2KD0A

Nmr solution structure of o64736 protein from arabidopsis thaliana. northeast structural genomics consortium mega target ar3445a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
MGHHHHHHSHSTIKLTVKFGGKSIPLSVSPDCTVKDLKSQLQPITNVLPRGQKLIFKGKVLVETSTLKQSDVGSGAKLMLMASQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LRR repeats and ubiquitin-like domain-containing protein At2
publication title NMR solution structure of O64736 protein from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2008-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kd0A01
1WY8A 4IC7B 3RZWC 3ZRFA 3KUZA 4OVUA 1UD7A 2EKEC 2HTHA 3TIXA 3VUXA 3W1SA 2FAZA 3VUYA 4B9KA 4NY0A 4CYEA 4NQLB 2D2QA 1R4MI 3DBRI 2C7NB 5JHAA 4MGIE 2DYOA 5L83A 2JVCA 1UZXB 2GBKA 4PS3A 2FUHB 3NOBA 4FA6A 3EFUA 3PV1A 2JUOA 4X57B 1YD8U 4B95A 2R2OA 4JGHB 2IBIB 4AOFA 4KZ0A 3RT3B 2WYQA 3JW0X 4W9DA 1WF9A 2K25A 2L05A 3HM6X 4MJSA 4AJYB 1EUVB 2DZKA 4WWPA 3IFWB 5J2RA 3OAWA 1WI0A 2QHOA 2GMIC 4FULA 1QZEA 1YX6B 1K8RB 4W9CA 3QA8A 4BOZB 1TGZB 2D10A 2V3SA 2WWZA 1LFDA 3ZW3A 4KDLB 4NPNA 3JSVB 4LCDE 3PPAA 1H8CA 4IWQA 4EZLA 1UGMA 3HIZA 3PS6A 3W1YA 5HKHA 4KIKB 4MGYE 1XD3B 3B1LX 1NI2A 3TBLD 2MSED 3L16A 4GSWA 4HWIB 4WJNA 3U7DA 4DDID 1Y8RC 1V5OA 4URKA 4LDTB 4M8NA 3A9KA 1P3QU 2KJRA 3AU4A 2LUEA 1HE8A 2I1JA 4EZKA 2XEWA 4RM9A 2HE7A 2FCNA 2MA9B 2KVRA 4HLEA 1TTNA 3ECIA 2KX3A 1ZGUB 3PGEA 4BKGA 1V80A 4FJYA 2BWFA 2KFKB 2MBQA 2MBEA 3VUWA 3SU8X 3Q3FA 5C1ZA 2BF8B 1J0GA 2KJHB 4FJVB 3ZNHB 2C7MB 4XC2A 4MSMB 3IG3A 4HCPB 3VH4B 3A9JA 4P7IA 2GOWA 2CHXA 4IM3A 4GN1A 4PYZA 4EKUA 1WGYA 2AEHA 1E8XA 2IY0B 2DX5B 1I42A 2KZRA 1R4NI 2JF5A 1YQBA 2O6VB 4M8MA 2WX1A 3S2AA 5D6JB 3DBLI 3ZTDA 4DK5A 3PT2B 4MSQB 2BYEA 4ZRIA 2CHWA 4DDGD 3NHEB 1RRBA 4WJPA 2MP2B 3TJPA 4A3OA 5BO4B 3HK0A 4MEMA 4GDLB 1GNUA 1V2YA 1JRUA 2N1VA 3SD5A 1VCBA 3ZVVA 2PJHA 1KLVA 2K8CA 3PHWB 3RYTA 1RFAA 2KX0A 1GG3A 4GDKA 1XQQA 3L0WB 3PLVA 2I1KA 2NS5A 3TMPB 3A1QB 4HK2A 3ZTCA 4M0WB 4KVGB 3QQ8B 4GOCA 4HCNB 4DHJD 3CSTA 4RM8A 1WX9A 3PLUA 4KDIC 2MBBB 4KV2A 2KHWB 2VRRB 3DQVA 4I6PA 1V86A 