2KD0A

Nmr solution structure of o64736 protein from arabidopsis thaliana. northeast structural genomics consortium mega target ar3445a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
MGHHHHHHSHSTIKLTVKFGGKSIPLSVSPDCTVKDLKSQLQPITNVLPRGQKLIFKGKVLVETSTLKQSDVGSGAKLMLMASQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of O64736 protein from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
molecule keywords LRR repeats and ubiquitin-like domain-containing protein At2
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2008-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kd0A01
3TCAA 3DDCB 3DBSA 4EFOA 4A3PA 1UZXB 4I6NB 2Z59B 2KJ6A 4AP4C 4KDLB 4EZLA 2ZJDA 1SE9A 3NOBA 2HTHA 3IFWB 2NPTA 1WH3A 1Q5WB 1WZ0A 1XT9B 4MEMA 2N7DA 1E5WA 3QAQA 1J8CA 3VUYA 3KW5B 2AL6A 3APDA 4LDTB 2ZCCA 2KX0A 5G2NA 3ZTCA 1X1MA 3S2AA 3IBEA 3JVZX 2JRIB 4FHKA 4JLCA 4FN2A 1M94A 4WQOB 2MP2A 5JHBA 5DPWA 2L3ZA 1WGRA 4GMVA 3KYCD 1WM3A 1E8XA 2O2VB 2MBOA 2K8HA 2QHOA 1G6JA 1YX6B 2L76A 1FXTB 2RD0A 1SGHA 4B9KA 1V81A 3VVWB 3APCA 4FJVB 4HCNB 4PYZA 4AWJA 3QWZB 4I6PA 4OVVA 4WWNA 4K7SA 4LJOB 4TQ1A 2DENB 1AARA 4ANXA 3A9KA 4WJOA 3Q3JA 2GOWA 4XC2A 4WWOA 1V49A 1GJZA 2O6VA 1D3ZA 2MP2B 3PPAA 2MBQA 4AUQC 3VUXA 3ZNID 4DBGA 3L10B 1YD8U 2LVOA 3PTFC 4MJSA 5IAAC 3PRPB 1CMXB 4W9KA 3ZW3A 4AJWA 4BVUC 1WRDB 4KZCA 2PEAA 5FR6A 5AZFA 5D2MB 3TIXA 2LRWA 1H4RA 2WYQA 2ZEQA 4RMAA 2N1WA 3WAOA 3IG3A 1VCBA 1OTRB 3TL5A 2KDIA 4W9GA 1TGZB 2GBJA 3H7PA 1EUVB 1WYWB 3M62B 1WX9A 2V4LA 3PRZA 1OGWA 2K6DB 2XK5A 1WY8A 2LVQA 5LLIA 1WI0A 4YL8A 3NY5A 5CHVC 5C23A 3SDLC 4HWIB 2IBIB 5D7GA 2WX1A 4IC7B 1WE7A 4GU2A 4ZDVA 2FNJB 3KVFB 1E8WA 1WMHB 2R2QA 2DZKA 3KUDB 3W1SA 4FADA 4KDIC 1R4MI 2JY6A 2KD0A 3AU5A 4LCDE 1WXMA 2REXA 2WDTB 3UF8A 2JWZA 5LXIB 4GGQA 4FHJA 3OJ4B 2LASA 3CMMB 4DK5A 2B3AA 3QCAA 2G3QB 2MBHA 3PS6A 4RM8A 1ZW7A 4ZRIA 2JZ3B 4M8NA 4GDKA 1K8RB 2CHZA 3NS8A 2IYDB 1Q0WB 4NPNA 3V61A 4W9DA 2FCQA 3EECA 2BYFA 2EMTA 4F8CB 2KXJA 2KN5A 4TUUA 2ZNVC 1IPGA 2J0MA 3I3TB 1S1QB 2KJRA 2C5LC 4CO7A 3B0AA 3PT2B 3L0WB 2RSUA 4DHZE 3UIOB 1WF9A 2M1MA 2KLGA 2CR5A 1E7VA 4G3XB 4MH0E 3T8MA 4HVBA 2W9NA 2IZVB 2NBWB 1IYFA 5JHAA 4CHKA 3CF6E 3V60A 2NS5A 3B1LX 3A4RA 4IM2A 2GBRA 3ZNGC 3DBHI 4MM3A 1KJTA 4I6LB 4NAWA 4JQWC 3DVNU 4DXAB 4PS8A 4HK2A 4XX5A 1E8ZA 1WE6A 3PLVA 2LVPA 3H1UA 1S3SG 1WGYA 1T0YA 2Z0EB 3RUIB 1WXAA 3QHTA 2YVCA 5JZEB 4EOYA 2MBBB 3JW0X 4W9HA 5L95C 3CSFA 2O6VB 1GC6A 4NQKE 4ASWC 1WFYA 1XQQA 1EF1A 2KC1A 4AOFA 3R7QA 3V6EB 3A4SC 4MSQB 3NHEB 2KKCA 2DAFA 4N9F4 3SD5A 5E6PA 1L2NA 5DPRA 3BY4B 3DVNV 3MTNB 4OVUA 4TKNA 3VXWA 2FCSA 3VUWA 1C3TA 2KLCA 4GN1A 4F1SA 3X0WA 1EF5A 2L00B 2DZJA 2LGDA 2XK5B 1YJ1A 2UYZB 5TR5A 1WXSA 3L16A 2IO0B 3T9LA 5L83A 4IM0A 2O6VD 1SIFA 1L7YA 4KSLC 4GIVA 3RULA 3X23A 2AL3A 2BWES 2G45B 2K1FA 2M8SA 4II2B 2PE6B 3OAWA 3A9JA 2KQSA 3AXCA 4NJ7A 2PE9A 2XEWA 5J2RA 3WIMA 2KJHB 4P7IA 3UGBB 1Q1OA 3AULA 2WX0A 3MJWA 2IO3B 4MJSB 2JRHA 1KOTA 5IA7A 4FA6A 4F7ZA 3JSVB 4LDTD 4WJQA 3HM6X 4RM9A 2L0TA 1LM8B 2JPHA 2MBEA 2N7EA 3DBLI 2KFKA 1WJUA 2KNBA 4W9JA 4BKTA 2KO3A 2LRUA 2N9EB 3R66C 2VRRB 3DBRI 2KTFA 3QARA 3WALA 2MRPA 4K81A 3DOWA 4HXDA 1WX8A 3QK0A 4MSMB 4ZRJA 2BPSA 2N9PC 1F9JA 1RAXA 3IHPC 2L7RA 4JGHB 1QZEA 1OQYA 4DDGD 2KMCA 3A9JB 3A1QA 1ISNA 1Z2MA 2IY0B 3ALBA 3Q3FA 3N32A 4A3OA 1WIAA 2ZCBA 3ZO5B 2K6QA 2DZMA 3ONSA 4EZKA 2IO1B 2NPTB 4HPLB 2FCNA 1GUAB 3HM3A 4G0NB 4PYUA 2I1JA 2R2OA 3WAMA 3DVGX 4BFRA 3HIZA 1I42A 1V9JA 2ZNVB 4IWQA 2LI5A 1OEYJ 1WM2A 1WX7A 4IWPA 4WAAA 3PSEB 4HDQA 2D07B 4JIOU 2NBUA 5E6OA 5J18A 1P98A 5KHOA 2BF8B 2C7NB 2M17A 4GOCA 3DCGA 4K7UA 2O2VA 3AI5A 3UQBA 3LJ3A 3ZDMC 3O65B 3QC8B 4W9IA 4EUTA 2KDBA 4BBNF 3R7RA 2DZIA 2KQ7A 4MGYE 3L08A 5CHFA 1KLVA 1WGHA 3GZNI 3QIJA 3VTVA 3VAWA 3PLUA 4PS7A 5E6NA 4A20A 3U7DA 4DWFA 2M0XA 4TQ0A 3VDZA 1WJNA 2KWUB 3A9KB 3L54A 1E8YA 2CHXA 3BINA 2C60A 2ASQA 2BKRB 4FJZA 4NNJB 4B95A 2MSED 2RPQA 2KZRA 3C0RB 2LZ6A 3K9OB 1WXVA 3MHSD 2IY1B 3M63B 4ICUA 2YLMA 2K25A 2L0FA 5GMVA 3PGEA 4NQLB 2NVUI 3PHWB 2MA9B 5G55A 4WJPA 4MGIE 4FJYA 1IP9A 2KK8A 2KC2A 3UINB 4X57B 4M0WB 1WGDA 3CSTA 1BT0A 4LJPB 4KIKB 2PPHA 4HLEA 1MG8A 1LXDA 3EHVA 5J17A 2C7MB 3VTWA 2DYBA 2LGYA 3VQIA 1P0RA 2G4SA 1V80A 3K9PB 1WJ6A 4K7WA 3W1YA 3JSVA 2MLBA 5KHQA 3LDZE 3VH3B 3ZNHB 2EKEC 2KHWB 2HD5B 3PVLA 3V6CB 2KFKB 2HE7A 4GSWA 2DYOA 4IM3A 1UH6A 2OOBB 3H9DA 2I1KA 1OEYA 5DPTA 1GG3A 1UBIA 2BYVE 3R3MA 5C1ZA 3QX1A 4DHZB 3TBLD 2XBBC 2K8BA 3ZRCA 4GXBA 3L13A 2IO2B 4URKA 3ZTDA 4IG7B 3UQAA 2J0JA 3UIPB 3EFUA 1JRUA 4EEWA 2GBNA 4ICVA 4JL9A 1U4AA 2NCNA 2HJ8A 4MGZE 2GMIC 1YX5B 1WGGA 4CYEA 3N30A 1ZGUB 3D32A 2ZVOA 3QJZA 2KANA 3DVGY 3QA8A 3VFKA 4BKGA 2MWSB 1P3QU 5HKHA 2KTRA 4GDLA 3OLMD 3ZDTA 4ANUA 2L05A 3H7PB 5DPSA 5DCNA 4AJYB 2BWFA 2JXXA 4KVGB 5AZHA 4G50A 5AEKB 4KV2A 1TTNA 4E3CA 1GNUA 5JH5C 1VD2A 2KX3A 1H8CA 2KOXA 2CHWA 4HDOA 3HHMA 2KVRA 1C1YB 1WZ3A 2A5UA 2J0KA 3DQVA 2UWQA 4B6WA 2NBVB 3U30A 2RGFA 2L8JA 1R4NI 2AEHA 3RD2A 4ZRKA 3ECIA 4WWPA 1TBEA 3WANA 3PRMB 3ZIMA 3M3JA 2KDFB 5EDSA 3SHQA 1PQSA 3B08A 4IUMB 3TMPB 2ZPNA 1Z5SB 2MW5A 2ZVNA 3RZFA 2GBMA 2KTRB 4GDLB 4HCPB 4KSKC 3RZWC 3ZNZB 2DX5B 4DHJB 4GDKB 1WR6E 2AYOB 4W9FA 1UBQA 2AWTA 2K8CA 3VH4B 1XD3B 1RLFA 2KWCA 5CX3A 4E71A 3A33B 2CS4A 2ZPYA 2MQJA 3ENEA 3ML8A 1UGMA 2JUOA 2FUHB 4W9LA 2FCMA 2EMSA 4J6IA 2D11A 4EKUA 2BGFA 3DPDA 5BO4B 1V5TA 5AZGA 4FLHA 4II3B 3NZUA 1E90A 3PZDA 4TV3A 2CKHB 4KIKA 1RFAA 4DDID 3PHXB 4EZJA 4HPMB 1NI2A 4W9EA 1P9DU 5CHWA 1E7UA 1NDDA 2J7QB 2M4NA 3H7SA 1V5OA 2JZZA 4HJKA 4MGKE 4NJ6A 3V62A 2A4ZA 4BBNC 2KWVB 4NAWB 3L17A 1TZ1A 3U8ZA 3KUZA 3N3KB 4IWOA 4KZ0A 3AU4A 2V1YA 2OJRA 3RYTA 4BOSC 2DYMA 2KMAA 4GB9A 2LUEA 2N1VA 1UD7A 4PS3A 1NBFC 2KFJA 4ANVA 1V2YA 2D10A 2FIDA 3HK0A 3TJPA 2MX2A 1LQBA 3OJ3A 4MELA 3KUCB 1YQBA 3KH0A 1V6EA 1J0GA 2G4DB 4MDKE 3IVFA 2RR9A 3APFA 2K39A 3A1QB 5LXHA 3H6NA 4ZYNA 2GBKA 3GOEA 1P1AA 2KDEB 2LGXA 1J19A 3KYDD 3NZSA 5CTRC 4ANWA 4W9CA 3WAPA 4FBJB 2CU1A 2DHZA 4FULA 3JYUA 3ML9A 2N4FA 3QQ8B 4BKSD 3P2BA 4K1RB 3VHTC 3ZLZA 2Y5BB 2V3SA 5D6JB 3W1SC 2NR2A 3ZRFA 2LWPA 4G11A 2LD9A 4M8MA 3SU8X 4E74A 2DAJA 2D2QA 3PV1A 3M95A 3RT3B 5D94A 3ZUNA 1EO6A 2BKFA 3ZKJC 1WJ4A 4WJNA 4NY0A 1ZKHA 4BKSA 2N9XA 2BYEA 2FIFA 2C9WB 4XZ4A 1GC7A 1KM7A 2D3GA 2FAZA 3RCZA 3PREA 1RRBA 1WMHA 1WR1A 1UELA 3EC8A 4DHJD 2Z0DB 3WA0A 2MCNB 2LXAA 2WWZA 4BOZB 2JVCA 2C7HA 3ZVVA 4IW0A 1YIWA 1HE8A 1A5RA 2LJ5A 1V86A 1I35A 2PJHA 3VTUA 2ZZPB 2JT4B 1LFDA 2LXCA 2JF5A 1Y8RC
chains in the Genus database with same CATH superfamily
