A;  3VRA B;  1D5Z C;  2WLB A;  2C60 A;  4WAA A;  1N63 A;  4NPN A;  4E3C A;  1QOF A;  2LGD A;  2FIF A;  1K52 A;  3DBS A;  1JWA D;  3Q3F A;  1K8R B;  2KVZ A;  2XBB C;  1MHX A;  2DAJ A;  1E9M A;  1L6V A;  1H4R A;  1WI0 A;  2LGS A;  2ZZP B;  2MQJ A;  4K7W A;  3C8Y A;  2DAF A;  2W54 A;  2D2Q A;  1QIL A;  4ZYS A;  3VXW A;  2EMS A;  3VTU A;  2O2V A;  4NJC A;  2WXJ A;  2PW9 A;  2GBR A;  1RWS A;  2V4I B;  4MEM A;  3QK0 A;  5IKC M;  2ZEQ A;  1QOA A;  4BBN C;  1RRB A;  1XQQ A;  2MHJ A;  1M94 A;  1V5O A;  2GMI C;  2ZW0 A;  2O6V B;  4IUM B;  3AE3 B;  3MFG A;  1WGD A;  3AMZ A;  3N3K B;  2WXK A;  1WE7 A;  1WXS A;  1P3Q U;  4LK0 M;  3QAQ A;  1BUI C;  2G3Q B;  4OW0 A;  1WJ4 A;  2LJ5 A;  2L0T A;  4I6L B;  1MPE A;  4WUR A;  2LI5 A;  4HDO A;  1F77 A;  3VAW A;  4GDL B;  3TEX A;  2MSE D;  1LFD A;  1QZE A;  2Z0D B;  4DQO C;  3VH4 B;  2M0A A;  1V81 A;  4ICV A;  1XCT L;  1E8Y A;  1B9R A;  4YTP B;  3M62 B;  3NOB A;  2DNF A;  3HUI A;  2HTM E;  3ZNH B;  3R3M A;  3L16 A;  2QEJ C;  1IBX A;  1TZ1 A;  3GS2 A;  1HE8 A;  2JWU A;  2KDI A;  2WX0 A;  2L83 A;  4H2A A;  4XWT A;  3TUO A;  1J8C A;  1X1M A;  4ANV A;  4EKU A;  2UU7 A;  3ZNZ B;  4RM8 A;  4HRO A;  4DXA B;  2KOX A;  2BYT A;  1VZ7 A;  2KFJ A;  4WAF A;  1C4A A;  1F52 A;  2VRR B;  1JRU A;  1F2R C;  2G1E A;  1PGB A;  3FKY A;  1PGX A;  4REZ A;  3E9S A;  3V62 A;  1JWS D;  1V8C A;  4HJK A;  3ZYY X;  3IFW B;  3PLU A;  3EGR A;  1NVI D;  2AYO B;  2BS4 B;  2K8B A;  3KYC D;  3A33 B;  3PVL A;  4K1R B;  2IY0 B;  4NAW A;  4LNN A;  2YLM A;  1F2R I;  3B1L X;  1EM7 A;  1SIJ A;  1WE6 A;  1YOV B;  3CWI A;  3SFD B;  3H1U A;  2LRW A;  1WXV A;  1KFY B;  2MLB A;  1A70 A;  1MVK A;  4RM9 A;  5G5G A;  3LYY A;  3OWE B;  3O13 A;  2B76 B;  1SGH A;  3SEB A;  2LVO A;  4LLG M;  4YT0 B;  1WGH A;  1MHH E;  2KN4 A;  2L7R A;  3AU4 A;  3QC8 B;  1AWD A;  4K81 A;  3UQA A;  5CHV C;  2AQ1 B;  2M4N A;  1XD3 B;  2G4S A;  2BWE S;  3PRZ A;  2K39 A;  3RNG C;  2WGS A;  3UQB A;  3N1Y C;  1I4G A;  2LZ6 A;  3OLM D;  1J7C A;  2V0G A;  2M56 B;  4WWM A;  3DVG Y;  4TQ0 A;  