2DZJA 4MDKE 5C23A 3CSFA 3IVFA 2ZVNA 1UH6A 4ANUA 1J19A 2OJRA 2V4LA 3IBEA 3EHVA 3X0WA 2ZCCA 3OLMD 3HHMA 1WE6A 3PREA 4HDQA 3M63B 1H4RA 3N32A 4IUMB 3QWZB 2KMAA 4W9KA 4DXAB 2FIDA 4BKTA 3R7QA 3B0AA 4NAWA 4G50A 2IY1B 5D7GA 1WH3A 1Q0WB 2D07B 3DVNU 3SDLC 1AARA 4N9F4 4J6IA 1ZKHA 3A4RA 3PTFC 4KSKC 1WJNA 2GBMA 4GIVA 5DPWA 3H7PB 1SIFA 3TCAA 1E8WA 4KZCA 3ZDMC 1WXVA 2DAJA 3ZIMA 2LASA 4XX5A 4WAAA 1ZW7A 2JZZA 5TR5A 3UIOB 4JL9A 2A5UA 3H1UA 2KKCA 4FHKA 3V6EB 1EO6A 4MM3A 1WMHB 2L00B 2ZEQA 2IO0B 5L95C 3NZSA 3ZLZA 2KTRB 3VQIA 4OVVA 5GMVA 2M8SA 2N7DA 2N1WA 2KLGA 3CF6E 4EOYA 3L13A 3KW5B 2MX2A 5DPSA 2ZVOA 4CHKA 1P98A 4K7SA 2C5LC 4ASWC 1G6JA 2NBVB 1P1AA 3EECA 2G45B 3RD2A 3APDA 3V61A 4HXDA 3R3MA 3QAQA 2D11A 3UQBA 2KLCA 2M1MA 3A33B 2KC1A 1A5RA 4LJOB 1WYWB 2C7HA 2M17A 3PSEB 2DZMA 2ZPNA 3QCAA 4KSLC 5E6PA 4WWOA 1FXTB 4AWJA 3DDCB 3A9KB 2BPSA 4FADA 1RLFA 3RZFA 2LRWA 1UELA 2CHZA 2PEAA 3EC8A 3KH0A 5CHVC 3WAPA 2GBNA 4E71A 2JWZA 3JSVA 2K39A 4GU2A 2L76A 5EDSA 2MBHA 3VH3B 4AJWA 4K81A 1LXDA 4FHJA 2K6QA 3DVNV 3TL5A 2K6DB 1YJ1A 2DHZA 2IYDB 3VXWA 3L17A 4K7UA 1WE7A 2FCQA 4IG7B 2ZZPB 4II2B 1KJTA 3A9JB 4YL8A 4NJ7A 3ZUNA 5JHBA 3KYDD 2N7EA 4HPLB 2XK5A 2PE9A 4ZRJA 2DZIA 3AI5A 2LZ6A 2KQSA 4MGKE 4MGZE 2KFKA 2Y5BB 1WFYA 2BYFA 1YIWA 2IZVB 5CX3A 2BYVE 2IO3B 3W1SC 1WJ6A 2Z59B 2B3AA 2G4SA 4LDTD 4TUUA 5DCNA 1F9JA 4I6NB 1GC7A 3UQAA 2KC2A 2AYOB 1WGHA 4NNJB 1UBQA 2JPHA 2MQJA 3L54A 4EEWA 2FNJB 3WANA 3ZNZB 3QK0A 5D94A 4BOSC 2RPQA 2DYBA 2O6VA 3NZUA 2N9PC 4B6WA 2R2QA 2N9EB 3BINA 5KHOA 1OEYA 3RULA 4TKNA 4ICVA 3VTWA 1WGGA 2GBRA 4WWNA 2KDFB 2NPTA 3WALA 2NR2A 2KQ7A 2A4ZA 2EMTA 4MH0E 3CMMB 2MP2A 5AEKB 3PRMB 1T0YA 3D32A 2FCSA 2GBJA 4GDLA 3KUCB 1Z2MA 2CKHB 2RD0A 4JIOU 1TZ1A 2JRIB 2KTFA 3T8MA 3M3JA 1OQYA 2KWVB 2O2VB 2RSUA 2J0MA 2ZCBA 2O6VD 1WXSA 2DENB 4FN2A 4II3B 3JYUA 3UF8A 4DWFA 4BBNC 5AZGA 3VTUA 2ZPYA 3APFA 1CMXB 4IM2A 5J18A 1E8ZA 3A1QA 3H7SA 3L08A 3ZNGC 2J0KA 5LLIA 4EFOA 3R7RA 4ZYNA 2JT4B 2G4DB 2PPHA 2MLBA 1GUAB 1RAXA 2FIFA 1EF1A 4NAWB 5CTRC 4NQKE 1OEYJ 2L0FA 4ANXA 3DVGY 2KMCA 4WJOA 4W9FA 3UGBB 5DPRA 2IO2B 2MBOA 2WX0A 3GOEA 3OJ3A 3X23A 3QJZA 3PZDA 1NDDA 2LVQA 3GZNI 2BKFA 2JY6A 1KOTA 4A3PA 3RCZA 4IM0A 4BVUC 2G3QB 2LGDA 1U4AA 2RR9A 4ANVA 3QIJA 2LWPA 3QHTA 3BY4B 1WX8A 4IW0A 4HPMB 1ISNA 1P0RA 2KXJA 1BT0A 2YVCA 3KUDB 3L10B 1IP9A 4MELA 2MCNB 4WJQA 5G55A 3ZKJC 2LD9A 2C60A 4MJSB 3WAOA 2XBBC 4IWPA 2N9XA 5IA7A 5CHFA 2L3ZA 4NJ6A 1GJZA 2CU1A 2MRPA 3AU5A 3DPDA 4TV3A 4HDOA 3ML9A 5JZEB 4I6LB 2BKRB 4EZJA 3DVGX 1MG8A 1WJUA 1WMHA 3WIMA 2M4NA 1WZ3A 2YLMA 2KWCA 3SHQA 2NBUA 4W9IA 4GB9A 1WR1A 2KOXA 1VD2A 2KDBA 2UYZB 3ZNID 2IO1B 2Z0EB 4W9LA 2REXA 2KTRA 4ANWA 4GMVA 3HM3A 1KM7A 2PE6B 2NCNA 2KFJA 3N30A 2KJ6A 3PHXB 4K1RB 3VAWA 1SE9A 1LQBA 1V9JA 2KDEB 2KN5A 4W9HA 4LJPB 1I35A 2JXXA 4DHZE 2AWTA 1V6EA 4HVBA 2JZ3B 5DPTA 3P2BA 1X1MA 2KWUB 2LVOA 4W9GA 2ASQA 2ZNVC 2HJ8A 4TQ1A 1GC6A 1WIAA 4PS8A 4KIKA 1E8YA 1S1QB 4PYUA 2DYMA 3ENEA 4K7WA 1NBFC 4WQOB 3V62A 1E90A 2L0TA 2CS4A 1OGWA 1V81A 2KD0A 2KK8A 5D2MB 3JVZX 1P9DU 2MWSB 1EF5A 2NVUI 5KHQA 2KANA 1XT9B 2K8HA 3LJ3A 2C9WB 3KYCD 2XK5B 3DBHI 4GGQA 5FR6A 2WDTB 2LXCA 4BFRA 3LDZE 1IYFA 3M95A 1E7VA 3ALBA 3M62B 1Q1OA 1LM8B 2AL3A 3AULA 3VTVA 2NBWB 5E6NA 3V6CB 3ML8A 4JLCA 3VFKA 2N4FA 1Z5SB 3MJWA 4G0NB 3PRPB 2LXAA 3Q3JA 3RUIB 3V60A 3OJ4B 2LVPA 3K9OB 3ZO5B 4DHJB 2CR5A 2BWES 2FCMA 3NY5A 3O65B 1D3ZA 2L7RA 4W9JA 5JH5C 1E5WA 4W9EA 1WGRA 3UIPB 3ZRCA 3AXCA 3N3KB 1E7UA 2M0XA 5J17A 2AL6A 4TQ0A 4BKSA 4JQWC 3H9DA 4GDKB 2K1FA 4RMAA 1WXAA 1WM2A 3VDZA 3A4SC 4A20A 4BBNF 2W9NA 3UINB 3ZDTA 3H6NA 3DOWA 2ZJDA 3DCGA 3PVLA 1M94A 1L2NA 1WM3A 2NPTB 1WX7A 1L7YA 3I3TB 3VVWB 1TBEA 2UWQA 2K8BA 2LI5A 2JRHA 1WGDA 1V5TA 4DBGA 1WJ4A 2ZNVB 2HD5B 4HJKA 3KVFB 4ZDVA 3APCA 3QARA 3B08A 1J8CA 4BKSD 2L8JA 1WZ0A 2LJ5A 3IHPC 2LRUA 3PRZA 3U8ZA 3T9LA 5AZFA 2D3GA 5E6OA 2OOBB 3MHSD 3R66C 3U30A 4FBJB 2KO3A 3C0RB 4E3CA 3MTNB 1WRDB 3QC8B 2DAFA 1C1YB 1UBIA 5AZHA 4AP4C 4CO7A 2O2VA 4GXBA 2LGXA 1WR6E 4G3XB 2LGYA 4IWOA 5CHWA 4AUQC 4F7ZA 4DHZB 1SGHA 3VHTC 4FJZA 2BGFA 2MW5A 3K9PB 3WA0A 1C3TA 4ZRKA 2EMSA 1YX5B 5LXIB 1Q5WB 3DBSA 2Z0DB 3NS8A 4F8CB 2J7QB 2KNBA 1IPGA 4PS7A 5IAAC 1OTRB 2KDIA 3WAMA 5LXHA 1WXMA 4F1SA 4E74A 2V1YA 1V49A 4G11A 2J0JA 4XZ4A 3ONSA 1S3SG 2RGFA 1PQSA 4ICUA 4EUTA 3QX1A 5G2NA 3H7PA 4FLHA