3TCAA 4C4VA 1UZXB 5BYSA 3Q8AA 3NOBA 1YN4A 1Q5WB 1WZ0A 1XT9B 4MEMA 3ZTCA 3AEBB 4FHKA 2JRIB 2JSVX 4WQOB 1WGRA 1YN5A 3KYCD 1WM3A 2O2VB 1ZP0B 3ZJTA 1F52A 1HXYD 2L76A 2K0PA 1E9MA 3QWZB 4HROA 4WWMA 4LJOB 4TQ1A 1PGXA 1VJKA 4WJOA 2GOWA 4XC2A 1GJZA 3VRAB 5G5HA 1FMAD 1YD8U 2LVOA 3NVVA 3AEGB 2BS3B 2KWDA 4LNOA 5AZFA 2LRWA 2L1AA 1H4RA 2WYQA 2N1WA 1E0ZA 4W9GA 1UNSA 2GBJA 2H89B 4RF1A 4LTUA 2V4LA 3PRZA 1DOYA 2W82A 1OGWA 2XK5A 2LVQA 2WXQA 5LLIA 3Q3MC 4YL8A 3SDLC 2IBIB 3BK1A 5D7GA 2N0SB 4ZDVA 2FNJB 1TS3A 2KD0A 1TYGB 4DXGA 1D5MC 2B3AA 2G3QB 3PS6A 1ZW7A 4NPNA 1Q0WB 2MJ3A 3FILA 4W9DA 3EECA 4CQNA 2KN5A 1C79A 3E9SA 4HRSA 1L6UA 1WF9A 2LUMA 4NJCA 2HTME 4M02A 1F2RC 3ZJUA 1L0YB 3A4RA 4FXCA 2AQ2B 1HQRD 1KJTA 3NVZA 4NAWA 4JQWC 3DVNU 3MC8A 2W54A 4ZHPA 1SIJA 2TSSA 1GC6A 4NQKE 2J53A 2KC1A 4XWWA 1F1HA 3NHEB 2J52A 2DAFA 3MHZA 4N9F4 5E6PA 3BY4B 3VXWA 5BMIA 2D3AA 3NVYA 3HUIA 4GN1A 1BMLC 1EF5A 2LGDA 3ETRA 3T9LA 2IO0B 1L7YA 2WXOA 3VR8B 2G45B 1T0QC 4II2B 4S0RA 2LGIA 4P7IA 3NJTA 3MJWA 1SSNA 1PGBA 1T5XD 1KOTA 4LLGM 4FA6A 3BVGA 1JCKB 3JSVB 4LDTD 4RM9A 2JPHA 4HKZE 1WJUA 3SEBA 2KO3A 2LRUA 5BMGA 3R66C 3GP7A 3DBRI 4HXDA 1E7PB 2N9PC 3IHPC 1P7FA 4S17A 2BB6A 4EE2A 3N32A 4L2YA 2WQYB 4EZKA 4HPLB 2R2OA 3WAMA 2PVOD 2ZNVB 2SEBD 3N20C 1ZUD2 4OZAA 1TKYA 4HDQA 2K3UA 3PSEB 5E6OA 5J18A 1P98A 2BF8B 4P1BC 1N62A 3TEXA 3UQBA 3LJ3A 3QC8B 4W9IA 2V9HA 1C77A 3L08A 1WGHA 1SBBB 3VAWA 4PS7A 1YOVB 4DWFA 1WSPA 3AE2B 4RGMA 3A9KB 2Y5PA 3BINA 4FJZA 4NNJB 4B95A 3C0RB 3K9OB 1WXVA 3FAHA 1VLBA 4OZCA 3M63B 2K25A 5GMVA 4NQLB 2NVUI 4HEA1 3NG0A 1WGDA 2NTTA 3AEFB 2PPHA 4HLEA 1NENB 1LXDA 3EHVA 1IUEA 2C7MB 1V80A 4K7WA 3W1YA 5KHQA 3JSVA 2MLBA 2IGGA 3VH3B 2EKEC 2KHWB 2HD5B 5EE9A 2KFKB 2HE7A 4GSWA 2WS3B 1UH6A 3ZJVA 1GG3A 3V3XA 1WWTA 4DHZB 3TBLD 2XBBC 1MPEA 2W3RA 2IO2B 4URKA 3MFGA 2NTSA 1QOFA 4A90A 2K9XA 3Q8BA 2NCNA 1EWYC 2HJ8A 2GMIC 3QJZA 1JWUD 3DVGY 1AN8A 2MWSB 2KTRA 4GDLA 3ZDTA 5FKAC 5DPSA 3RNFC 4AJYB 2KACA 1H8CA 2E3TA 3HHMA 1WZ3A 2J0KA 2NMQA 2RGFA 3RD2A 4ZRKA 4WWPA 1TBEA 3M3JA 3KQ4A 1QF6A 1WGKA 2IJ0A 2WU2B 2WU5B 3ZNZB 3R2IA 1RLFA 2MH7A 2ZPYA 3ENEA 1LO5D 1UGMA 2FCMA 2N9LA 4J6IA 2JXTA 1V5TA 1HA5A 2MJDA 4OZBA 4TV3A 3PZDA 4KX6B 1V1OA 1ET6A 1E7UA 3L17A 1EU4A 1TZ1A 1L0XB 3N3KB 4BOSC 2KMAA 2KYWA 2N1VA 1UD7A 2KFJA 1V2YA 2D10A 2MX2A 5E6JA 1MJDA 2G4DB 1WRIA 2RR9A 3IAM1 3A1QB 4ZYNA 2GBKA 2G1EA 5CTRC 1TJEA 3NZSA 1QQRA 1JWSD 2FE8A 1QOGA 2INCC 3JYUA 4BKSD 4XGAB 4JWUC 4KGSA 2LD9A 1FIQA 4M8MA 4RFBA 3SU8X 2AQ3B 3M95A 1CZPA 1ZKHA 4BKSA 1D6EC 2C9WB 3EGRA 4K3BA 1RRBA 1WR1A 3EC8A 4BOZB 2LXAA 4OVZA 2JVCA 4L1BA 1YIWA 2PJHA 4RF0A 2JT4B 2LXCA 2JF5A 1Y8RC 4C56C 3DDCB 2OEDA 3DBSA 4EFOA 1HTQA 1MG4A 4AP4C 2ZJDA 5HHDG 2NPTA 1WH3A 1RM6C 2N7DA 4BAXA 2AL6A 3APDA 2KX0A 5G2NA 1WYGA 4M0WA 2WLBA 3KWVA 1L4DB 3JVZX 4JLCA 3AN1A 2KT7A 4AS1A 2MP2A 5JHBA 5DPWA 2RDGA 4NZLB 1FXTB 2RD0A 1SGHA 4ZHOA 4HCNB 2QSDA 1V1PB 3AE6B 3P4RB 4I6PA 4Q2JA 4OVVA 4WQMA 5FR3A 3GZNB 4ANXA 2RMMA 4WWOA 2QMTA 1V49A 2MP2B 3AE8B 3RMKC 4AUQC 3VUXA 2JYEA 3PTFC 3PRPB 1CMXB 3SFDB 4KZCA 5FR6A 4RMAA 2WXLA 4A9AA 4PT5A 3H7PA 2VZKB 1I4GA 1WX9A 5BMHA 1FM0D 2K6DB 1WY8A 1ZOYB 4HWIB 1Q10A 3AEEB 3AE3B 4RGTA 3KVFB 1E8WA 1WMHB 3KUDB 2DZKA 3W1SA 4C7YA 1R4MI 2JY6A 1WXMA 3UF8A 2JWZA 4GGQA 3DBLB 4DK5A 1CJEA 3DWMA 1C9FA 2BS4B 1MI0A 4GDKA 1K8RB 2CHZA 3V61A 3HVZA 2BYFA 1RWSA 2KXJA 3I63C 2V0GA 2J0MA 4CO7A 3L0WB 2RSUA 4G3XB 4L23A 1TKEA 3NZ3A 2W9NA 2NBWB 4CHKA 3ZXVA 4A8XC 2GBRA 4B0EA 1C4PA 3VR9B 2PTLA 3R8BA 2LHEA 1E8ZA 3PLVA 2LVPA 1QOBA 4TMAB 4WIPA 3RUIB 5JZEB 2MBBB 2KAJA 1WFYA 1EF1A 1P7EA 2ZW1A 1D5ZC 2KKCA 1FNUA 3SD5A 1L2NA 3DVNV 4OVUA 3VUWA 2KLCA 3GS2A 1NYQA 1XEEA 2J4XA 2L00B 2XK5B 1YJ1A 3I5JC 5TR5A 4IM0A 2LEKA 3AMZA 2O6VD 4GIVA 3RULA 3X23A 2DNFA 1V8CA 3AXCA 3WIMA 2KJHB 1Q1OA 2IO3B 2JRHA 5I4DA 1QLBB 1HTOA 1LM8B 3NVWA 2MBEA 1XCQL 2MRPA 1WX8A 1K53A 1XF5L 4DDGD 1OQYA 3TEWA 2KMCA 3Q3FA 1ISNA 1Z2MA 2IY0B 3ALBA 3NRZA 1WIAA 2ZCBA 3ZO5B 2DZMA 1OQRA 4PYUA 4G0NB 3HIZA 1I42A 1XLQA 2LI5A 1OEYJ 4IWPA 2D07B 4TSSA 1FEHA 3N9YC 5KHOA 1F0ZA 4GOCA 3AE9B 1XLNA 3Q3OC 4K7UA 2O2VA 3FILB 3BVZA 1SE4A 3O65B 2ZW0A 4BBNF 3R7RA 2DZIA 1NVID 1HEZE 3FC4A 2QCZA 1TZOA 3QIJA 2SAKA 5E6NA 4TQ0A 3L54A 2ASQA 1C78A 2M19A 1PDXA 2RPQA 2LZ6A 3GB1A 4JPSA 3MHSD 1L5PA 1TS2A 1R4MB 3PHWB 2MA9B 4WJPA 4MGIE 4FJYA 1IP9A 2KK8A 4A55A 1N61A 4LJPB 2JX5A 1YQ4B 3BYTB 1MG8A 3U52E 2G4SA 4REZA 3K9PB 3P4SB 1PGAA 1VZ6A 3HVDA 4R3DA 1FNWA 1OEYA 1ZXHA 5DPTA 3ZRCA 1YJJA 2L83A 1T6BX 2J0JA 3EFUA 1JRUA 2UU7A 3MJ5A 4JL9A 4MGZE 4CYEA 3VFKA 1I7HA 5HKHA 4ANUA 4RGNA 4KVGB 2ON8A 1GNUA 5IOIA 3RFZB 2KX3A 4HDOA 2KVRA 1C1YB 4MT5A 2KDMA 5HI1A 2RDHA 3WANA 1YMHE 1PQSA 4IUMB 3TMPB 2MW5A 2OJWA 4RCOA 4HCPB 4KSKC 3BWUD 2AYOB 3Q8FA 1XLOA 1JWMD 2AWTA 1JWBD 4JX1C 5CX3A 4E71A 2WDQB 1VZ7A 3ML8A 2EMSA 2XN9C 1HZ5A 4II3B 3NZUA 3T3OA 2CKHB 4LNFA 1B1ZA 1FCCC 4HPMB 2YEPB 1NI2A 1P9DU 1NDDA 2J7QB 2M4NA 3H7SA 4YTNB 4BZAA 2A4ZA 4NAWB 2WXMA 3RYTA 2OJRA 3EFCA 5EE1A 4PS3A 1QKZA 3AEDB 2PIAA 2FIDA 1K50A 4YSXB 3N1ZC 1UF0A 1JQ4A 1ZXIA 1IBXA 4MELA 3RNGC 3KH0A 1V6EA 4IOIE 1J0GA 1AWDA 1R4NB 5LXHA 3GOEA 3AB5A 1P1AA 4ANWA 3WAPA 4FBJB 2ICIA 4YSZB 3ML9A 3QQ8B 3P2BA 3VHTC 3ZLZA 2Y5BB 5D6JB 3W5VB 3CIRB 1GB1A 1K52A 3PV1A 1NYRA 3N1YC 3U7ZA 1I4XA 3ZUNA 4C80A 1EO6A 3ZKJC 1WJ4A 4WJNA 2BW2A 4RNAA 2BYEA 2FIFA 1GC7A 2FAZA 4HKQA 3URYA 1FRRA 2Z0DB 5H8YE 2MCNB 1KF6B 3ZVVA 1HE8A 1I35A 2ZZPB 1DGJA 3U4EG 1FNVA 4A3PA 4I6NB 2KJ6A 3P4PB 3AECB 1SE9A 3P4QB 1V97A 2JZPA 3PO0A 3QAQA 1NI3A 4AQ7A 3KW5B 2ZCCA 2VH1A 1X1MA 4FN2A 1M94A 1E8XA 2MBOA 2K8HA 3MP9A 1G6JA 1YX6B 3GE3C 4JWSC 4YSYB 1TT5B 1UWXA 1N5WA 1V81A 1AYFA 2QILA 4FJVB 3VVWB 1LGRA 1VRAB 4JE3B 4XE0A 4AWJA 4WWNA 2L32A 4K7SA 2J42A 2DENB 3VRBB 4H2AA 3A9KA 2GB1A 2O6VA 1D3ZA 4DBGA 3L10B 3ZW3A 4MJSA 1WRDB 2PEAA 5D2MB 2ZEQA 3WAOA 3TL5A 2KDIA 1C76A 3DBRB 1TGZB 3ZXRA 1WYWB 3CWIA 2Y5CA 5AUKA 2OHFA 1WI0A 3NY5A 5CHVC 3DHIC 3RNAC 3W2DA 2MEKA 1WE7A 1MFWA 4GU2A 2WXRA 2KN4A 2R2QA 4FADA 4LCDE 3Q2AC 2WDTB 2CJNA 4RH6A 3QCAA 5GXGB 2JZ3B 4M8NA 1L6VA 3NS8A 3OWEB 1OFFA 1JROA 4F8CB 1GOZA 3NUHB 1IPGA 4ITKA 3I3TB 1S1QB 2DBYA 3B0AA 3N1XC 3PT2B 3UIOB 2GLSA 5EE3A 2M1MA 2CR5A 2KLGA 1E7VA 4MH0E 3T8MA 4HVBA 1JMLA 1GB4A 1IYFA 5JHAA 3BIID 3B1LX 2WDRB 2VZKD 1UWMA 4K3CA 4I6LB 1I4PA 1FXIA 2CJOA 4DXAB 4KGRA 4D2KA 1I4QA 4IDIA 3LYYA 4XDCA 1S3SG 3DBHB 1T0YA 1KFYB 4PK1A 2YVCA 4EOYA 1TY2A 5L95C 3CSFA 2O6VB 3BK2A 1JALA 3PZ8A 1YQ3B 5DPRA 4TKNA 2FCSA 4YXDB 3R2TA 4XWTA 4US8A 4F1SA 3X0WA 3AEAB 3RNCC 1MHHE 2DZJA 1TS5A 5L83A 4KSLC 1ACCA 3SR6A 2K1FA 2PE6B 3A9JA 3BZDB 1SE3A 4NJ7A 2XEWA 3AULA 3E56A 2WX0A 1SF0A 5T8IA 4F7ZA 3HM6X 2BQQA 3DBLI 4W9JA 4WURA 2KNBA 1ZDXA 2VRRB 3QARA 1PFDA 4ZRJA 1F9JA 1RAXA 4MH8A 4US9A 3GE8C 5IP4D 1J7AA 3A9JB 2WXKA 4A3OA 2MJEA 2K6QA 2IO1B 2NPTB 1CK1A 4XYCA 1GUAB 3HM3A 2L52A 2D5GA 1R7SA 4IWQA 1KLGD 3P1MA 1ZPSA 3B2FA 2M17A 1I4HA 3LB8C 5H92C 3DCGA 3H8HA 3AI5A 1SB3C 3ZDMC 4YWGG 4EUTA 2Y3AA 2KDBA 4MGYE 1KLVA 3GZNI 1L0VB 3VTVA 1C4CA 4N6EB 3PLUA 1V1PA 2INDC 4KGTA 2KWUB 1E8YA 2CHXA 3IT6B 4OHJA 1K51A 2BKRB 2IPKD 2KZRA 3UI3A 1F2RI 2WDVB 4RGOS 2WP9B 2QEJC 2R61A 4USAA 2PVGC 4QAYA 3AH7A 3UINB 4X57B 4WAFA 3CSTA 1BT0A 4KIKB 1T0RC 2HJ1A 1QILA 2DYBA 3O13A 3VQIA 1UUPA 4ARIA 2E6XA 3ZNHB 1QT9A 3V6CB 2WXJA 1JWAD 1D5XC 2DYOA 1TS4A 2LFIA 1UBIA 3R3MA 1PYWD 4IG7B 3ZTDA 3UQAA 3UIPB 4ICVA 1U4AA 1YN3A 1WGGA 4OW0A 1SE2A 3N30A 2ZVOA 3QA8A 1FFUA 2HDEA 1P3QU 3OLMD 1EU3A 2L05A 5DCNA 2JXXA 3I57A 4KV2A 1TTNA 4E3CA 5AEKB 5JH5C 2CHWA 5D3DA 2A5UA 3DQVA 2UWQA 3U30A 2AEHA 4UDUC 3ECIA 2H88B 5EDSA 3SHQA 2ZPNA 1DOXA 5TSSA 2Z8LA 4P16A 4ARCA 1WR6E 2WGSA 2K8CA 3VH4B 3B9JA 1XD3B 2KWCA 3A33B 4NAMA 2CS4A 4YTMB 2DWQA 2MQJA 1VDVA 2CU3A 4W9LA 3C8YA 4EKUA 2BGFA 2WXHA 4LNIA 1IGCA 4O1NA 5BO4B 1E6EB 5AZGA 1B9RA 4FLHA 2X38A 1XO3A 5JXVA 3TEZA 1RFAA 2M56B 3PHXB 1ZDVA 4EZJA 4W9EA 4MACA 4NJ6A 1V5OA 4MGKE 3U8ZA 3KUZA 4IWOA 4KZ0A 2V1YA 5AUIA 2DYMA 4GB9A 3P63A 1NBFC 1YNTE 4ANVA 1OQQA 3Q14C 3TJPA 4LK0M 1J7CA 1LQBA 1YQBA 3DHHC 