3L10 B;  4RNA A;  3W1S A;  1TY0 A;  2IGG A;  3NZS A;  4LDT B;  3HHM A;  3FC4 A;  1ZW7 A;  4USA A;  4MAC A;  1I35 A;  1C9F A;  1DOI A;  4Q2J A;  2BF8 B;  1DOX A;  4IM0 A;  1K50 A;  4PS8 A;  1D6E C;  3NUH B;  1C4P A;  3Q14 C;  3CIR B;  3R7R A;  5JXV A;  1YJI A;  4WJO A;  2Y5P A;  4XGA B;  1BXT A;  3RNB C;  1KM7 A;  5J17 A;  3HM6 X;  1M4V A;  4ZDV A;  3UIN B;  3A9K B;  5HHD G;  4BKT A;  5EE1 A;  3DWG C;  4A8X C;  4FXC A;  5HKH A;  1FXA A;  2A5U A;  2RDH A;  3CF6 E;  3NZU A;  1D4B A;  2V3S A;  3N30 A;  1V86 A;  3V05 A;  2HD5 B;  4KGS A;  4LJO B;  1RAX A;  3DVN U;  1E5W A;  1V80 A;  1E8X A;  3DBR B;  1LQB A;  4E74 A;  2BTE A;  3ZIM A;  1RFA A;  1WYW B;  1Z2M A;  3D32 A;  4WJP A;  2K3U A;  2WXN A;  2D3G A;  3H7P B;  3FIL A;  1AW7 A;  1V1P A;  3AN1 A;  3BY4 B;  2FUG 1;  4W9E A;  3KH0 A;  5G2N A;  4MGZ E;  3TCA A;  4IOI E;  3VTV A;  4HPP A;  4ZHO A;  1K53 A;  3R2T A;  1E0Z A;  4W9C A;  2Q5W D;  1CK1 A;  2BS3 B;  3QAR A;  2WXM A;  2AQ2 B;  2LGY A;  2RSU A;  1R4N I;  4WIP A;  2NR2 A;  1I7H A;  1TS2 A;  1IP9 A;  2BQQ A;  2A4Z A;  4W9D A;  4G0N B;  3ZRF A;  3TEY A;  1I4H A;  1RLF A;  2E6X A;  3N1X C;  2BVC A;  4HKQ A;  4OZA A;  4JLC A;  3KQ4 A;  4OHJ A;  2WWZ A;  2DZK A;  2O6V A;  2ACZ B;  1PQS A;  3VR9 B;  3RN9 C;  2JY6 A;  4OVV A;  2PE9 A;  3AI5 A;  2KVR A;  3UIO B;  2KQS A;  3ML8 A;  2QSD A;  1TT5 B;  3VUX A;  2ZPY A;  4JWU C;  2CHX A;  4KIK A;  3TEW A;  4F7Z A;  2GLS A;  2DYO A;  4CHK A;  4DHJ D;  2K6D B;  5IN7 A;  4C80 A;  3NVV A;  2XEW A;  2LXC A;  1D5M C;  5LXH A;  2FCM A;  4NNJ B;  1EU4 A;  2WXF A;  2K1F A;  3ENE A;  4FJY A;  1WR1 A;  3EUB 2;  2H88 B;  3PZ7 A; 
#chains in the Genus database with same CATH homology
 2R2O A;  2K8C A;  2DX5 B;  4EZL A;  4PYU A;  2KXJ A;  2WX1 A;  3C0R B;  4A20 A;  4KDL B;  1SIF A;  2KFK A;  3IHP C;  2L76 A;  2NBU A;  4MGI E;  2CR5 A;  1E7U A;  1NDD A;  5LXI B;  4A3O A;  2LGX A;  1V2Y A;  1EF1 A;  2LUE A;  2ZVN A;  3ZTD A;  2KX0 A;  1P1A A;  2KLG A;  2K6Q A;  1XT9 B;  3UIP B;  1WJ6 A;  2NPT B;  1WGY A;  1UBQ A;  3VDZ A;  1GG3 A;  1TGZ B;  5AZH A;  1WIA A;  1WY8 A;  1MG8 A;  3LDZ E;  4EZK A;  2C60 A;  3VH3 B;  1Q1O A;  4WAA A;  1GUA B;  4JL9 A;  3CSF A;  2XK5 B;  4NPN A;  2FID A;  4MEL A;  3TMP B;  4E3C A;  2MBB B;  3DVG X;  3ZKJ C;  3MJW A;  3A9J B;  1WZ3 A;  1YD8 U;  2FIF A;  2LGD A;  3DBS A;  4M8M A;  1YJ1 A;  3Q3F A;  1K8R B;  4HLE A;  2XBB C;  3DBL I;  5D2M B;  2EMT A;  4FUL A;  3JSV B;  1WXA A;  2DAJ A;  1YX6 B;  1H4R A;  3H9D A;  1WI0 A;  3WAO A;  2ZZP B;  2JVC A;  3H6N A;  2MQJ A;  3MHS D;  1V9J A;  2IZV B;  1IPG A;  2NPT A;  2O2V B;  2DAF A;  4K7W A;  2D2Q A;  3APF A;  3W1S C;  2N1W A;  4HCN B;  3VXW A;  2EMS A;  2JXX A;  4MSQ B;  3VTU A;  2ZNV C;  4BKS D;  5JHB A;  2L00 B;  1WX8 A;  4HK2 A;  2O2V A;  2N9E B;  4B95 A;  2IYD B;  2KFK B;  3ZNI D;  2I1J A;  3UGB B;  3JSV A;  2DZM A;  4II2 B;  2L0F A;  2G45 B;  2NVU I;  2GBR A;  1WM2 A;  3HK0 A;  3L54 A;  4W9I A;  4KSL C;  4MEM A;  3QK0 A;  2ZEQ A;  4BBN C;  1RRB A;  1XQQ A;  5J18 A;  2QHO A;  1M94 A;  1V5O A;  1YIW A;  4ASW C;  2DYB A;  1YQB A;  5EDS A;  1GJZ A;  4IW0 A;  1OQY A;  1WRD B;  2GMI C;  3K9P B;  2O6V B;  1P98 A;  4IUM B;  2OOB B;  2ZVO A;  3ZVV A;  1WFY A;  4B9K A;  1WMH B;  2KHW B;  4KVG B;  5AZF A;  4DBG A;  4NY0 A;  3ALB A;  1WGD A;  4K7U A;  2BYE A;  2CS4 A;  3IBE A;  3IVF A;  3N3K B;  1G6J A;  4WQO B;  2HJ8 A;  1WE7 A;  2PE6 B;  1WXS A;  1P3Q U;  3EHV A;  3QAQ A;  3QIJ A;  3KW5 B;  1E8W A;  2G3Q B;  1ZGU B;  2KX3 A;  4GU2 A;  2ASQ A;  2ZCB A;  1WJ4 A;  2LJ5 A;  4FLH A;  2Z59 B;  2L0T A;  2RD0 A;  3JYU A;  4I6L B;  4IWQ A;  2LI5 A;  4HDO A;  2JRI B;  3ZLZ A;  3NHE B;  1WX7 A;  4GDL B;  3VAW A;  3AU5 A;  4XX5 A;  3T9L A;  2IBI B;  4URK A;  2MSE D;  1LFD A;  3PLV A;  1QZE A;  4ANX A;  2Z0D B;  3NS8 A;  1UGM A;  2L05 A;  4ANW A;  3WIM A;  1OTR B;  3VH4 B;  1WGG A;  1V81 A;  2KWV B;  3CMM B;  4ICV A;  3TIX A;  1ZKH A;  1A5R A;  1E8Y A;  5E6N A;  1OEY A;  2KKC A;  2NS5 A;  1CMX B;  3M62 B;  4HDQ A;  3NOB A;  2KDE B;  3SU8 X;  3U30 A;  5L95 C;  1UZX B;  2GBK A;  4EOY A;  3M95 A;  2K8H A;  