chains in the Genus database with same CATH superfamily
1WY8A 4YT0B 3KUZA 1VDVA 2HTHA 3VUXA 1F2RI 1KLUD 1R4MI 3DBRI 5EE0A 4MGIE 3AE8B 2FUHB 1YD8U 4B95A 2R2OA 1FNUA 2WYQA 3JW0X 3IAS1 4MJSA 2DZKA 2OJWA 1WI0A 2GMIC 1QZEA 1PGAA 3AEGB 3QA8A 2W82A 1TGZB 2BBCA 2B76B 3ZW3A 3B2GA 4YTPB 3JSVB 1M4VA 4KIKB 4MGYE 1XD3B 2CJNA 4GSWA 1L4ZB 4US8A 4C4VA 3DWGC 1FEHA 3AU4A 2LUEA 2I1JA 2PMVA 2AQ2B 2WU2B 1XCQL 2KMMA 1TTNA 3I9V1 4BKGA 1L0VB 1YN4A 1V80A 3I5JC 5D3DA 1L0XB 3VUWA 1V8CA 4LNIA 5IN7A 3IG3A 3A9JA 1D5MC 4IM3A 4WH4A 1E0ZA 1WGYA 2AEHA 1QOBA 1R4NI 2JF5A 2J42A 5HG2A 1BUIC 1YMHE 3DBLI 4ZRIA 4L2YA 2KWDA 2WXLA 2INCC 4N59A 1SF0A 1IBXA 1GNUA 1JRUA 4MT5A 2DWQA 1VCBA 1KLVA 4GDKA 1GG3A 4ARCA 4ARIA 1SIJA 3L0WB 2I1KA 4M0WB 4MH8A 3QQ8B 3CSTA 3PLUA 1ZPSA 4KV2A 2KHWB 1CK1A 2VRRB 3DQVA 4I6PA 1V86A 2DZJA 4LNOA 4MDKE 5FR3A 2WDVB 3W5UB 1UH6A 3IBEA 3HHMA 3PREA 4HRSA 4DXGA 1H4RA 1SJED 1SE2A 4DXAB 3B0AA 4G50A 1Q0WB 4N9F4 2EKIA 3PTFC 1WJNA 5EE3A 3TCAA 1T3QA 4KZCA 4AS1A 2LASA 3U52E 4XX5A 2Y5PA 5TR5A 4UDUC 3UIOB 2A5UA 3H1UA 1EO6A 3Q8AA 2ZEQA 3P63A 3NZSA 3ZLZA 3VQIA 4OVVA 1KLGD 2N1WA 3CF6E 4EOYA 3KW5B 5DPSA 2ZVOA 2ICIA 3P42A 3RD2A 4N58A 1JALA 2D11A 5BYRA 1I4GA 4JWSC 2IGDA 1WYWB 1J7AA 2DZMA 2ZPNA 3FKYA 4KSLC 1FXTB 3DDCB 2IGGA 2BPSA 1RLFA 2UU7A 1UELA 3WAPA 2K39A 4RGTA 4AJWA 3VH3B 1LXDA 3P1MA 3ZJTA 3HVZA 1ENFA 2IYDB 3NJTA 3VXWA 5IP4D 4WURA 2M19A 1KRHA 2INDC 2N7EA 4HPLB 2DZIA 3AI5A 3I63C 3ZGZA 2LZ6A 2QJLA 1FO4A 3LXFA 2Z59B 2G4SA 4TUUA 4YTMB 2HDEA 2IDYA 4I6NB 3AE4B 4IKGA 2JPHA 3WANA 4BOSC 2O6VA 4B6WA 2R2QA 3BINA 1JWUD 3SR6A 2GBRA 3B2FA 2NR2A 2A4ZA 3CMMB 2MP2A 3PRMB 4NJCA 1VZ6A 5GXGB 3Q6BA 1TS5A 4GDLA 3KUCB 2JWUA 3EA6A 1TZ1A 2VH2A 3M3JA 2KWVB 3RPFC 4FN2A 4ZYSA 3UF8A 4BBNC 1I4PA 3VTUA 3APFA 1CMXB 1LGRA 1E8ZA 5LLIA 4EFOA 2JT4B 2MLBA 3W2DA 1GUAB 2Y3AA 1TT5B 2WXKA 1SSNA 3EFCA 1OEYJ 2MJ3A 4NQKE 2KMCA 4WJOA 4W9FA 5HI1A 3GOEA 3OJ3A 3X23A 1JWBD 2JZPA 1YQ4B 2JY6A 4A3PA 2OEDA 4XYCA 4RFBA 