2XNAC 3APFA 2K39A 3Q3NC 3H6NA 2LGXA 3KYDD 2BTEA 1TY0A 4W9CA 1WXQA 2CU1A 3KWLA 3TSSA 3Q8EA 4HJGE 4KKIA 2V3SA 3AE5B 3W1SC 3NS1A 2LHDA 1ROEA 2NR2A 4G11A 2KQ4X 2DAJA 3RT3B 3OG5A 5D94A 3T3NA 2AQ1B 2LJIA 1MHXA 2N9XA 1JRPA 1T0SC 5HG2A 1FRDA 3DWGC 3RCZA 3PREA 1UELA 2BB5A 4M00A 2JWUA 3DHGC 2IGHA 1V86A 3VTUA 2PMVA 1LFDA 2JU6X 4XDDA 3RN9C 1QOAA 3W5UB 2Z59B 1KH0A 1ENFA 4KDLB 4EZLA 2HTHA 5HFYA 3IFWB 3FKYA 1E5WA 1J8CA 3VUYA 2EELA 4LDTB 3BVMA 3S2AA 3IBEA 2L3ZA 4GMVA 1Y56A 3U2SC 4C4VB 2QHOA 1FO4A 2YEPF 1KTKA 4B9KA 1C4AA 3APCA 4KKJA 4PYZA 4DQOC 1XCTL 1AARA 3Q3JA 2D3CA 3PPAA 3LXFA 2MBQA 3ZNID 4P6VF 2Q5WD 5IAAC 3ABVB 4W9KA 4BVUC 2K22A 4AJWA 3ZGZA 3TIXA 1FXAA 1VZ8A 3IG3A 1VCBA 1OTRB 4C00A 1EUVB 3AE4B 3M62B 2PW9A 1IBXB 5C23A 2G9HD 2WX1A 1VR9A 4IC7B 2V4IB 2QDFA 1XXGA 4KDIC 3AU5A 2REXA 5LXIB 4FHJA 3OJ4B 2LASA 3CMMB 2LGSA 2MBHA 4RM8A 2WXNA 4ZRIA 2IYDB 1SJHD 2FCQA 1AW7A 1UGJA 2EMTA 1FCLA 2K5PA 4TUUA 2ZNVC 2KJRA 2QIEB 2C5LC 1M4VA 4DHZE 1RYJA 4WH4A 3Q8CA 3RNBC 4N58A 2X8XX 2IZVB 3CF6E 3V60A 2D3BA 2NS5A 5MPOA 4IM2A 4ZOHC 3ZNGC 3DBHI 4YT0B 4ZRPA 4MM3A 3I9V1 4PS8A 4HK2A 4XX5A 3RPFC 1WE6A 3H1UA 1STEA 1WGYA 1BUIC 1ZE3D 2Z0EB 1WXAA 3L4PA 3QHTA 2QC8A 2MHJA 3JW0X 1EWCA 4W9HA 2INPE 3ZYYX 4ASWC 1XQQA 2IDYA 3WCQA 4AOFA 3R7QA 3V6EB 3A4SC 4MSQB 1T3QA 3MTNB 1N5XA 3W9CB 1C3TA 2WXFA 3AE7B 5EE0A 2UYZB 1WXSA 3L16A 1I4RA 1SIFA 3C19A 2AL3A 2BWES 2M8SA 4B0MA 3OAWA 1IGDA 2KQSA 2BS2B 4IKGA 2PE9A 5J2RA 2AX5A 3UGBB 3PZ7A 2ACZB 4MJSB 5IA7A 4WJQA 1ESFA 2L0TA 3TUOA 2N7EA 2KFKA 4BKTA 4ZRQA 2N9EB 2KTFA 3WALA 4K81A 3DOWA 4MSMB 2M0AA 3QK0A 2BPSA 4JGHB 2L7RA 1QZEA 1FD6A 1HZ6A 5LNK1 4C7ZA 2RDBC 3A1QA 1N63A 1D4BA 3IT4B 1DYQA 3ONSA 2FBWB 2FCNA 3BYYB 4BFRA 2I1JA 3DVGX 1V9JA 5FK9C 1WM2A 1WX7A 4LNNA 4WAAA 4JIOU 2NBUA 4MM3B 2C7NB 2EKIA 2I38A 1SJED 2KQ7A 2N7JA 1RFKA 5CHFA 1EM7A 1FPYA 4A20A 3U7DA 2M0XA 3VDZA 1WJNA 2C60A 2KVZA 2MSED 2V3PA 4P1CC 3RI7C 5BYRA 2IY1B 3KLSX 4ICUA 2ONQA 2YLMA 3MC9A 2L0FA 3PGEA 4A6QA 1JW9D 5G55A 1MVKA 1N6ZA 2KC2A 4M0WB 5J17A 1ET9A 3VTWA 2LGYA 3IAS1 1P0RA 3IXSA 2JYTA 1WJ6A 3LDZE 5C3JB 2I2YA 2N9KA 3PVLA 4IM3A 2B76B 2OOBB 3H9DA 4DXFA 2I1KA 1YJIA 2BYVE 5C1ZA 3QX1A 2K8BA 2V3NA 4GXBA 3L13A 2JQRB 3J9CA 3AE1B 4EEWA 2GBNA 3V05A 2RPVA 1A70A 1GAQB 3EUB2 3TEYA 1L4ZB 1YX5B 3Q69A 1ZGUB 3D32A 1XLPA 2KANA 1F77A 4BKGA 1KLUD 4GLSC 4HPPA 3H7PB 3HRDD 1KRHA 2BBCA 2BWFA 5AZHA 4G50A 3Q6BA 1VD2A 1DOIA 2WXIA 1E10A 2KOXA 2IGDA 5IKCM 2WXPA 4B6WA 3RNEC 2NBVB 2L8JA 1R4NI 1SXTA 2INNE 1J7BA 3PRMB 1TIFA 3ZIMA 2KDFB 3B08A 2QJLA 1Z5SB 2ZVNA 3RZFA 2GBMA 2KTRB 4GDLB 3RZWC 2DX5B 2WNMA 2BT6A 1SEBD 5G5GA 2BVCA 2PLPA 4DHJB 2VH2A 4GDKB 1GPXA 1UBQA 3SFEB 3EA6A 2FUG1 1N60A 3AV8A 2JUOA 1TKGA 2FUHB 3ZQ4A 2DLBA 2D11A 2PKOA 3DPDA 4N59A 5IO9A 1E90A 4KIKA 4J3OD 1NEKB 4DDID 1FFVA 5CHWA 4W9FA 2JZZA 4HJKA 3V62A 4BBNC 2KWVB 4LNKA 3AU4A 5C2TB 2LUEA 5IN7A 1CQVA 4ACFA 5D3IB 3HK0A 1BXTA 4M01A 3B2GA 3OJ3A 3KUCB 2LMCA 2WHIA 4MDKE 3IVFA 2KMMA 3MC0B 2KDEB 1J19A 2GRIA 5BYQA 2W55A 3AM9A 2DHZA 4FULA 2N4FA 4ZYSA 4K1RB 1PUTA 2BYTA 3ZRFA 2LWPA 4E74A 2D2QA 2WXGA 2W3SA 2BKFA 3P42A 4NY0A 4XZ4A 1KM7A 2D3GA 2GI9A 1WMHA 4DHJD 3WA0A 2WWZA 2C7HA 4IW0A 1A5RA 2LJ5A 4YTPB
chains in the Genus database with same CATH topology
3TCAA 3DDCB 3DBSA 4EFOA 4A3PA 1UZXB 4I6NB 2Z59B 2KJ6A 4AP4C 4KDLB 4EZLA 2ZJDA 1SE9A 3NOBA 2HTHA 3IFWB 2NPTA 1WH3A 1Q5WB 1WZ0A 1XT9B 4MEMA 2N7DA 1E5WA 3QAQA 1J8CA 3VUYA 3KW5B 2AL6A 3APDA 4LDTB 2ZCCA 2KX0A 5G2NA 3ZTCA 1X1MA 3S2AA 3IBEA 3JVZX 2JRIB 4FHKA 4JLCA 4FN2A 1M94A 4WQOB 2MP2A 5JHBA 5DPWA 2L3ZA 1WGRA 4GMVA 3KYCD 1WM3A 1E8XA 2O2VB 2MBOA 2K8HA 2QHOA 1G6JA 1YX6B 2L76A 1FXTB 2RD0A 1SGHA 4B9KA 1V81A 3VVWB 3APCA 4FJVB 4HCNB 4PYZA 4AWJA 3QWZB 4I6PA 4OVVA 4WWNA 4K7SA 4LJOB 4TQ1A 2DENB 1AARA 4ANXA 3A9KA 4WJOA 3Q3JA 2GOWA 4XC2A 4WWOA 1V49A 1GJZA 2O6VA 1D3ZA 2MP2B 3PPAA 2MBQA 4AUQC 3VUXA 3ZNID 4DBGA 3L10B 1YD8U 2LVOA 3PTFC 4MJSA 5IAAC 3PRPB 1CMXB 4W9KA 3ZW3A 4AJWA 4BVUC 1WRDB 4KZCA 2PEAA 5FR6A 5AZFA 5D2MB 3TIXA 2LRWA 1H4RA 2WYQA 2ZEQA 4RMAA 2N1WA 3WAOA 3IG3A 1VCBA 1OTRB 3TL5A 2KDIA 4W9GA 1TGZB 2GBJA 3H7PA 1EUVB 1WYWB 3M62B 1WX9A 2V4LA 3PRZA 1OGWA 2K6DB 2XK5A 1WY8A 2LVQA 5LLIA 1WI0A 4YL8A 3NY5A 5CHVC 5C23A 3SDLC 4HWIB 2IBIB 5D7GA 2WX1A 4IC7B 1WE7A 4GU2A 4ZDVA 2FNJB 3KVFB 1E8WA 1WMHB 2R2QA 2DZKA 3KUDB 3W1SA 4FADA 4KDIC 1R4MI 2JY6A 2KD0A 3AU5A 4LCDE 1WXMA 2REXA 2WDTB 3UF8A 2JWZA 5LXIB 4GGQA 4FHJA 3OJ4B 2LASA 3CMMB 4DK5A 2B3AA 3QCAA 2G3QB 2MBHA 3PS6A 4RM8A 1ZW7A 4ZRIA 2JZ3B 4M8NA 4GDKA 1K8RB 2CHZA 3NS8A 2IYDB 1Q0WB 4NPNA 3V61A 4W9DA 2FCQA 3EECA 2BYFA 2EMTA 4F8CB 2KXJA 2KN5A 4TUUA 2ZNVC 1IPGA 2J0MA 3I3TB 1S1QB 2KJRA 2C5LC 4CO7A 3B0AA 3PT2B 3L0WB 2RSUA 4DHZE 3UIOB 1WF9A 2M1MA 2KLGA 2CR5A 1E7VA 4G3XB 4MH0E 3T8MA 4HVBA 2W9NA 2IZVB 2NBWB 1IYFA 5JHAA 4CHKA 3CF6E 3V60A 2NS5A 3B1LX 3A4RA 4IM2A 2GBRA 3ZNGC 3DBHI 4MM3A 1KJTA 4I6LB 4NAWA 4JQWC 3DVNU 4DXAB 4PS8A 4HK2A 4XX5A 1E8ZA 1WE6A 3PLVA 2LVPA 3H1UA 1S3SG 1WGYA 1T0YA 2Z0EB 3RUIB 1WXAA 3QHTA 2YVCA 5JZEB 4EOYA 2MBBB 3JW0X 4W9HA 5L95C 3CSFA 2O6VB 1GC6A 4NQKE 4ASWC 1WFYA 1XQQA 1EF1A 2KC1A 4AOFA 3R7QA 3V6EB 3A4SC 4MSQB 3NHEB 2KKCA 2DAFA 4N9F4 3SD5A 5E6PA 1L2NA 5DPRA 3BY4B 3DVNV 3MTNB 4OVUA 4TKNA 3VXWA 2FCSA 3VUWA 1C3TA 2KLCA 4GN1A 4F1SA 3X0WA 1EF5A 2L00B 2DZJA 2LGDA 2XK5B 1YJ1A 2UYZB 5TR5A 1WXSA 3L16A 2IO0B 3T9LA 5L83A 4IM0A 2O6VD 1SIFA 1L7YA 4KSLC 4GIVA 3RULA 3X23A 2AL3A 2BWES 2G45B 2K1FA 2M8SA 4II2B 2PE6B 3OAWA 3A9JA 2KQSA 3AXCA 4NJ7A 2PE9A 2XEWA 5J2RA 3WIMA 2KJHB 4P7IA 3UGBB 1Q1OA 3AULA 2WX0A 3MJWA 2IO3B 4MJSB 2JRHA 1KOTA 5IA7A 4FA6A 4F7ZA 3JSVB 4LDTD 4WJQA 3HM6X 4RM9A 2L0TA 1LM8B 2JPHA 2MBEA 2N7EA 3DBLI 2KFKA 1WJUA 2KNBA 4W9JA 4BKTA 2KO3A 2LRUA 2N9EB 3R66C 2VRRB 3DBRI 2KTFA 3QARA 3WALA 2MRPA 4K81A 3DOWA 4HXDA 1WX8A 3QK0A 4MSMB 4ZRJA 2BPSA 2N9PC 1F9JA 1RAXA 3IHPC 2L7RA 4JGHB 1QZEA 1OQYA 4DDGD 2KMCA 3A9JB 3A1QA 1ISNA 1Z2MA 2IY0B 3ALBA 3Q3FA 3N32A 4A3OA 1WIAA 2ZCBA 3ZO5B 2K6QA 2DZMA 3ONSA 4EZKA 2IO1B 2NPTB 4HPLB 2FCNA 1GUAB 3HM3A 4G0NB 4PYUA 2I1JA 2R2OA 3WAMA 3DVGX 4BFRA 3HIZA 1I42A 1V9JA 2ZNVB 4IWQA 2LI5A 1OEYJ 1WM2A 1WX7A 4IWPA 4WAAA 3PSEB 4HDQA 2D07B 4JIOU 2NBUA 5E6OA 5J18A 1P98A 5KHOA 2BF8B 2C7NB 2M17A 4GOCA 3DCGA 4K7UA 2O2VA 3AI5A 3UQBA 3LJ3A 3ZDMC 3O65B 3QC8B 4W9IA 4EUTA 2KDBA 4BBNF 3R7RA 2DZIA 2KQ7A 4MGYE 3L08A 5CHFA 1KLVA 1WGHA 3GZNI 3QIJA 3VTVA 3VAWA 3PLUA 4PS7A 5E6NA 4A20A 3U7DA 4DWFA 2M0XA 4TQ0A 3VDZA 1WJNA 2KWUB 3A9KB 3L54A 1E8YA 2CHXA 3BINA 2C60A 2ASQA 2BKRB 4FJZA 4NNJB 4B95A 2MSED 2RPQA 2KZRA 3C0RB 2LZ6A 3K9OB 1WXVA 3MHSD 2IY1B 3M63B 4ICUA 2YLMA 2K25A 2L0FA 5GMVA 3PGEA 4NQLB 2NVUI 3PHWB 2MA9B 5G55A 4WJPA 4MGIE 4FJYA 1IP9A 2KK8A 2KC2A 3UINB 4X57B 4M0WB 1WGDA 3CSTA 1BT0A 4LJPB 4KIKB 2PPHA 4HLEA 1MG8A 1LXDA 3EHVA 5J17A 2C7MB 3VTWA 2DYBA 2LGYA 3VQIA 1P0RA 2G4SA 1V80A 3K9PB 1WJ6A 4K7WA 3W1YA 3JSVA 2MLBA 5KHQA 3LDZE 3VH3B 3ZNHB 2EKEC 2KHWB 2HD5B 3PVLA 3V6CB 2KFKB 2HE7A 4GSWA 2DYOA 4IM3A 1UH6A 2OOBB 3H9DA 2I1KA 1OEYA 5DPTA 1GG3A 1UBIA 2BYVE 3R3MA 5C1ZA 3QX1A 4DHZB 3TBLD 2XBBC 2K8BA 3ZRCA 4GXBA 3L13A 2IO2B 4URKA 3ZTDA 4IG7B 3UQAA 2J0JA 3UIPB 3EFUA 1JRUA 4EEWA 2GBNA 4ICVA 4JL9A 1U4AA 2NCNA 2HJ8A 4MGZE 2GMIC 1YX5B 1WGGA 4CYEA 3N30A 1ZGUB 3D32A 2ZVOA 3QJZA 