3DQV A;  3ZNH B;  3NY5 A;  2DYM A;  3R3M A;  3L16 A;  3QCA A;  5CTR C;  3SD5 A;  3PT2 B;  5D6J B;  1TZ1 A;  2J0M A;  4FHJ A;  4WWO A;  1HE8 A;  2FCQ A;  2L8J A;  2LXA A;  2ZJD A;  3V6C B;  2KDI A;  2N9X A;  2M8S A;  2WX0 A;  4AOF A;  2RR9 A;  2AEH A;  4GN1 A;  4NAW B;  3ZDT A;  5C1Z A;  1J19 A;  1VCB A;  2CKH B;  2KAN A;  2KJ6 A;  2GBJ A;  2MP2 A;  3VTW A;  4FBJ B;  2C7N B;  1J8C A;  3BIN A;  1X1M A;  4ANV A;  4DK5 A;  4GGQ A;  4G50 A;  5JH5 C;  1H8C A;  3R66 C;  4BKG A;  3A4R A;  4EKU A;  4GIV A;  2R2Q A;  3KUZ A;  3EEC A;  3OJ3 A;  4RMA A;  4RM8 A;  3ZNZ B;  4DXA B;  1C3T A;  2BWF A;  1S3S G;  2KWU B;  2LWP A;  4M8N A;  2KOX A;  3PS6 A;  3QHT A;  3X0W A;  4II3 B;  1UH6 A;  2KNB A;  3SHQ A;  4WWP A;  2KFJ A;  4EFO A;  2VRR B;  4GDL A;  2ZPN A;  3HM3 A;  1S1Q B;  1E8Z A;  1JRU A;  3HIZ A;  2MCN B;  2DZI A;  3RZF A;  4CYE A;  2PJH A;  1L7Y A;  3M3J A;  5CHF A;  3V62 A;  2PPH A;  2MX2 A;  3DDC B;  4KDI C;  4HJK A;  4NJ7 A;  1D3Z A;  3ZUN A;  3IFW B;  3PLU A;  3PRM B;  2AYO B;  2N7D A;  2MA9 B;  2K8B A;  2UYZ B;  3KYC D;  3A33 B;  3PVL A;  4K1R B;  2IY0 B;  1Q5W B;  2IO3 B;  1GNU A;  3N32 A;  3RD2 A;  4NAW A;  3QJZ A;  4F8C B;  2YLM A;  2JT4 B;  3B1L X;  2MP2 B;  3H7S A;  3ZTC A;  1WE6 A;  4DHZ B;  5DPT A;  3WAL A;  3H1U A;  2LRW A;  1WXV A;  4LDT D;  2MLB A;  2KO3 A;  4KV2 A;  3A1Q B;  2KC2 A;  1WZ0 A;  1Y8R C;  4IWO A;  2J0J A;  2AL3 A;  2KD0 A;  3AUL A;  2CHZ A;  4RM9 A;  2MBH A;  5L83 A;  4MJS B;  2RPQ A;  4I6N B;  4MGY E;  1SGH A;  3KYD D;  4W9J A;  3QWZ B;  2KTR B;  2LVO A;  2KJR A;  3APC A;  4E71 A;  2KC1 A;  1WGH A;  3B08 A;  2KN5 A;  4PS3 A;  4JIO U;  3APD A;  1EUV B;  2L7R A;  4M0W B;  3DCG A;  4ZYN A;  3AU4 A;  3QC8 B;  4TV3 A;  3T8M A;  4GDK B;  1ISN A;  1SE9 A;  1WXM A;  3TJP A;  4G3X B;  4K81 A;  3UQA A;  4KIK B;  3DPD A;  5CHV C;  2M4N A;  3VQI A;  1J0G A;  2JWZ A;  1XD3 B;  2YVC A;  2G4S A;  1UD7 A;  3RCZ A;  2BWE S;  4AUQ C;  2HTH A;  2CHW A;  3PRZ A;  3M63 B;  2K39 A;  4W9K A;  1Z5S B;  3QX1 A;  5DCN A;  4IG7 B;  2W9N A;  3L17 A;  5KHO A;  4FJZ A;  3UQB A;  4W9H A;  4EZJ A;  4XC2 A;  2B3A A;  5AZG A;  5TR5 A;  2Z0E B;  3KUD B;  4HXD A;  2FNJ B;  2HE7 A;  4ZRJ A;  2LZ6 A;  3OLM D;  2IO1 B;  3AXC A;  3O65 B;  4LJP B;  2N1V A;  2MRP A;  4NJ6 A;  2JZZ A;  3DVG Y;  1YX5 B;  3PV1 A;  3TL5 A;  2UWQ A;  3RUI B;  4TQ0 A;  2KZR A;  2DHZ A;  3L10 B;  1Q0W B;  3V60 A;  3W1S A;  4MGK E;  4ZRI A;  4KZC A;  5IA7 A;  2BKR B;  1TTN A;  2FAZ A;  5G55 A;  3ZDM C;  3NZS A;  1V49 A;  2N4F A;  3ONS A;  3HHM A;  2GOW A;  2MW5 A;  4LDT B;  1VD2 A;  1ZW7 A;  1UBI A;  3RUL A;  4F1S A;  1I35 A;  4MSM B;  3OJ4 B;  1UEL A;  2BF8 B;  4IM0 A;  1OGW A;  4FJV B;  3ML9 A;  5FR6 A;  1BT0 A;  2L3Z A;  4MDK E;  4PS8 A;  5DPR A;  3WA0 A;  4WJQ A;  1WM3 A;  2KJH B;  4MH0 E;  3PHX B;  3R7R A;  2J0K A;  2BPS A;  2KWC A;  3DBH I;  4IWP A;  3GZN I;  1FXT B;  4FAD A;  4K7S A;  3CST A;  3U7D A;  4LCD E;  4ANU A;  2C7H A;  2WYQ A;  4WJO A;  4BKS A;  3EFU A;  2M0X A;  4X57 B;  2N9P C;  2IO0 B;  2IY1 B;  1WR6 E;  3R7Q A;  1KM7 A;  5LLI A;  2Y5B B;  3HM6 X;  3W1Y A;  5J17 A;  4ZDV A;  1U4A A;  1LM8 B;  2GBN A;  3P2B A;  3B0A A;  3PSE B;  4GB9 A;  4N9F 4;  3ZNG C;  3UIN B;  3A9K B;  3DOW A;  4BKT A;  1KOT A;  4GDK A;  3EC8 A;  4BBN F;  1KLV A;  3VHT C;  3LJ3 A;  1WGR A;  4ZRK A;  4WWN A;  4BVU C;  2LAS A;  3K9O B;  4IC7 B;  5HKH A;  2A5U A;  4FN2 A;  3ZRC A;  2MBE A;  2WDT B;  2KTR A;  2OJR A;  4IM2 A;  3PHW B;  3SDL C;  3CF6 E;  3NZU A;  3MTN B;  3PPA A;  4IM3 A;  4A3P A;  4AWJ A;  4AJY B;  2V3S A;  1NI2 A;  3A9J A;  3L0W B;  2KMA A;  4KZ0 A;  2KLC A;  3N30 A;  2C7M B;  1V86 A;  2HD5 B;  3KUC B;  2G4D B;  3L13 A;  3OAW A;  2LD9 A;  4LJO B;  2M17 A;  2DZJ A;  4W9L A;  1RAX A;  2LVQ A;  2REX A;  4EUT A;  3DVN U;  1E5W A;  1V80 A;  4BFR A;  4PYZ A;  4GSW A;  3JVZ X;  2KMC A;  3WAM A;  4FHK A;  1E8X A;  1LQB A;  4HPL B;  1GC7 A;  5DPW A;  3VFK A;  4E74 A;  3WAP A;  3VVW B;  2D07 B;  3ZIM A;  1KJT A;  1RFA A;  4I6P A;  1WYW B;  1Z2M A;  1P9D U;  2NBW B;  3D32 A;  4P7I A;  5J2R A;  1WF9 A;  4WJP A;  4MM3 A;  4DHZ E;  