4BVUC 2LGDA 1PFDA 3AN1A 4IW0A 5AUKA 1BT0A 3L10B 3UI3A 4WJQA 5G55A 4MJSB 2C60A 3WAOA 1V97A 5CHFA 4TV3A 1F52A 4O1NA 2QSDA 3DVGX 1MG8A 1WJUA 1WMHA 4RH6A 1WZ3A 1WXQA 4W9IA 4GB9A 1WR1A 4A9AA 2N9LA 2Z0EB 2L1AA 2REXA 1TY0A 4GMVA 1XF5L 3HM3A 2KYWA 3ZQ4A 3ETRA 1SE9A 1T0SC 1V9JA 2KACA 4W9HA 3RMKC 5I4DA 2JZ3B 4W9GA 2ASQA 4XWTA 5HHDG 2ZNVC 1WIAA 4KIKA 4K7WA 3V62A 1OGWA 2K8HA 1Q10A 2SEBD 1C9FA 3DBHI 5FR6A 5BYQA 3Q2AC 1IYFA 2GLSA 1Q1OA 3VTVA 2NBWB 3AEBB 5E6NA 3V6CB 1Z5SB 3MJWA 1JRPA 4ZRQA 2LVPA 2Z8LA 1D3ZA 4W9JA 5JH5C 1E5WA 3UIPB 2I2YA 3AEFB 3AXCA 2WNMA 2M0XA 4RF0A 2AL6A 1GB4A 3BVGA 4GDKB 1WXAA 3VDZA 1ACCA 2AX5A 1VR9A 2W9NA 5AUIA 3H6NA 4BAXA 3VRAB 3BVZA 2UWQA 2X38A 3N1ZC 1TS2A 5EE1A 1V5TA 4B0EA 1WJ4A 2ZNVB 2HD5B 2K5PA 4BKSD 5D3IB 2L8JA 3Q8CA 2LJ5A 3SEBA 3IHPC 3KLSX 3MHSD 4RF1A 4ACFA 1B9RA 2PVGC 4HKQA 1FIQA 2W3SA 4HPPA 1WR6E 2LGYA 2DNFA 1SGHA 3WA0A 1C3TA 4ZRKA 1YX5B 5LXIB 2KNBA 4KGTA 1D5XC 1OTRB 3MFGA 4E74A 1V49A 1PQSA 2PIAA 1ET6A 1V1OA 1UD7A 3OWEB 3URYA 1RWSA 3HUIA 4OHJA 3MP9A 2OHFA 3DBRB 2DYOA 2GBKA 3NOBA 2Y5CA 2N7JA 1WWTA 4JGHB 3T3OA 4PK1A 1WF9A 2L05A 4XDCA 2QHOA 1N60A 1YX6B 1K8RB 4W9CA 4M00A 3AE5B 3PPAA 1ESFA 2MSED 3L16A 4HWIB 1VJKA 3U4EG 4A6QA 2KJRA 2WDQB 1HE8A 3N1YC 2XEWA 4RM9A 4OZBA 1I7HA 2FCNA 2KVRA 3ZJUA 1ZGUB 1TJEA 1PGXA 3SU8X 3RFZB 3FILB 5C1ZA 1J0GA 2JSVX 3KWLA 3ZNHB 2C7MB 4XC2A 3NUHB 1E8XA 1I42A 2RPVA 2KZRA 3ZYYX 4HEA1 1YQBA 2O6VB 4M8MA 1CQVA 1TKYA 3BIID 4MSQB 3DBLB 4DDGD 3BK2A 1MHHE 1RRBA 4P16A 4WJPA 2MP2B 3TJPA 5BO4B 1FRRA 4GDLB 1V2YA 3SD5A 4M01A 3ZVVA 4S17A 2K8CA 3PHWB 2KX0A 4AQ7A 1JW9D 1XQQA 3PLVA 2J4XA 3TMPB 1YN5A 4M02A 3AB5A 3LYYA 2W54A 3RN9C 2MBBB 2DLBA 4OZCA 3CSFA 1KF6B 3GE3C 3X0WA 2BT6A 5FK9C 3OLMD 1WE6A 4C7YA 3M63B 3N32A 1A70A 1QF6A 2JXTA 2PVOD 2M56B 5BMHA 1TS3A 1RFKA 1AARA 4IDIA 3BYTB 3A4RA 2GBMA 3H7PB 1XXGA 1E8WA 1ZW7A 2AQ1B 4YSYB 3W9CB 4FHKA 3U2SC 4A55A 1WMHB 3SFEB 2LGIA 2Q5WD 1QOGA 2MX2A 4TMAB 3RNFC 2C5LC 4ASWC 2VZKB 2G45B 1UUPA 1J7CA 3UQBA 2KLCA 2M1MA 4REZA 1MFWA 2L52A 1A5RA 4LJOB 5H92C 4KX6B 4ZHOA 4OVZA 2M17A 4YXDB 5E6PA 3MHZA 