2KANA 3DVGY 3QA8A 3VFKA 4BKGA 2MWSB 1P3QU 5HKHA 2KTRA 4GDLA 3OLMD 3ZDTA 4ANUA 2L05A 3H7PB 5DPSA 5DCNA 4AJYB 2BWFA 2JXXA 4KVGB 5AZHA 4G50A 5AEKB 4KV2A 1TTNA 4E3CA 1GNUA 5JH5C 1VD2A 2KX3A 1H8CA 2KOXA 2CHWA 4HDOA 3HHMA 2KVRA 1C1YB 1WZ3A 2A5UA 2J0KA 3DQVA 2UWQA 4B6WA 2NBVB 3U30A 2RGFA 2L8JA 1R4NI 2AEHA 3RD2A 4ZRKA 3ECIA 4WWPA 1TBEA 3WANA 3PRMB 3ZIMA 3M3JA 2KDFB 5EDSA 3SHQA 1PQSA 3B08A 4IUMB 3TMPB 2ZPNA 1Z5SB 2MW5A 2ZVNA 3RZFA 2GBMA 2KTRB 4GDLB 4HCPB 4KSKC 3RZWC 3ZNZB 2DX5B 4DHJB 4GDKB 1WR6E 2AYOB 4W9FA 1UBQA 2AWTA 2K8CA 3VH4B 1XD3B 1RLFA 2KWCA 5CX3A 4E71A 3A33B 2CS4A 2ZPYA 2MQJA 3ENEA 3ML8A 1UGMA 2JUOA 2FUHB 4W9LA 2FCMA 2EMSA 4J6IA 2D11A 4EKUA 2BGFA 3DPDA 5BO4B 1V5TA 5AZGA 4FLHA 4II3B 3NZUA 1E90A 3PZDA 4TV3A 2CKHB 4KIKA 1RFAA 4DDID 3PHXB 4EZJA 4HPMB 1NI2A 4W9EA 1P9DU 5CHWA 1E7UA 1NDDA 2J7QB 2M4NA 3H7SA 1V5OA 2JZZA 4HJKA 4MGKE 4NJ6A 3V62A 2A4ZA 4BBNC 2KWVB 4NAWB 3L17A 1TZ1A 3U8ZA 3KUZA 3N3KB 4IWOA 4KZ0A 3AU4A 2V1YA 2OJRA 3RYTA 4BOSC 2DYMA 2KMAA 4GB9A 2LUEA 2N1VA 1UD7A 4PS3A 1NBFC 2KFJA 4ANVA 1V2YA 2D10A 2FIDA 3HK0A 3TJPA 2MX2A 1LQBA 3OJ3A 4MELA 3KUCB 1YQBA 3KH0A 1V6EA 1J0GA 2G4DB 4MDKE 3IVFA 2RR9A 3APFA 2K39A 3A1QB 5LXHA 3H6NA 4ZYNA 2GBKA 3GOEA 1P1AA 2KDEB 2LGXA 1J19A 3KYDD 3NZSA 5CTRC 4ANWA 4W9CA 3WAPA 4FBJB 2CU1A 2DHZA 4FULA 3JYUA 3ML9A 2N4FA 3QQ8B 4BKSD 3P2BA 4K1RB 3VHTC 3ZLZA 2Y5BB 2V3SA 5D6JB 3W1SC 2NR2A 3ZRFA 2LWPA 4G11A 2LD9A 4M8MA 3SU8X 4E74A 2DAJA 2D2QA 3PV1A 3M95A 3RT3B 5D94A 3ZUNA 1EO6A 2BKFA 3ZKJC 1WJ4A 4WJNA 4NY0A 1ZKHA 4BKSA 2N9XA 2BYEA 2FIFA 2C9WB 4XZ4A 1GC7A 1KM7A 2D3GA 2FAZA 3RCZA 3PREA 1RRBA 1WMHA 1WR1A 1UELA 3EC8A 4DHJD 2Z0DB 3WA0A 2MCNB 2LXAA 2WWZA 4BOZB 2JVCA 2C7HA 3ZVVA 4IW0A 1YIWA 1HE8A 1A5RA 2LJ5A 1V86A 1I35A 2PJHA 3VTUA 2ZZPB 2JT4B 1LFDA 2LXCA 2JF5A 1Y8RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCA A;  3DDC B;  3DBS A;  4EFO A;  4A3P A;  1UZX B;  4I6N B;  2Z59 B;  2KJ6 A;  4AP4 C;  4KDL B;  4EZL A;  2ZJD A;  1SE9 A;  3NOB A;  2HTH A;  3IFW B;  2NPT A;  1WH3 A;  1Q5W B;  1WZ0 A;  1XT9 B;  4MEM A;  2N7D A;  1E5W A;  3QAQ A;  1J8C A;  3VUY A;  3KW5 B;  2AL6 A;  3APD A;  4LDT B;  2ZCC A;  2KX0 A;  5G2N A;  3ZTC A;  1X1M A;  3S2A A;  3IBE A;  3JVZ X;  2JRI B;  4FHK A;  4JLC A;  4FN2 A;  1M94 A;  4WQO B;  2MP2 A;  5JHB A;  5DPW A;  2L3Z A;  1WGR A;  4GMV A;  3KYC D;  1WM3 A;  1E8X A;  2O2V B;  2MBO A;  2K8H A;  2QHO A;  1G6J A;  1YX6 B;  2L76 A;  1FXT B;  2RD0 A;  1SGH A;  4B9K A;  1V81 A;  3VVW B;  3APC A;  4FJV B;  4HCN B;  4PYZ A;  4AWJ A;  3QWZ B;  4I6P A;  4OVV A;  4WWN A;  4K7S A;  4LJO B;  4TQ1 A;  2DEN B;  1AAR A;  4ANX A;  3A9K A;  4WJO A;  3Q3J A;  2GOW A;  4XC2 A;  4WWO A;  1V49 A;  1GJZ A;  2O6V A;  1D3Z A;  2MP2 B;  3PPA A;  2MBQ A;  4AUQ C;  3VUX A;  3ZNI D;  4DBG A;  3L10 B;  1YD8 U;  2LVO A;  3PTF C;  4MJS A;  5IAA C;  3PRP B;  1CMX B;  4W9K A;  3ZW3 A;  4AJW A;  4BVU C;  1WRD B;  4KZC A;  2PEA A;  5FR6 A;  5AZF A;  5D2M B;  3TIX A;  2LRW A;  1H4R A;  2WYQ A;  2ZEQ A;  4RMA A;  2N1W A;  3WAO A;  3IG3 A;  1VCB A;  1OTR B;  3TL5 A;  2KDI A;  4W9G A;  1TGZ B;  2GBJ A;  3H7P A;  1EUV B;  1WYW B;  3M62 B;  1WX9 A;  2V4L A;  3PRZ A;  1OGW A;  2K6D B;  2XK5 A;  1WY8 A;  2LVQ A;  5LLI A;  1WI0 A;  4YL8 A;  3NY5 A;  5CHV C;  5C23 A;  3SDL C;  4HWI B;  2IBI B;  5D7G A;  2WX1 A;  4IC7 B;  1WE7 A;  4GU2 A;  4ZDV A;  2FNJ B;  3KVF B;  1E8W A;  1WMH B;  2R2Q A;  2DZK A;  3KUD B;  3W1S A;  4FAD A;  4KDI C;  1R4M I;  2JY6 A;  2KD0 A;  3AU5 A;  4LCD E;  1WXM A;  2REX A;  2WDT B;  3UF8 A;  2JWZ A;  5LXI B;  4GGQ A;  4FHJ A;  3OJ4 B;  2LAS A;  3CMM B;  4DK5 A;  2B3A A;  3QCA A;  2G3Q B;  2MBH A;  3PS6 A;  4RM8 A;  1ZW7 A;  4ZRI A;  2JZ3 B;  4M8N A;  4GDK A;  1K8R B;  2CHZ A;  3NS8 A;  2IYD B;  1Q0W B;  4NPN A;  3V61 A;  4W9D A;  2FCQ A;  3EEC A;  2BYF A;  2EMT A;  4F8C B;  2KXJ A;  2KN5 A;  4TUU A;  2ZNV C;  1IPG A;  2J0M A;  3I3T B;  1S1Q B;  2KJR A;  2C5L C;  4CO7 A;  3B0A A;  3PT2 B;  3L0W B;  2RSU A;  4DHZ E;  3UIO B;  1WF9 A;  2M1M A;  2KLG A;  2CR5 A;  1E7V A;  4G3X B;  4MH0 E;  3T8M A;  4HVB A;  2W9N A;  2IZV B;  2NBW B;  1IYF A;  5JHA A;  4CHK A;  3CF6 E;  3V60 A;  2NS5 A;  3B1L X;  3A4R A;  4IM2 A;  2GBR A;  3ZNG C;  3DBH I;  4MM3 A;  1KJT A;  4I6L B;  4NAW A;  4JQW C;  3DVN U;  4DXA B;  4PS8 A;  4HK2 A;  4XX5 A;  1E8Z A;  1WE6 A;  3PLV A;  2LVP A;  3H1U A;  1S3S G;  1WGY A;  1T0Y A;  2Z0E B;  3RUI B;  1WXA A;  3QHT A;  2YVC A;  5JZE B;  4EOY A;  2MBB B;  3JW0 X;  4W9H A;  5L95 C;  3CSF A;  2O6V B;  1GC6 A;  4NQK E;  4ASW C;  1WFY A;  1XQQ A;  1EF1 A;  2KC1 A;  4AOF A;  3R7Q A;  3V6E B;  3A4S C;  4MSQ B;  3NHE B;  2KKC A;  2DAF A;  4N9F 4;  3SD5 A;  5E6P A;  1L2N A;  5DPR A;  3BY4 B;  3DVN V;  3MTN B;  4OVU A;  4TKN A;  3VXW A;  2FCS A;  3VUW A;  1C3T A;  2KLC A;  4GN1 A;  4F1S A;  3X0W A;  1EF5 A;  2L00 B;  2DZJ A;  2LGD A;  2XK5 B;  1YJ1 A;  2UYZ B;  5TR5 A;  1WXS A;  3L16 A;  2IO0 B;  3T9L A;  5L83 A;  4IM0 A;  2O6V D;  1SIF A;  1L7Y A;  4KSL C;  4GIV A;  3RUL A;  3X23 A;  2AL3 A;  2BWE S;  2G45 B;  2K1F A;  2M8S A;  4II2 B;  2PE6 B;  3OAW A;  3A9J A;  2KQS A;  3AXC A;  4NJ7 A;  2PE9 A;  2XEW A;  5J2R A;  3WIM A;  2KJH B;  4P7I A;  3UGB B;  1Q1O A;  3AUL A;  2WX0 A;  3MJW A;  2IO3 B;  4MJS B;  2JRH A;  1KOT A;  5IA7 A;  4FA6 A;  4F7Z A;  3JSV B;  4LDT D;  4WJQ A;  3HM6 X;  4RM9 A;  2L0T A;  1LM8 B;  2JPH A;  2MBE A;  2N7E A;  3DBL I;  2KFK A;  1WJU A;  2KNB A;  4W9J A;  4BKT A;  2KO3 A;  2LRU A;  2N9E B;  3R66 C;  2VRR B;  3DBR I;  2KTF A;  3QAR A;  3WAL A;  2MRP A;  4K81 A;  3DOW A;  4HXD A;  1WX8 A;  3QK0 A;  4MSM B;  4ZRJ A;  2BPS A;  2N9P C;  1F9J A;  1RAX A;  3IHP C;  2L7R A;  4JGH B;  1QZE A;  1OQY A;  4DDG D;  2KMC A;  3A9J B;  3A1Q A;  1ISN A;  1Z2M A;  2IY0 B;  3ALB A;  3Q3F A;  3N32 A;  4A3O A;  1WIA A;  2ZCB A;  3ZO5 B;  2K6Q A;  2DZM A;  3ONS A;  4EZK A;  2IO1 B;  2NPT B;  4HPL B;  2FCN A;  1GUA B;  3HM3 A;  4G0N B;  4PYU A;  2I1J A;  2R2O A;  3WAM A;  3DVG X;  4BFR A;  3HIZ A;  1I42 A;  1V9J A;  2ZNV B;  4IWQ A;  2LI5 A;  1OEY J;  1WM2 A;  1WX7 A;  4IWP A;  4WAA A;  3PSE B;  4HDQ A;  2D07 B;  4JIO U;  2NBU A;  5E6O A;  5J18 A;  1P98 A;  5KHO A;  2BF8 B;  2C7N B;  2M17 A;  4GOC A;  3DCG A;  4K7U A;  2O2V A;  3AI5 A;  3UQB A;  3LJ3 A;  3ZDM C;  3O65 B;  3QC8 B;  4W9I A;  4EUT A;  2KDB A;  4BBN F;  3R7R A;  2DZI A;  2KQ7 A;  4MGY E;  3L08 A;  5CHF A;  1KLV A;  1WGH A;  3GZN I;  3QIJ A;  3VTV A;  3VAW A;  3PLU A;  4PS7 A;  5E6N A;  4A20 A;  3U7D A;  4DWF A;  2M0X A;  4TQ0 A;  3VDZ A;  1WJN A;  2KWU B;  3A9K B;  3L54 A;  1E8Y A;  2CHX A;  3BIN A;  2C60 A;  2ASQ A;  2BKR B;  4FJZ A;  4NNJ B;  4B95 A;  2MSE D;  2RPQ A;  2KZR A;  3C0R B;  2LZ6 A;  3K9O B;  1WXV A;  3MHS D;  2IY1 B;  3M63 B;  4ICU A;  2YLM A;  2K25 A;  2L0F A;  5GMV A;  3PGE A;  4NQL B;  2NVU I;  3PHW B;  2MA9 B;  5G55 A;  4WJP A;  4MGI E;  4FJY A;  1IP9 A;  2KK8 A;  2KC2 A;  3UIN B;  4X57 B;  4M0W B;  1WGD A;  3CST A;  1BT0 A;  4LJP B;  4KIK B;  2PPH A;  4HLE A;  1MG8 A;  1LXD A;  3EHV A;  5J17 A;  2C7M B;  3VTW A;  2DYB A;  2LGY A;  3VQI A;  1P0R A;  2G4S A;  1V80 A;  3K9P B;  1WJ6 