2D3G A;  3GOE A;  4NQL B;  3H7P B;  2AL6 A;  1IYF A;  1OEY J;  2JZ3 B;  4FA6 A;  1WJU A;  2J7Q B;  3PRP B;  3S2A A;  2MBQ A;  3BY4 B;  4W9E A;  3KH0 A;  3PTF C;  4W9G A;  5DPS A;  3VUY A;  3VUW A;  5G2N A;  4DDI D;  4MGZ E;  3TCA A;  4JQW C;  4BOZ B;  5GMV A;  2JUO A;  5JZE B;  4HPM B;  1LXD A;  1EO6 A;  2O6V D;  1TBE A;  4TUU A;  2JF5 A;  2CU1 A;  3PRE A;  1C1Y B;  3VTV A;  4DWF A;  1WMH A;  2K25 A;  3DBR I;  3X23 A;  3V6E B;  4W9C A;  2FCS A;  2RGF A;  2KQ7 A;  2EKE C;  3QAR A;  3WAN A;  4DHJ B;  2LVP A;  2PEA A;  3V61 A;  4GOC A;  4ICU A;  5D7G A;  3I3T B;  5C23 A;  3QQ8 B;  2LGY A;  2RSU A;  4GMV A;  2FUH B;  2M1M A;  4J6I A;  1R4N I;  3RT3 B;  2BYF A;  1V6E A;  2NR2 A;  5BO4 B;  3A1Q A;  5CX3 A;  4DDG D;  4TKN A;  4G11 A;  4AP4 C;  4TQ1 A;  2XK5 A;  1IP9 A;  3A4S C;  3RYT A;  2A4Z A;  4W9D A;  2JPH A;  4GXB A;  2V1Y A;  4G0N B;  4B6W A;  2IO2 B;  4CO7 A;  3ZRF A;  2JRH A;  1P0R A;  4OVU A;  4AJW A;  1RLF A;  4XZ4 A;  4PS7 A;  2C5L C;  3PZD A;  4HWI B;  2MWS B;  4JGH B;  1I42 A;  4JLC A;  5IAA C;  2GBM A;  2WWZ A;  2DZK A;  1EF5 A;  2O6V A;  4EEW A;  1PQS A;  4HVB A;  2I1K A;  4YL8 A;  5E6P A;  3RZW C;  2D10 A;  2JY6 A;  4OVV A;  2KK8 A;  2PE9 A;  3AI5 A;  3ECI A;  2FCN A;  4KSK C;  4MJS A;  1E7V A;  2KTF A;  3KVF B;  3IG3 A;  2KVR A;  3UF8 A;  3UIO B;  2BGF A;  2KQS A;  3ML8 A;  3ZW3 A;  1T0Y A;  3VUX A;  3DVN V;  2N7E A;  3Q3J A;  2ZCC A;  3U8Z A;  2ZPY A;  1WJN A;  3PGE A;  1WX9 A;  3ZO5 B;  2CHX A;  4WJN A;  3A9K A;  2BKF A;  4KIK A;  4F7Z A;  2AWT A;  2NBV B;  2DYO A;  4NQK E;  4CHK A;  1WH3 A;  1L2N A;  4DHJ D;  5KHQ A;  2K6D B;  2KDF B;  3QA8 A;  2V4L A;  3JW0 X;  4HCP B;  4BOS C;  5E6O A;  1GC6 A;  2XEW A;  2ZNV B;  1E90 A;  1F9J A;  2LXC A;  2LRU A;  1NBF C;  5D94 A;  5AEK B;  1AAR A;  2MBO A;  1V5T A;  3L08 A;  5JHA A;  2C9W B;  5LXH A;  2FCM A;  2KDB A;  2NCN A;  4NNJ B;  2BYV E;  1R4M I;  4W9F A;  2D11 A;  3H7P A;  4FJY A;  2K1F A;  2DEN B;  3ENE A;  3TBL D;  1WR1 A;  5CHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...