3A9KB 2LRWA 2CHZA 3I57A 3KH0A 5CHVC 2WXNA 1ZUD2 3CIRB 5EDSA 4OW0A 4YSXB 2GB1A 3TL5A 2I38A 2IGHA 3ZXRA 4II2B 5JHBA 2D3CA 2PE9A 1YJIA 2PLPA 4C80A 4MGKE 1WFYA 2VH1A 5CX3A 2BYVE 5DCNA 2FBWB 1ZP0B 2D5GA 4EEWA 4EE2A 5D94A 1FXAA 2N9PC 1N62A 5KHOA 3R8BA 4TKNA 4ICVA 3TUOA 1FFUA 4WWNA 2KQ7A 1T0YA 3D32A 2FCSA 2GBJA 2CKHB 3WCQA 2RSUA 2O6VD 2DENB 4LTUA 4DWFA 2BS4B 2ZPYA 4IM2A 3H7SA 2MEKA 3ZNGC 4ZYNA 1RAXA 3E56A 3MC0B 5EE9A 5CTRC 2WXQA 4ANXA 1L5PA 3DVGY 1C77A 4S0RA 2X8XX 4JE3B 2MBOA 1K53A 3IXSA 2LVQA 3AE3B 4ANVA 1FNWA 1J7BA 1WX8A 3BY4B 2KXJA 1P0RA 2WXFA 2YVCA 2MCNB 1FD6A 3ZKJC 4IWPA 4RNAA 4NJ6A 1TY2A 2BW2A 3N9YC 2KQ4X 3AU5A 3DPDA 3ML9A 3WIMA 3N1XC 2ONQA 2KWCA 2YLMA 4K3CA 1F0ZA 2UYZB 1MVKA 1SE4A 2KDBA 2KTRA 1D5ZC 4ANWA 1KM7A 2RDHA 2KFJA 2QILA 2KDEB 4LJPB 1I35A 2AWTA 5DPTA 3P2BA 1X1MA 2KWUB 2LVOA 1ZDVA 2HJ8A 4TQ1A 1F77A 2DYMA 3NVZA 1E7PB 1R7SA 2L0TA 2KD0A 2KK8A 2MWSB 1EF5A 2VZKD 1MHXA 1NENB 3KYCD 5BMGA 2LXCA 3DBHB 4BFRA 3LDZE 3M95A 3M62B 1YJJA 3AULA 3FILA 2NTSA 3VFKA 2N4FA 3PRPB 2JQRB 3Q3JA 4K3BA 2NTTA 4DHJB 2BWES 3O65B 2BB5A 1WGRA 3ZRCA 5J17A 1I4HA 1RM6C 4JQWC 3U7ZA 1XLOA 4RMAA 3A4SC 3FC4A 4BBNF 1C4PA 3ZDTA 3EUB2 2ZJDA 5IKCM 1WM3A 1BXTA 1NI3A 2QC8A 3I3TB 4Q2JA 2JRHA 5JXVA 1YOVB 4ZDVA 3QARA 1ET9A 3PRZA 3U8ZA 3RNBC 3T9LA 2D3GA 2MHJA 3C0RB 3MTNB 2D3BA 2DAFA 5AZHA 2O2VA 4GXBA 1EU3A 4WAFA 4G3XB 5CHWA 1MJDA 4IWOA 2LFIA 2MW5A 1L0YB 4NAMA 1IPGA 4PS7A 5IAAC 3DWMA 2V1YA 4LNFA 4XZ4A 4ICUA 3ZXVA 3QX1A 4QAYA 3H7PA 4FLHA 2EELA 3RZWC 3ZRFA 1MG4A 4OVUA 2EKEC 1L4DB 1KFYB 3TIXA 1TKEA 3VUYA 4NY0A 4NQLB 2D2QA 3AEEB 1ZDXA 1STEA 5JHAA 1JWAD 1UZXB 3NVWA 1HA5A 3AV8A 4FA6A 3PV1A 2JUOA 4X57B 4AOFA 3SFDB 3J9CA 2K25A 3HM6X 3P4RB 4WWPA 5T8IA 3OAWA 4RCOA 1FRDA 4FULA 4JPSA 4BOZB 2WWZA 1LFDA 3CWIA 3AMZA 2L32A 4US9A 1H8CA 4IWQA 1UGMA 3HIZA 3PS6A 3W1YA 4C56C 1NI2A 1XLNA 3U7DA 3R2TA 1EWYC 4DDID 1SBBB 4URKA 4JX1C 3A9KA 3B9JA 1DGJA 1P3QU 4EZKA 2HE7A 2MA9B 1PDXA 3V05A 4HLEA 3ECIA 4FJYA 2BWFA 3NRZA 1XEEA 1YQ3B 3AEAB 3Q3FA 1GAQB 3TEYA 2ACZB 4MSMB 4P7IA 2GOWA 2KN4A 2H89B 4PYZA 4XGAB 4YTNB 