A;  4K7W A;  3W1Y A;  3JSV A;  2MLB A;  5KHQ A;  3LDZ E;  3VH3 B;  3ZNH B;  2EKE C;  2KHW B;  2HD5 B;  3PVL A;  3V6C B;  2KFK B;  2HE7 A;  4GSW A;  2DYO A;  4IM3 A;  1UH6 A;  2OOB B;  3H9D A;  2I1K A;  1OEY A;  5DPT A;  1GG3 A;  1UBI A;  2BYV E;  3R3M A;  5C1Z A;  3QX1 A;  4DHZ B;  3TBL D;  2XBB C;  2K8B A;  3ZRC A;  4GXB A;  3L13 A;  2IO2 B;  4URK A;  3ZTD A;  4IG7 B;  3UQA A;  2J0J A;  3UIP B;  3EFU A;  1JRU A;  4EEW A;  2GBN A;  4ICV A;  4JL9 A;  1U4A A;  2NCN A;  2HJ8 A;  4MGZ E;  2GMI C;  1YX5 B;  1WGG A;  4CYE A;  3N30 A;  1ZGU B;  3D32 A;  2ZVO A;  3QJZ A;  2KAN A;  3DVG Y;  3QA8 A;  3VFK A;  4BKG A;  2MWS B;  1P3Q U;  5HKH A;  2KTR A;  4GDL A;  3OLM D;  3ZDT A;  4ANU A;  2L05 A;  3H7P B;  5DPS A;  5DCN A;  4AJY B;  2BWF A;  2JXX A;  4KVG B;  5AZH A;  4G50 A;  5AEK B;  4KV2 A;  1TTN A;  4E3C A;  1GNU A;  5JH5 C;  1VD2 A;  2KX3 A;  1H8C A;  2KOX A;  2CHW A;  4HDO A;  3HHM A;  2KVR A;  1C1Y B;  1WZ3 A;  2A5U A;  2J0K A;  3DQV A;  2UWQ A;  4B6W A;  2NBV B;  3U30 A;  2RGF A;  2L8J A;  1R4N I;  2AEH A;  3RD2 A;  4ZRK A;  3ECI A;  4WWP A;  1TBE A;  3WAN A;  3PRM B;  3ZIM A;  3M3J A;  2KDF B;  5EDS A;  3SHQ A;  1PQS A;  3B08 A;  4IUM B;  3TMP B;  2ZPN A;  1Z5S B;  2MW5 A;  2ZVN A;  3RZF A;  2GBM A;  2KTR B;  4GDL B;  4HCP B;  4KSK C;  3RZW C;  3ZNZ B;  2DX5 B;  4DHJ B;  4GDK B;  1WR6 E;  2AYO B;  4W9F A;  1UBQ A;  2AWT A;  2K8C A;  3VH4 B;  1XD3 B;  1RLF A;  2KWC A;  5CX3 A;  4E71 A;  3A33 B;  2CS4 A;  2ZPY A;  2MQJ A;  3ENE A;  3ML8 A;  1UGM A;  2JUO A;  2FUH B;  4W9L A;  2FCM A;  2EMS A;  4J6I A;  2D11 A;  4EKU A;  2BGF A;  3DPD A;  5BO4 B;  1V5T A;  5AZG A;  4FLH A;  4II3 B;  3NZU A;  1E90 A;  3PZD A;  4TV3 A;  2CKH B;  4KIK A;  1RFA A;  4DDI D;  3PHX B;  4EZJ A;  4HPM B;  1NI2 A;  4W9E A;  1P9D U;  5CHW A;  1E7U A;  1NDD A;  2J7Q B;  2M4N A;  3H7S A;  1V5O A;  2JZZ A;  4HJK A;  4MGK E;  4NJ6 A;  3V62 A;  2A4Z A;  4BBN C;  2KWV B;  4NAW B;  3L17 A;  1TZ1 A;  3U8Z A;  3KUZ A;  3N3K B;  4IWO A;  4KZ0 A;  3AU4 A;  2V1Y A;  2OJR A;  3RYT A;  4BOS C;  2DYM A;  2KMA A;  4GB9 A;  2LUE A;  2N1V A;  1UD7 A;  4PS3 A;  1NBF C;  2KFJ A;  4ANV A;  1V2Y A;  2D10 A;  2FID A;  3HK0 A;  3TJP A;  2MX2 A;  1LQB A;  3OJ3 A;  4MEL A;  3KUC B;  1YQB A;  3KH0 A;  1V6E A;  1J0G A;  2G4D B;  4MDK E;  3IVF A;  2RR9 A;  3APF A;  2K39 A;  3A1Q B;  5LXH A;  3H6N A;  4ZYN A;  2GBK A;  3GOE A;  1P1A A;  2KDE B;  2LGX A;  1J19 A;  3KYD D;  3NZS A;  5CTR C;  4ANW A;  4W9C A;  3WAP A;  4FBJ B;  2CU1 A;  2DHZ A;  4FUL A;  3JYU A;  3ML9 A;  2N4F A;  3QQ8 B;  4BKS D;  3P2B A;  4K1R B;  3VHT C;  3ZLZ A;  2Y5B B;  2V3S A;  5D6J B;  3W1S C;  2NR2 A;  3ZRF A;  2LWP A;  4G11 A;  2LD9 A;  4M8M A;  3SU8 X;  4E74 A;  2DAJ A;  2D2Q A;  3PV1 A;  3M95 A;  3RT3 B;  5D94 A;  3ZUN A;  1EO6 A;  2BKF A;  3ZKJ C;  1WJ4 A;  4WJN A;  4NY0 A;  1ZKH A;  4BKS A;  2N9X A;  2BYE A;  2FIF A;  2C9W B;  4XZ4 A;  1GC7 A;  1KM7 A;  2D3G A;  2FAZ A;  3RCZ A;  3PRE A;  1RRB A;  1WMH A;  1WR1 A;  1UEL A;  3EC8 A;  4DHJ D;  2Z0D B;  3WA0 A;  2MCN B;  2LXA A;  2WWZ A;  4BOZ B;  2JVC A;  2C7H A;  3ZVV A;  4IW0 A;  1YIW A;  1HE8 A;  1A5R A;  2LJ5 A;  1V86 A;  1I35 A;  2PJH A;  3VTU A;  2ZZP B;  2JT4 B;  1LFD A;  2LXC A;  2JF5 A;  1Y8R C; 
#chains in the Genus database with same CATH topology
 3TCA A;  4C4V A;  1UZX B;  5BYS A;  3Q8A A;  3NOB A;  1YN4 A;  1Q5W B;  1WZ0 A;  1XT9 B;  4MEM A;  3ZTC A;  3AEB B;  4FHK A;  2JRI B;  2JSV X;  4WQO B;  1WGR A;  1YN5 A;  3KYC D;  1WM3 A;  2O2V B;  1ZP0 B;  3ZJT A;  1F52 A;  1HXY D;  2L76 A;  2K0P A;  1E9M A;  3QWZ B;  4HRO A;  4WWM A;  4LJO B;  4TQ1 A;  1PGX A;  1VJK A;  4WJO A;  2GOW A;  4XC2 A;  1GJZ A;  3VRA B;  5G5H A;  1FMA D;  1YD8 U;  2LVO A;  3NVV A;  3AEG B;  2BS3 B;  2KWD A;  4LNO A;  5AZF A;  2LRW A;  2L1A A;  1H4R A;  2WYQ A;  2N1W A;  1E0Z A;  4W9G A;  1UNS A;  2GBJ A;  2H89 B;  4RF1 A;  4LTU A;  2V4L A;  3PRZ A;  1DOY A;  2W82 A;  1OGW A;  2XK5 A;  2LVQ A;  2WXQ A;  5LLI A;  3Q3M C;  4YL8 A;  3SDL C;  2IBI B;  3BK1 A;  5D7G A;  2N0S B;  4ZDV A;  2FNJ B;  1TS3 A;  2KD0 A;  1TYG B;  4DXG A;  1D5M C;  2B3A A;  2G3Q B;  3PS6 A;  1ZW7 A;  4NPN A;  1Q0W B;  2MJ3 A;  3FIL A;  4W9D A;  3EEC A;  4CQN A;  2KN5 A;  1C79 A;  3E9S A;  4HRS A;  1L6U A;  1WF9 A;  2LUM A;  4NJC A;  2HTM E;  4M02 A;  1F2R C;  3ZJU A;  1L0Y B;  3A4R A;  4FXC A;  2AQ2 B;  1HQR D;  1KJT A;  3NVZ A;  4NAW A;  4JQW C;  3DVN U;  3MC8 A;  2W54 A;  4ZHP A;  1SIJ A;  2TSS A;  1GC6 A;  4NQK E;  2J53 A;  2KC1 A;  4XWW A;  1F1H A;  3NHE B;  2J52 A;  2DAF A;  3MHZ A;  4N9F 4;  5E6P A;  3BY4 B;  3VXW A;  5BMI A;  2D3A A;  3NVY A;  3HUI A;  4GN1 A;  1BML C;  1EF5 A;  2LGD A;  3ETR A;  3T9L A;  2IO0 B;  1L7Y A;  2WXO A;  3VR8 B;  2G45 B;  1T0Q C;  4II2 B;  4S0R A;  2LGI A;  4P7I A;  3NJT A;  3MJW A;  1SSN A;  1PGB A;  1T5X D;  1KOT A;  4LLG M;  4FA6 A;  3BVG A;  1JCK B;  3JSV B;  4LDT D;  4RM9 A;  2JPH A;  4HKZ E;  1WJU A;  3SEB A;  2KO3 A;  2LRU A;  5BMG A;  3R66 C;  3GP7 A;  3DBR I;  4HXD A;  1E7P B;  2N9P C;  3IHP C;  1P7F A;  4S17 A;  2BB6 A;  4EE2 A;  3N32 A;  4L2Y A;  2WQY B;  4EZK A;  4HPL B;  2R2O A;  3WAM A;  2PVO D;  2ZNV B;  2SEB D;  3N20 C;  1ZUD 2;  4OZA A;  1TKY A;  4HDQ A;  2K3U A;  3PSE B;  5E6O A;  5J18 A;  1P98 A;  2BF8 B;  4P1B C;  1N62 A;  3TEX A;  3UQB A;  3LJ3 A;  3QC8 B;  4W9I A;  2V9H A;  1C77 A;  3L08 A;  1WGH A;  1SBB B;  3VAW A;  4PS7 A;  1YOV B;  4DWF A;  1WSP A;  3AE2 B;  4RGM A;  3A9K B;  2Y5P A;  3BIN A;  4FJZ A;  4NNJ B;  4B95 A;  3C0R B;  3K9O B;  1WXV A;  3FAH A;  1VLB A;  4OZC A;  3M63 B;  2K25 A;  5GMV A;  4NQL B;  2NVU I;  4HEA 1;  3NG0 A;  1WGD A;  2NTT A;  3AEF B;  2PPH A;  4HLE A;  1NEN B;  1LXD A;  3EHV A;  1IUE A;  2C7M B;  1V80 A;  4K7W A;  3W1Y A;  5KHQ A;  3JSV A;  2MLB A;  2IGG A;  3VH3 B;  2EKE C;  2KHW B;  2HD5 B;  5EE9 A;  2KFK B;  2HE7 A;  4GSW A;  2WS3 B;  1UH6 A;  3ZJV A;  1GG3 A;  3V3X A;  1WWT A;  4DHZ B;  3TBL D;  2XBB C;  1MPE A;  2W3R A;  2IO2 B;  4URK A;  3MFG A;  2NTS A;  1QOF A;  4A90 A;  2K9X A;  3Q8B A;  2NCN A;  1EWY C;  2HJ8 A;  2GMI C;  3QJZ A;  1JWU D;  3DVG Y;  1AN8 A;  2MWS B;  2KTR A;  4GDL A;  3ZDT A;  5FKA C;  5DPS A;  3RNF C;  4AJY B;  2KAC A;  1H8C A;  2E3T A;  3HHM A;  1WZ3 A;  2J0K A;  2NMQ A;  2RGF A;  3RD2 A;  4ZRK A;  4WWP A;  1TBE A;  3M3J A;  3KQ4 A;  1QF6 A;  1WGK A;  2IJ0 A;  2WU2 B;  2WU5 B;  3ZNZ B;  3R2I A;  1RLF A;  2MH7 A;  2ZPY A;  3ENE A;  1LO5 D;  1UGM A;  2FCM A;  2N9L A;  4J6I A;  2JXT A;  1V5T A;  1HA5 A;  2MJD A;  4OZB A;  4TV3 A;  3PZD A;  4KX6 B;  1V1O A;  1ET6 A;  1E7U A;  3L17 A;  1EU4 A;  1TZ1 A;  1L0X B;  3N3K B;  4BOS C;  2KMA A;  2KYW A;  2N1V A;  1UD7 A;  2KFJ A;  1V2Y A;  2D10 A;  2MX2 A;  5E6J A;  1MJD A;  2G4D B;  1WRI A;  2RR9 A;  3IAM 1;  3A1Q B;  4ZYN A;  2GBK A;  2G1E A;  5CTR C;  1TJE A;  3NZS A;  1QQR A;  1JWS D;  2FE8 A;  1QOG A;  2INC C;  3JYU A;  4BKS D;  4XGA B;  4JWU C;  4KGS A;  2LD9 A;  1FIQ A;  4M8M A;  4RFB A;  3SU8 X;  2AQ3 B;  3M95 A;  1CZP A;  1ZKH A;  4BKS A;  1D6E C;  2C9W B;  3EGR A;  4K3B A;  1RRB A;  1WR1 A;  3EC8 A;  4BOZ B;  2LXA A;  4OVZ A;  2JVC A;  4L1B A;  1YIW A;  2PJH A;  4RF0 A;  2JT4 B;  2LXC A;  2JF5 A;  1Y8R C;  4C56 C;  3DDC B;  2OED A;  3DBS A;  4EFO A;  1HTQ A;  1MG4 A;  4AP4 C;  2ZJD A;  5HHD G;  2NPT A;  1WH3 A;  1RM6 C;  2N7D A;  4BAX A;  2AL6 A;  3APD A;  2KX0 A;  5G2N A;  1WYG A;  4M0W A;  2WLB A;  3KWV A;  1L4D B;  3JVZ X;  4JLC A;  3AN1 A;  2KT7 A;  4AS1 A;  2MP2 A;  5JHB A;  5DPW A;  2RDG A;  4NZL B;  1FXT B;  2RD0 A;  1SGH A;  4ZHO A;  4HCN B;  2QSD A;  1V1P B;  3AE6 B;  3P4R B;  4I6P A;  4Q2J A;  4OVV A;  4WQM A;  5FR3 A;  3GZN B;  4ANX A;  2RMM A;  4WWO A;  2QMT A;  1V49 A;  2MP2 B;  3AE8 B;  3RMK C;  4AUQ C;  3VUX A;  2JYE A;  3PTF C;  3PRP B;  1CMX B;  3SFD B;  4KZC A;  5FR6 A;  4RMA A;  2WXL A;  4A9A A;  4PT5 A;  3H7P A;  2VZK B;  1I4G A;  1WX9 A;  5BMH A;  1FM0 D;  2K6D B;  1WY8 A;  1ZOY B;  4HWI B;  1Q10 A;  3AEE B;  3AE3 B;  4RGT A;  3KVF B;  1E8W A;  1WMH B;  3KUD B;  2DZK A;  3W1S A;  4C7Y A;  1R4M I;  2JY6 A;  1WXM A;  3UF8 A;  2JWZ A;  4GGQ A;  3DBL B;  4DK5 A;  1CJE A;  3DWM A;  1C9F A;  2BS4 B;  1MI0 A;  4GDK A;  1K8R B;  2CHZ A;  3V61 A;  3HVZ A;  2BYF A;  1RWS A;  2KXJ A;  3I63 C;  2V0G A;  2J0M A;  4CO7 A;  3L0W B;  2RSU A;  4G3X B;  4L23 A;  1TKE A;  3NZ3 A;  2W9N A;  2NBW B;  4CHK A;  3ZXV A;  4A8X C;  2GBR A;  4B0E A;  1C4P A;  3VR9 B;  2PTL A;  3R8B A;  2LHE A;  1E8Z A;  3PLV A;  2LVP A;  1QOB A;  4TMA B;  4WIP A;  3RUI B;  5JZE B;  2MBB B;  2KAJ A;  1WFY A;  1EF1 A;  1P7E A;  2ZW1 A;  1D5Z C;  2KKC A;  1FNU A;  3SD5 A;  1L2N A;  3DVN V;  4OVU A;  3VUW A;  2KLC A;  3GS2 A;  1NYQ A;  1XEE A;  2J4X A;  2L00 B;  2XK5 B;  1YJ1 A;  3I5J C;  5TR5 A;  4IM0 A;  2LEK A;  3AMZ A;  2O6V D;  4GIV A;  3RUL A;  3X23 A;  2DNF A;  1V8C A;  3AXC A;  3WIM A;  2KJH B;  1Q1O A;  2IO3 B;  2JRH A;  5I4D A;  1QLB B;  1HTO A;  1LM8 B;  3NVW A;  2MBE A;  1XCQ L;  2MRP A;  1WX8 A;  1K53 A;  1XF5 L;  4DDG D;  1OQY A;  3TEW A;  2KMC A;  3Q3F A;  1ISN A;  1Z2M A;  2IY0 B;  3ALB A;  3NRZ A;  1WIA A;  2ZCB A;  3ZO5 B;  2DZM A;  1OQR A;  4PYU A;  4G0N B;  3HIZ A;  1I42 A;  1XLQ A;  2LI5 A;  1OEY J;  4IWP A;  2D07 B;  4TSS A;  1FEH A;  3N9Y C;  5KHO A;  1F0Z A;  4GOC A;  3AE9 B;  1XLN A;  3Q3O C;  4K7U A;  2O2V A;  3FIL B;  3BVZ A;  1SE4 A;  3O65 B;  2ZW0 A;  4BBN F;  3R7R A;  2DZI A;  1NVI D;  1HEZ E;  3FC4 A;  2QCZ A;  1TZO A;  3QIJ A;  2SAK A;  5E6N A;  4TQ0 A;  3L54 A;  2ASQ A;  1C78 A;  2M19 A;  1PDX A;  2RPQ A;  2LZ6 A;  3GB1 A;  4JPS A;  3MHS D;  1L5P A;  1TS2 A;  1R4M B;  3PHW B;  2MA9 B;  4WJP A;  4MGI E;  4FJY A;  1IP9 A;  2KK8 A;  4A55 A;  1N61 A;  4LJP B;  2JX5 A;  1YQ4 B;  3BYT B;  1MG8 A;  3U52 E;  2G4S A;  4REZ A;  3K9P B;  3P4S B;  1PGA A;  1VZ6 A;  3HVD A;  4R3D A;  1FNW A;  1OEY A;  1ZXH A;  5DPT A;  3ZRC A;  1YJJ A;  2L83 A;  1T6B X;  2J0J A;  3EFU A;  1JRU A;  2UU7 A;  3MJ5 A;  4JL9 A;  4MGZ E;  4CYE A;  3VFK A;  1I7H A;  5HKH A;  4ANU A;  4RGN A;  4KVG B;  2ON8 A;  1GNU A;  5IOI A;  3RFZ B;  2KX3 A;  4HDO A;  2KVR A;  1C1Y B;  4MT5 A;  2KDM A;  5HI1 A;  2RDH A;  3WAN A;  1YMH E;  1PQS A;  4IUM B;  3TMP B;  2MW5 A;  2OJW A;  4RCO A;  4HCP B;  4KSK C;  3BWU D;  2AYO B;  3Q8F A;  1XLO A;  1JWM D;  2AWT A;  1JWB D;  4JX1 C;  5CX3 A;  4E71 A;  2WDQ B;  1VZ7 A;  3ML8 A;  2EMS A;  2XN9 C;  1HZ5 A;  4II3 B;  3NZU A;  3T3O A;  2CKH B;  4LNF A;  1B1Z A;  1FCC C;  4HPM B;  2YEP B;  1NI2 A;  1P9D U;  1NDD A;  2J7Q B;  2M4N A;  3H7S A;  4YTN B;  4BZA A;  2A4Z A;  4NAW B;  2WXM A;  3RYT A;  2OJR A;  3EFC A;  5EE1 A;  4PS3 A;  1QKZ A;  3AED B;  2PIA A;  2FID A;  1K50 A;  4YSX B;  3N1Z C;  1UF0 A;  1JQ4 A;  1ZXI A;  1IBX A;  4MEL A;  3RNG C;  3KH0 A;  1V6E A;  4IOI E;  1J0G A;  1AWD A;  1R4N B;  5LXH A;  3GOE A;  3AB5 A;  1P1A A;  4ANW A;  3WAP A;  4FBJ B;  2ICI A;  4YSZ B;  3ML9 A;  3QQ8 B;  3P2B A;  3VHT C;  3ZLZ A;  2Y5B B;  5D6J B;  3W5V B;  3CIR B;  1GB1 A;  1K52 A;  3PV1 A;  1NYR A;  3N1Y C;  3U7Z A;  1I4X A;  3ZUN A;  4C80 A;  1EO6 A;  3ZKJ C;  1WJ4 A;  4WJN A;  2BW2 A;  4RNA A;  2BYE A;  2FIF A;  1GC7 A;  2FAZ A;  4HKQ A;  3URY A;  1FRR A;  2Z0D B;  5H8Y E;  2MCN B;  1KF6 B;  3ZVV A;  1HE8 A;  1I35 A;  2ZZP B;  1DGJ A;  3U4E G;  1FNV A;  4A3P A;  4I6N B;  2KJ6 A;  3P4P B;  3AEC B;  1SE9 A;  3P4Q B;  1V97 A;  2JZP A;  3PO0 A;  3QAQ A;  1NI3 A;  4AQ7 A;  3KW5 B;  2ZCC A;  2VH1 A;  1X1M A;  4FN2 A;  1M94 A;  1E8X A;  2MBO A;  2K8H A;  3MP9 A;  1G6J A;  1YX6 B;  3GE3 C;  4JWS C;  4YSY B;  1TT5 B;  1UWX A;  1N5W A;  1V81 A;  1AYF A;  2QIL A;  4FJV B;  3VVW B;  1LGR A;  1VRA B;  4JE3 B;  4XE0 A;  4AWJ A;  4WWN A;  2L32 A;  4K7S A;  2J42 A;  2DEN B;  3VRB B;  4H2A A;  3A9K A;  2GB1 A;  2O6V A;  1D3Z A;  4DBG A;  3L10 B;  3ZW3 A;  4MJS A;  1WRD B;  2PEA A;  5D2M B;  2ZEQ A;  3WAO A;  3TL5 A;  2KDI A;  1C76 A;  3DBR B;  1TGZ B;  3ZXR A;  1WYW B;  3CWI A;  2Y5C A;  5AUK A;  2OHF A;  1WI0 A;  3NY5 A;  5CHV C;  3DHI C;  3RNA C;  3W2D A;  2MEK A;  1WE7 A;  1MFW A;  4GU2 A;  2WXR A;  2KN4 A;  2R2Q A;  4FAD A;  4LCD E;  3Q2A C;  2WDT B;  2CJN A;  4RH6 A;  3QCA A;  5GXG B;  2JZ3 B;  4M8N A;  1L6V A;  3NS8 A;  3OWE B;  1OFF A;  1JRO A;  4F8C B;  1GOZ A;  3NUH B;  1IPG A;  4ITK A;  3I3T B;  1S1Q B;  2DBY A;  3B0A A;  3N1X C;  3PT2 B;  3UIO B;  2GLS A;  5EE3 A;  2M1M A;  2CR5 A;  2KLG A;  1E7V A;  4MH0 E;  3T8M A;  4HVB A;  1JML A;  1GB4 A;  1IYF A;  5JHA A;  3BII D;  3B1L X;  2WDR B;  2VZK D;  1UWM A;  4K3C A;  4I6L B;  1I4P A;  1FXI A;  2CJO A;  4DXA B;  4KGR A;  4D2K A;  1I4Q A;  4IDI A;  3LYY A;  4XDC A;  1S3S G;  3DBH B;  1T0Y A;  1KFY B;  4PK1 A;  2YVC A;  4EOY A;  1TY2 A;  5L95 C;  3CSF A;  2O6V B;  3BK2 A;  1JAL A;  3PZ8 A;  1YQ3 B;  5DPR A;  4TKN A;  2FCS A;  4YXD B;  3R2T A;  4XWT A;  4US8 A;  4F1S A;  3X0W A;  3AEA B;  3RNC C;  1MHH E;  2DZJ A;  1TS5 A;  5L83 A;  4KSL C;  1ACC A;  3SR6 A;  2K1F A;  2PE6 B;  3A9J A;  3BZD B;  1SE3 A;  4NJ7 A;  2XEW A;  3AUL A;  3E56 A;  2WX0 A;  1SF0 A;  5T8I A;  4F7Z A;  3HM6 X;  2BQQ A;  3DBL I;  4W9J A;  4WUR A;  2KNB A;  1ZDX A;  2VRR B;  3QAR A;  1PFD A;  4ZRJ A;  1F9J A;  1RAX A;  4MH8 A;  4US9 A;  3GE8 C;  5IP4 D;  1J7A A;  3A9J B;  2WXK A;  4A3O A;  2MJE A;  2K6Q A;  2IO1 B;  2NPT B;  1CK1 A;  4XYC A;  1GUA B;  3HM3 A;  2L52 A;  2D5G A;  1R7S A;  4IWQ A;  1KLG D;  3P1M A;  1ZPS A;  3B2F A;  2M17 A;  1I4H A;  3LB8 C;  5H92 C;  3DCG A;  3H8H A;  3AI5 A;  1SB3 C;  3ZDM C;  4YWG G;  4EUT A;  2Y3A A;  2KDB A;  4MGY E;  1KLV A;  3GZN I;  1L0V B;  3VTV A;  1C4C A;  4N6E B;  3PLU A;  1V1P A;  2IND C;  4KGT A;  2KWU B;  1E8Y A;  2CHX A;  3IT6 B;  4OHJ A;  1K51 A;  2BKR B;  2IPK D;  2KZR A;  3UI3 A;  1F2R I;  2WDV B;  4RGO S;  2WP9 B;  2QEJ C;  2R61 A;  4USA A;  2PVG C;  4QAY A;  3AH7 A;  3UIN B;  4X57 B;  4WAF A;  3CST A;  1BT0 A;  4KIK B;  1T0R C;  2HJ1 A;  1QIL A;  2DYB A;  3O13 A;  3VQI A;  1UUP A;  4ARI A;  2E6X A;  3ZNH B;  1QT9 A;  3V6C B;  2WXJ A;  1JWA D;  1D5X C;  2DYO A;  1TS4 A;  2LFI A;  1UBI A;  3R3M A;  1PYW D;  4IG7 B;  3ZTD A;  3UQA A;  3UIP B;  4ICV A;  1U4A A;  1YN3 A;  1WGG A;  4OW0 A;  1SE2 A;  3N30 A;  2ZVO A;  3QA8 A;  1FFU A;  2HDE A;  