3Q3MC 4C00A 3AEDB 1N61A 1FFVA 3HVDA 2WX1A 1TYGB 3S2AA 1NEKB 5D6JB 3ZTDA 4TSSA 4DK5A 2V3PA 2BYEA 4KKJA 1C78A 1VLBA 3NHEB 4A3OA 2KVZA 3ZJVA 1PUTA 2E3TA 2N1VA 1WGKA 2J53A 1RFAA 2HJ1A 4KKIA 3NVYA 3ZTCA 4GOCA 4DHJD 4RM8A 1N5WA 1K52A 1TS4A 2QIEB 5C23A 3IVFA 2ZVNA 1J19A 2MH7A 3EHVA 3TEXA 4HDQA 3VRBB 2D3AA 2IJ0A 1BMLC 4L23A 2IY1B 1P7EA 3P4PB 5D7GA 1WH3A 3SDLC 2D07B 3DVNU 4J6IA 1ZKHA 5G5HA 4GIVA 2J52A 2PKOA 5DPWA 1SIFA 1WXVA 5TSSA 2DAJA 3ZIMA 4WAAA 3GZNB 2YEPB 2KKCA 3V6EB 2BTEA 2L00B 2N9KA 4C7ZA 3MC9A 3AM9A 2KTRB 3GS2A 5GMVA 2KT7A 2KLGA 3L13A 1L6UA 5MPOA 1G6JA 1P98A 4K7SA 2NBVB 1P1AA 3V61A 4HXDA 1XLPA 3R3MA 3QAQA 3A33B 2KC1A 1HXYD 3Q8FA 1ZOYB 1VZ8A 3QCAA 1XCTL 4WQMA 4FADA 3EC8A 3VR9B 2PEAA 2GBNA 4E71A 2MJDA 4GU2A 2L76A 4GLSC 3MC8A 2WQYB 3BYYB 4FHJA 3TEWA 2DHZA 4DQOC 3Q3NC 3GE8C 1WE7A 4K7UA 3PZ7A 1KJTA 2LMCA 4YL8A 1V1PA 4NJ7A 3KYDD 4ZRJA 2KQSA 3P4QB 2KFKA 2JU6X 2Y5BB 1YIWA 2IZVB 2SAKA 2IO3B 2B3AA 1XLQA 3LB8C 1N63A 5IOIA 1AN8A 1F9JA 2G9HD 1GC7A 3UQAA 4NNJB 4N6EB 2MQJA 3L54A 2FNJB 5FKAC 1WRIA 2RPQA 2DYBA 4LNNA 3RULA 1AWDA 2N0SB 2KDFB 3WALA 4WIPA 2V3NA 4MH0E 2RD0A 2JRIB 1FNVA 2KTFA 3T8MA 1OQYA 2WXRA 1C79A 1UF0A 2O2VB 2ZCBA 1WXSA 4CQNA 1E9MA 3A1QA 2RMMA 3L08A 2J0KA 1EF1A 4NAWB 2L0FA 5BMIA 5DPRA 2IO2B 2K0PA 2WX0A 3QJZA 3PZDA 3GZNI 3RNCC 2BS2B 2WXIA 1KOTA 1MI0A 4P1CC 3RCZA 4IM0A 2MJEA 2G3QB 1U4AA 3QIJA 4HPMB 1ISNA 3KUDB 4MELA 1YN3A 5LNK1 2LD9A 2XBBC 1GJZA 2CU1A 2MRPA 1XO3A 3IAM1 5JZEB 1T0RC 4I6LB 3AE9B 4J3OD 4EZJA 1JCKB 2M4NA 2KOXA 1VD2A 3ZNID 3N30A 4K1RB 2KJ6A 3PHXB 1UNSA 2KN5A 2JXXA 3BWUD 2WLBA 4PS8A 4HROA 1FCCC 1QLBB 1E8YA 1S1QB 1JWMD 1NBFC 1UGJA 2WXHA 4WQOB 1E90A 2CS4A 1MPEA 5D2MB 3JVZX 3C8YA 5BYSA 1AW7A 3LJ3A 2C9WB 2AQ3B 1ZXHA 2XK5B 4GGQA 3Q14C 2H88B 4H2AA 1E7VA 2AL3A 4IOIE 1T0QC 3ML8A 3Q8EA 3OJ4B 3PZ8A 3K9OB 2CR5A 1TIFA 4RGMA 2L7RA 1E7UA 1N5XA 1GOZA 1CZPA 4A90A 1OFFA 1D4BA 1DOXA 3R2IA 2XN9C 1L2NA 2NPTB 3N20C 1D6EC 1L7YA 1WX7A 1TBEA 3DHIC 2K8BA 2LI5A 1WGDA 4DBGA 2WXGA 2K22A 3APCA 3B08A 1I4XA 4JWUC 3RI7C 3AE6B 2KAJA 1PGBA 3QC8B 3E9SA 2LGXA 4AUQC 4F7ZA 