1P3Q U;  3OLM D;  1EU3 A;  2L05 A;  5DCN A;  2JXX A;  3I57 A;  4KV2 A;  1TTN A;  4E3C A;  5AEK B;  5JH5 C;  2CHW A;  5D3D A;  2A5U A;  3DQV A;  2UWQ A;  3U30 A;  2AEH A;  4UDU C;  3ECI A;  2H88 B;  5EDS A;  3SHQ A;  2ZPN A;  1DOX A;  5TSS A;  2Z8L A;  4P16 A;  4ARC A;  1WR6 E;  2WGS A;  2K8C A;  3VH4 B;  3B9J A;  1XD3 B;  2KWC A;  3A33 B;  4NAM A;  2CS4 A;  4YTM B;  2DWQ A;  2MQJ A;  1VDV A;  2CU3 A;  4W9L A;  3C8Y A;  4EKU A;  2BGF A;  2WXH A;  4LNI A;  1IGC A;  4O1N A;  5BO4 B;  1E6E B;  5AZG A;  1B9R A;  4FLH A;  2X38 A;  1XO3 A;  5JXV A;  3TEZ A;  1RFA A;  2M56 B;  3PHX B;  1ZDV A;  4EZJ A;  4W9E A;  4MAC A;  4NJ6 A;  1V5O A;  4MGK E;  3U8Z A;  3KUZ A;  4IWO A;  4KZ0 A;  2V1Y A;  5AUI A;  2DYM A;  4GB9 A;  3P63 A;  1NBF C;  1YNT E;  4ANV A;  1OQQ A;  3Q14 C;  3TJP A;  4LK0 M;  1J7C A;  1LQB A;  1YQB A;  3DHH C;  2XNA C;  3APF A;  2K39 A;  3Q3N C;  3H6N A;  2LGX A;  3KYD D;  2BTE A;  1TY0 A;  4W9C A;  1WXQ A;  2CU1 A;  3KWL A;  3TSS A;  3Q8E A;  4HJG E;  4KKI A;  2V3S A;  3AE5 B;  3W1S C;  3NS1 A;  2LHD A;  1ROE A;  2NR2 A;  4G11 A;  2KQ4 X;  2DAJ A;  3RT3 B;  3OG5 A;  5D94 A;  3T3N A;  2AQ1 B;  2LJI A;  1MHX A;  2N9X A;  1JRP A;  1T0S C;  5HG2 A;  1FRD A;  3DWG C;  3RCZ A;  3PRE A;  1UEL A;  2BB5 A;  4M00 A;  2JWU A;  3DHG C;  2IGH A;  1V86 A;  3VTU A;  2PMV A;  1LFD A;  2JU6 X;  4XDD A;  3RN9 C;  1QOA A;  3W5U B;  2Z59 B;  1KH0 A;  1ENF A;  4KDL B;  4EZL A;  2HTH A;  5HFY A;  3IFW B;  3FKY A;  1E5W A;  1J8C A;  3VUY A;  2EEL A;  4LDT B;  3BVM A;  3S2A A;  3IBE A;  2L3Z A;  4GMV A;  1Y56 A;  3U2S C;  4C4V B;  2QHO A;  1FO4 A;  2YEP F;  1KTK A;  4B9K A;  1C4A A;  3APC A;  4KKJ A;  4PYZ A;  4DQO C;  1XCT L;  1AAR A;  3Q3J A;  2D3C A;  3PPA A;  3LXF A;  2MBQ A;  3ZNI D;  4P6V F;  2Q5W D;  5IAA C;  3ABV B;  4W9K A;  4BVU C;  2K22 A;  4AJW A;  3ZGZ A;  3TIX A;  1FXA A;  1VZ8 A;  3IG3 A;  1VCB A;  1OTR B;  4C00 A;  1EUV B;  3AE4 B;  3M62 B;  2PW9 A;  1IBX B;  5C23 A;  2G9H D;  2WX1 A;  1VR9 A;  4IC7 B;  2V4I B;  2QDF A;  1XXG A;  4KDI C;  3AU5 A;  2REX A;  5LXI B;  4FHJ A;  3OJ4 B;  2LAS A;  3CMM B;  2LGS A;  2MBH A;  4RM8 A;  2WXN A;  4ZRI A;  2IYD B;  1SJH D;  2FCQ A;  1AW7 A;  1UGJ A;  2EMT A;  1FCL A;  2K5P A;  4TUU A;  2ZNV C;  2KJR A;  2QIE B;  2C5L C;  1M4V A;  4DHZ E;  1RYJ A;  4WH4 A;  3Q8C A;  3RNB C;  4N58 A;  2X8X X;  2IZV B;  3CF6 E;  3V60 A;  2D3B A;  2NS5 A;  5MPO A;  4IM2 A;  4ZOH C;  3ZNG C;  3DBH I;  4YT0 B;  4ZRP A;  4MM3 A;  3I9V 1;  4PS8 A;  4HK2 A;  4XX5 A;  3RPF C;  1WE6 A;  3H1U A;  1STE A;  1WGY A;  1BUI C;  1ZE3 D;  2Z0E B;  1WXA A;  3L4P A;  3QHT A;  2QC8 A;  2MHJ A;  3JW0 X;  1EWC A;  4W9H A;  2INP E;  3ZYY X;  4ASW C;  1XQQ A;  2IDY A;  3WCQ A;  4AOF A;  3R7Q A;  3V6E B;  3A4S C;  4MSQ B;  1T3Q A;  3MTN B;  1N5X A;  3W9C B;  1C3T A;  2WXF A;  3AE7 B;  5EE0 A;  2UYZ B;  1WXS A;  3L16 A;  1I4R A;  1SIF A;  3C19 A;  2AL3 A;  2BWE S;  2M8S A;  4B0M A;  3OAW A;  1IGD A;  2KQS A;  2BS2 B;  4IKG A;  2PE9 A;  5J2R A;  2AX5 A;  3UGB B;  3PZ7 A;  2ACZ B;  4MJS B;  5IA7 A;  4WJQ A;  1ESF A;  2L0T A;  3TUO A;  2N7E A;  2KFK A;  4BKT A;  4ZRQ A;  2N9E B;  2KTF A;  3WAL A;  4K81 A;  3DOW A;  4MSM B;  2M0A A;  3QK0 A;  2BPS A;  4JGH B;  2L7R A;  1QZE A;  1FD6 A;  1HZ6 A;  5LNK 1;  4C7Z A;  2RDB C;  3A1Q A;  1N63 A;  1D4B A;  3IT4 B;  1DYQ A;  3ONS A;  2FBW B;  2FCN A;  3BYY B;  4BFR A;  2I1J A;  3DVG X;  1V9J A;  5FK9 C;  1WM2 A;  1WX7 A;  4LNN A;  4WAA A;  4JIO U;  2NBU A;  4MM3 B;  2C7N B;  2EKI A;  2I38 A;  1SJE D;  2KQ7 A;  2N7J A;  1RFK A;  5CHF A;  1EM7 A;  1FPY A;  4A20 A;  3U7D A;  2M0X A;  3VDZ A;  1WJN A;  2C60 A;  2KVZ A;  2MSE D;  2V3P A;  4P1C C;  3RI7 C;  5BYR A;  2IY1 B;  3KLS X;  4ICU A;  2ONQ A;  2YLM A;  3MC9 A;  2L0F A;  3PGE A;  4A6Q A;  1JW9 D;  5G55 A;  1MVK A;  1N6Z A;  2KC2 A;  4M0W B;  5J17 A;  1ET9 A;  3VTW A;  2LGY A;  3IAS 1;  1P0R A;  3IXS A;  2JYT A;  1WJ6 A;  3LDZ E;  5C3J B;  2I2Y A;  2N9K A;  3PVL A;  4IM3 A;  2B76 B;  2OOB B;  3H9D A;  4DXF A;  2I1K A;  1YJI A;  2BYV E;  5C1Z A;  3QX1 A;  2K8B A;  2V3N A;  4GXB A;  3L13 A;  2JQR B;  3J9C A;  3AE1 B;  4EEW A;  2GBN A;  3V05 A;  2RPV A;  1A70 A;  1GAQ B;  3EUB 2;  3TEY A;  1L4Z B;  1YX5 B;  3Q69 A;  1ZGU B;  3D32 A;  1XLP A;  2KAN A;  1F77 A;  4BKG A;  1KLU D;  4GLS C;  4HPP A;  3H7P B;  3HRD D;  1KRH A;  2BBC A;  2BWF A;  5AZH A;  4G50 A;  3Q6B A;  1VD2 A;  1DOI A;  2WXI A;  1E10 A;  2KOX A;  2IGD A;  5IKC M;  2WXP A;  4B6W A;  3RNE C;  2NBV B;  2L8J A;  1R4N I;  1SXT A;  2INN E;  1J7B A;  3PRM B;  1TIF A;  3ZIM A;  2KDF B;  3B08 A;  2QJL A;  1Z5S B;  2ZVN A;  3RZF A;  2GBM A;  2KTR B;  4GDL B;  3RZW C;  2DX5 B;  2WNM A;  2BT6 A;  1SEB D;  5G5G A;  2BVC A;  2PLP A;  4DHJ B;  2VH2 A;  4GDK B;  1GPX A;  1UBQ A;  3SFE B;  3EA6 A;  2FUG 1;  1N60 A;  3AV8 A;  2JUO A;  1TKG A;  2FUH B;  3ZQ4 A;  2DLB A;  2D11 A;  2PKO A;  3DPD A;  4N59 A;  5IO9 A;  1E90 A;  4KIK A;  4J3O D;  1NEK B;  4DDI D;  1FFV A;  5CHW A;  4W9F A;  2JZZ A;  4HJK A;  3V62 A;  4BBN C;  2KWV B;  4LNK A;  3AU4 A;  5C2T B;  2LUE A;  5IN7 A;  1CQV A;  4ACF A;  5D3I B;  3HK0 A;  1BXT A;  4M01 A;  3B2G A;  3OJ3 A;  3KUC B;  2LMC A;  2WHI A;  4MDK E;  3IVF A;  2KMM A;  3MC0 B;  2KDE B;  1J19 A;  2GRI A;  5BYQ A;  2W55 A;  3AM9 A;  2DHZ A;  4FUL A;  2N4F A;  4ZYS A;  4K1R B;  1PUT A;  2BYT A;  3ZRF A;  2LWP A;  4E74 A;  2D2Q A;  2WXG A;  2W3S A;  2BKF A;  3P42 A;  4NY0 A;  4XZ4 A;  1KM7 A;  2D3G A;  2GI9 A;  1WMH A;  4DHJ D;  3WA0 A;  2WWZ A;  2C7H A;  4IW0 A;  1A5R A;  2LJ5 A;  4YTP B; 
#chains in the Genus database with same CATH homology
 3TCA A;  3DDC B;  3DBS A;  4EFO A;  4A3P A;  1UZX B;  4I6N B;  2Z59 B;  2KJ6 A;  4AP4 C;  4KDL B;  4EZL A;  2ZJD A;  1SE9 A;  3NOB A;  2HTH A;  3IFW B;  2NPT A;  1WH3 A;  1Q5W B;  1WZ0 A;  1XT9 B;  4MEM A;  2N7D A;  1E5W A;  3QAQ A;  1J8C A;  3VUY A;  3KW5 B;  2AL6 A;  3APD A;  4LDT B;  2ZCC A;  2KX0 A;  5G2N A;  3ZTC A;  1X1M A;  3S2A A;  3IBE A;  3JVZ X;  2JRI B;  4FHK A;  4JLC A;  4FN2 A;  1M94 A;  4WQO B;  2MP2 A;  5JHB A;  5DPW A;  2L3Z A;  1WGR A;  4GMV A;  3KYC D;  1WM3 A;  1E8X A;  2O2V B;  2MBO A;  2K8H A;  2QHO A;  1G6J A;  1YX6 B;  2L76 A;  1FXT B;  2RD0 A;  1SGH A;  4B9K A;  1V81 A;  3VVW B;  3APC A;  4FJV B;  4HCN B;  4PYZ A;  4AWJ A;  3QWZ B;  4I6P A;  4OVV A;  4WWN A;  4K7S A;  4LJO B;  4TQ1 A;  2DEN B;  1AAR A;  4ANX A;  3A9K A;  4WJO A;  3Q3J A;  2GOW A;  4XC2 A;  4WWO A;  1V49 A;  1GJZ A;  2O6V A;  1D3Z A;  2MP2 B;  3PPA A;  2MBQ A;  4AUQ C;  3VUX A;  3ZNI D;  4DBG A;  3L10 B;  1YD8 U;  2LVO A;  3PTF C;  4MJS A;  5IAA C;  3PRP B;  1CMX B;  4W9K A;  3ZW3 A;  4AJW A;  4BVU C;  1WRD B;  4KZC A;  2PEA A;  5FR6 A;  5AZF A;  5D2M B;  3TIX A;  2LRW A;  1H4R A;  2WYQ A;  2ZEQ A;  4RMA A;  2N1W A;  3WAO A;  3IG3 A;  1VCB A;  1OTR B;  3TL5 A;  2KDI A;  4W9G A;  1TGZ B;  2GBJ A;  3H7P A;  1EUV B;  1WYW B;  3M62 B;  1WX9 A;  2V4L A;  3PRZ A;  1OGW A;  2K6D B;  2XK5 A;  1WY8 A;  2LVQ A;  5LLI A;  1WI0 A;  4YL8 A;  3NY5 A;  5CHV C;  5C23 A;  3SDL C;  4HWI B;  2IBI B;  5D7G A;  2WX1 A;  4IC7 B;  1WE7 A;  4GU2 A;  4ZDV A;  2FNJ B;  3KVF B;  1E8W A;  1WMH B;  2R2Q A;  2DZK A;  3KUD B;  3W1S A;  4FAD A;  4KDI C;  1R4M I;  2JY6 A;  2KD0 A;  3AU5 A;  4LCD E;  1WXM A;  2REX A;  2WDT B;  3UF8 A;  2JWZ A;  5LXI B;  4GGQ A;  4FHJ A;  3OJ4 B;  2LAS A;  3CMM B;  4DK5 A;  2B3A A;  3QCA A;  2G3Q B;  2MBH A;  3PS6 A;  4RM8 A;  1ZW7 A;  4ZRI A;  2JZ3 B;  4M8N A;  4GDK A;  1K8R B;  2CHZ A;  3NS8 A;  2IYD B;  1Q0W B;  4NPN A;  3V61 A;  4W9D A;  2FCQ A;  3EEC A;  2BYF A;  2EMT A;  4F8C B;  2KXJ A;  2KN5 A;  4TUU A;  2ZNV C;  1IPG A;  2J0M A;  3I3T B;  1S1Q B;  2KJR A;  2C5L C;  4CO7 A;  3B0A A;  3PT2 B;  3L0W B;  2RSU A;  4DHZ E;  3UIO B;  1WF9 A;  2M1M A;  2KLG A;  2CR5 A;  1E7V A;  4G3X B;  4MH0 E;  3T8M A;  4HVB A;  2W9N A;  2IZV B;  2NBW B;  1IYF A;  5JHA A;  4CHK A;  3CF6 E;  3V60 A;  2NS5 A;  3B1L X;  3A4R A;  4IM2 A;  2GBR A;  3ZNG C;  3DBH I;  4MM3 A;  1KJT A;  4I6L B;  4NAW A;  4JQW C;  3DVN U;  4DXA B;  4PS8 A;  4HK2 A;  4XX5 A;  1E8Z A;  1WE6 A;  3PLV A;  2LVP A;  3H1U A;  1S3S G;  1WGY A;  1T0Y A;  2Z0E B;  3RUI B;  1WXA A;  3QHT A;  2YVC A;  5JZE B;  4EOY A;  2MBB B;  3JW0 X;  4W9H A;  5L95 C;  3CSF A;  2O6V B;  1GC6 A;  4NQK E;  4ASW C;  1WFY A;  1XQQ A;  1EF1 A;  2KC1 A;  4AOF A;  3R7Q A;  3V6E B;  3A4S C;  4MSQ B;  3NHE B;  2KKC A;  2DAF A;  4N9F 4;  3SD5 A;  5E6P A;  1L2N A;  5DPR A;  3BY4 B;  3DVN V;  3MTN B;  4OVU A;  4TKN A;  3VXW A;  2FCS A;  3VUW A;  1C3T A;  2KLC A;  4GN1 A;  4F1S A;  3X0W A;  1EF5 A;  2L00 B;  2DZJ A;  2LGD A;  2XK5 B;  1YJ1 A;  2UYZ B;  5TR5 A;  1WXS A;  3L16 A;  2IO0 B;  3T9L A;  5L83 A;  4IM0 A;  2O6V D;  1SIF A;  1L7Y A;  4KSL C;  4GIV A;  3RUL A;  3X23 A;  2AL3 A;  2BWE S;  2G45 B;  2K1F A;  2M8S A;  4II2 B;  2PE6 B;  3OAW A;  3A9J A;  2KQS A;  3AXC A;  4NJ7 A;  2PE9 A;  2XEW A;  5J2R A;  3WIM A;  2KJH B;  4P7I A;  3UGB B;  1Q1O A;  3AUL A;  2WX0 A;  3MJW A;  2IO3 B;  4MJS B;  2JRH A;  1KOT A;  5IA7 A;  4FA6 A;  4F7Z A;  3JSV B;  4LDT D;  4WJQ A;  3HM6 X;  4RM9 A;  2L0T A;  1LM8 B;  2JPH A;  2MBE A;  2N7E A;  3DBL I;  2KFK A;  1WJU A;  2KNB A;  4W9J A;  4BKT A;  2KO3 A;  2LRU A;  2N9E B;  3R66 C;  2VRR B;  3DBR I;  2KTF A;  3QAR A;  3WAL A;  2MRP A;  4K81 A;  3DOW A;  4HXD A;  1WX8 A;  3QK0 A;  4MSM B;  4ZRJ A;  2BPS A;  2N9P C;  1F9J A;  1RAX A;  3IHP C;  2L7R A;  4JGH B;  1QZE A;  1OQY A;  4DDG D;  2KMC A;  3A9J B;  3A1Q A;  1ISN A;  1Z2M A;  2IY0 B;  3ALB A;  3Q3F A;  3N32 A;  4A3O A;  1WIA A;  2ZCB A;  3ZO5 B;  2K6Q A;  2DZM A;  3ONS A;  4EZK A;  2IO1 B;  2NPT B;  4HPL B;  2FCN A;  1GUA B;  3HM3 A;  4G0N B;  4PYU A;  2I1J A;  2R2O A;  3WAM A;  3DVG X;  4BFR A;  3HIZ A;  1I42 A;  1V9J A;  2ZNV B;  4IWQ A;  2LI5 A;  1OEY J;  1WM2 A;  1WX7 A;  4IWP A;  4WAA A;  3PSE B;  4HDQ A;  2D07 B;  4JIO U;  2NBU A;  5E6O A;  5J18 A;  1P98 A;  5KHO A;  2BF8 B;  2C7N B;  2M17 A;  4GOC A;  3DCG A;  4K7U A;  2O2V A;  3AI5 A;  3UQB A;  3LJ3 A;  3ZDM C;  3O65 B;  3QC8 B;  4W9I A;  4EUT A;  2KDB A;  4BBN F;  3R7R A;  2DZI A;  2KQ7 A;  4MGY E;  3L08 A;  5CHF A;  1KLV A;  1WGH A;  3GZN I;  3QIJ A;  3VTV A;  3VAW A;  3PLU A;  4PS7 A;  5E6N A;  4A20 A;  3U7D A;  4DWF A;  2M0X A;  4TQ0 A;  3VDZ A;  1WJN A;  2KWU B;  3A9K B;  3L54 A;  1E8Y A;  2CHX A;  3BIN A;  2C60 A;  2ASQ A;  2BKR B;  4FJZ A;  4NNJ B;  4B95 A;  2MSE D;  2RPQ A;  2KZR A;  3C0R B;  2LZ6 A;  3K9O B;  1WXV A;  3MHS D;  2IY1 B;  3M63 B;  4ICU A;  2YLM A;  2K25 A;  2L0F A;  5GMV A;  3PGE A;  4NQL B;  2NVU I;  3PHW B;  2MA9 B;  5G55 A;  4WJP A;  4MGI E;  4FJY A;  1IP9 A;  2KK8 A;  2KC2 A;  3UIN B;  4X57 B;  4M0W B;  1WGD A;  3CST A;  1BT0 A;  4LJP B;  4KIK B;  2PPH A;  4HLE A;  1MG8 A;  1LXD A;  3EHV A;  5J17 A;  2C7M B;  3VTW A;  2DYB A;  2LGY A;  3VQI A;  1P0R A;  2G4S A;  1V80 A;  3K9P B;  1WJ6 A;  4K7W A;  3W1Y A;  3JSV A;  2MLB A;  5KHQ A;  3LDZ E;  3VH3 B;  3ZNH B;  2EKE C;  2KHW B;  2HD5 B;  3PVL A;  3V6C B;  2KFK B;  2HE7 A;  4GSW A;  2DYO A;  4IM3 A;  1UH6 A;  2OOB B;  3H9D A;  2I1K A;  1OEY A;  5DPT A;  1GG3 A;  1UBI A;  2BYV E;  3R3M A;  5C1Z A;  3QX1 A;  4DHZ B;  3TBL D;  2XBB C;  2K8B A;  3ZRC A;  4GXB A;  3L13 A;  2IO2 B;  4URK A;  3ZTD A;  4IG7 B;  3UQA A;  2J0J A;  3UIP B;  3EFU A;  1JRU A;  4EEW A;  2GBN A;  4ICV A;  4JL9 A;  1U4A A;  2NCN A;  2HJ8 A;  4MGZ E;  2GMI C;  1YX5 B;  1WGG A;  4CYE A;  3N30 A;  1ZGU B;  3D32 A;  2ZVO A;  3QJZ A;  2KAN A;  3DVG Y;  3QA8 A;  3VFK A;  4BKG A;  2MWS B;  1P3Q U;  5HKH A;  2KTR A;  4GDL A;  3OLM D;  3ZDT A;  4ANU A;  2L05 A;  3H7P B;  5DPS A;  5DCN A;  4AJY B;  2BWF A;  2JXX A;  4KVG B;  5AZH A;  4G50 A;  5AEK B;  4KV2 A;  1TTN A;  4E3C A;  1GNU A;  5JH5 C;  1VD2 A;  2KX3 A;  1H8C A;  2KOX A;  2CHW A;  4HDO A;  3HHM A;  2KVR A;  1C1Y B;  1WZ3 A;  2A5U A;  2J0K A;  3DQV A;  2UWQ A;  4B6W A;  2NBV B;  3U30 A;  2RGF A;  2L8J A;  1R4N I;  2AEH A;  3RD2 A;  4ZRK A;  3ECI A;  4WWP A;  1TBE A;  3WAN A;  3PRM B;  3ZIM A;  3M3J A;  2KDF B;  5EDS A;  3SHQ A;  1PQS A;  3B08 A;  4IUM B;  3TMP B;  2ZPN A;  1Z5S B;  2MW5 A;  2ZVN A;  3RZF A;  2GBM A;  2KTR B;  4GDL B;  4HCP B;  4KSK C;  3RZW C;  3ZNZ B;  2DX5 B;  4DHJ B;  4GDK B;  1WR6 E;  2AYO B;  4W9F A;  1UBQ A;  2AWT A;  2K8C A;  3VH4 B;  1XD3 B;  1RLF A;  2KWC A;  5CX3 A;  4E71 A;  3A33 B;  2CS4 A;  2ZPY A;  2MQJ A;  3ENE A;  3ML8 A;  1UGM A;  2JUO A;  2FUH B;  4W9L A;  2FCM A;  2EMS A;  4J6I A;  2D11 A;  4EKU A;  2BGF A;  3DPD A;  5BO4 B;  1V5T A;  5AZG A;  4FLH A;  4II3 B;  3NZU A;  1E90 A;  3PZD A;  4TV3 A;  2CKH B;  4KIK A;  1RFA A;  4DDI D;  3PHX B;  4EZJ A;  4HPM B;  1NI2 A;  4W9E A;  1P9D U;  5CHW A;  1E7U A;  1NDD A;  2J7Q B;  2M4N A;  3H7S A;  1V5O A;  2JZZ A;  4HJK A;  4MGK E;  4NJ6 A;  3V62 A;  2A4Z A;  4BBN C;  2KWV B;  4NAW B;  3L17 A;  1TZ1 A;  3U8Z A;  3KUZ A;  3N3K B;  4IWO A;  4KZ0 A;  3AU4 A;  2V1Y A;  2OJR A;  3RYT A;  4BOS C;  2DYM A;  2KMA A;  4GB9 A;  2LUE A;  2N1V A;  1UD7 A;  4PS3 A;  1NBF C;  2KFJ A;  4ANV A;  1V2Y A;  2D10 A;  2FID A;  3HK0 A;  3TJP A;  2MX2 A;  1LQB A;  3OJ3 A;  4MEL A;  3KUC B;  1YQB A;  3KH0 A;  1V6E A;  1J0G A;  2G4D B;  4MDK E;  3IVF A;  2RR9 A;  3APF A;  2K39 A;  3A1Q B;  5LXH A;  3H6N A;  4ZYN A;  2GBK A;  3GOE A;  1P1A A;  2KDE B;  2LGX A;  1J19 A;  3KYD D;  3NZS A;  5CTR C;  4ANW A;  4W9C A;  3WAP A;  4FBJ B;  2CU1 A;  2DHZ A;  4FUL A;  3JYU A;  3ML9 A;  2N4F A;  3QQ8 B;  4BKS D;  3P2B A;  4K1R B;  3VHT C;  3ZLZ A;  2Y5B B;  2V3S A;  5D6J B;  3W1S C;  2NR2 A;  3ZRF A;  2LWP A;  4G11 A;  2LD9 A;  4M8M A;  3SU8 X;  4E74 A;  2DAJ A;  2D2Q A;  3PV1 A;  3M95 A;  3RT3 B;  5D94 A;  3ZUN A;  1EO6 A;  2BKF A;  3ZKJ C;  1WJ4 A;  4WJN A;  4NY0 A;  1ZKH A;  4BKS A;  2N9X A;  2BYE A;  2FIF A;  2C9W B;  4XZ4 A;  1GC7 A;  1KM7 A;  2D3G A;  2FAZ A;  3RCZ A;  3PRE A;  1RRB A;  1WMH A;  1WR1 A;  1UEL A;  3EC8 A;  4DHJ D;  2Z0D B;  3WA0 A;  2MCN B;  2LXA A;  2WWZ A;  4BOZ B;  2JVC A;  2C7H A;  3ZVV A;  4IW0 A;  1YIW A;  1HE8 A;  1A5R A;  2LJ5 A;  1V86 A;  1I35 A;  2PJH A;  3VTU A;  2ZZP B;  2JT4 B;  1LFD A;  2LXC A;  2JF5 A;  1Y8R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...