4DHZB 4LK0M 1HQRD 1T6BX 3OG5A 3DBSA 4R3DA 2Z0DB 4F8CB 2J7QB 2WP9B 2KDIA 3WAMA 1WXMA 4F1SA 2WU5B 2J0JA 2GI9A 3ONSA 4HDOA 3TBLD 4IC7B 2LHDA 3W1SA 4B9KA 2FAZA 4CYEA 3V3XA 2C7NB 2GRIA 5E6JA 5L83A 2JVCA 4PS3A 3EFUA 2IBIB 4KZ0A 4L1BA 3RT3B 4W9DA 1SXTA 4AJYB 1EUVB 3IFWB 5J2RA 1UWMA 2D10A 2V3SA 4KDLB 4NPNA 4LCDE 4EZLA 5HKHA 3B1LX 3GP7A 2JX5A 4WJNA 1Y8RC 3FAHA 1V5OA 4LDTB 4M8NA 2CJOA 4WWMA 1FPYA 1V1PB 2QEJC 2KX3A 3PGEA 2G1EA 2WHIA 2KFKB 2MBQA 2MBEA 1NVID 2BF8B 2KJHB 4FJVB 3KWVA 2BYTA 4HCPB 3VH4B 2CHXA 3DHHC 4GN1A 1VRAB 2WXMA 4EKUA 2IY0B 2DX5B 3C19A 2ZW1A 2HTME 1SE3A 3PT2B 3NS1A 1OQRA 2CHWA 4USAA 1FMAD 1SB3C 3HK0A 3BVMA 4MEMA 1C4AA 2R61A 2PJHA 3RYTA 3W5VB 2PTLA 1NYRA 2NS5A 3A1QB 4HK2A 4KVGB 1CJEA 3IT6B 4HCNB 1WX9A 4KDIC 2KDMA 4RGOS 2LEKA 3BK1A 2BB6A 4ANUA 1QKZA 2OJRA 2V4LA 1NYQA 2ZCCA 3BZDB 4IUMB 3QWZB 2KMAA 4W9KA 2FIDA 4BKTA 1HEZE 3R7QA 4NAWA 2WS3B 4XE0A 4HKZE 2JYTA 2WXJA 4KSKC 5HFYA 3ZDMC 5G5GA 2E6XA 3NZ3A 2JZZA 3ABVB 4JL9A 1FXIA 2FUG1 4MM3A 3AE1B 5IO9A 2IO0B 5L95C 2JYEA 2M8SA 2N7DA 4P1BC 3AE2B 1JROA 4CHKA 1F1HA 3EECA 4MACA 2NMQA 3APDA 4A8XC 1P7FA 1QOAA 4DXFA 4B0MA 4YSZB 2C7HA 3AECB 3PSEB 1SJHD 1IGCA 4WWOA 4C4VB 1HTQA 4AWJA 2ZW0A 2WXOA 3RZFA 1FM0D 3TEZA 2JWZA 3JSVA 2MBHA 4K81A 2LJIA 2FE8A 2K6QA 3DVNV 2K6DB 1YJ1A 3L17A 2YEPF 2FCQA 4IG7B 2ZZPB 4FXCA 3A9JB 3ZUNA 2XK5A 1E6EB 1KH0A 4MGZE 2BYFA 3W1SC 1WJ6A 1I4RA 1WYGA 2DBYA 2V9HA 4LDTD 3AE7B 4YWGG 2KC2A 3RNGC 2AYOB 4P6VF 1WGHA 1UBQA 2BS3B 3ZNZB 3EGRA 3QK0A 1IBXB 4ITKA 3NZUA 4HJGE 3H8HA 1B1ZA 2N9EB 2INPE 1OEYA 1OQQA 3VTWA 1F2RC 1WGGA 2NPTA 2EMTA 5AEKB 2PW9A 1HZ6A 1Z2MA 4JIOU 3KQ4A 1QQRA 2CU3A 2INNE 2J0MA 3Q3OC 4II3B 3JYUA 1N6ZA 1K50A 5AZGA 5J18A 3IT4B 1SEBD 1FCLA 3Q8BA 1ZXIA 4M0WA 3PO0A 3R7RA 2PPHA 2G4DB 1DOYA 2FIFA 5C2TB 3UGBB 1C76A 2V0GA 1EM7A 1NDDA 2BKFA 3RNAC 3T3NA 1GB1A 1EU4A 4XWWA 2RR9A 3HRDD 2LWPA 3QHTA 1T5XD 1IP9A 3O13A 1LO5D 1IUEA 1WSPA 2N9XA 5IA7A 2L3ZA 1JWSD 1AYFA 1RYJA 2XNAC 1L6VA 1ZE3D 2BKRB 1R4MB 4PT5A 3SHQA 2NBUA 1VZ7A 4ZHPA 1QOFA 2LGSA 2IO1B 4W9LA 3Q69A 2PE6B 2NCNA 4D2KA 3VAWA 1LQBA 1HTOA 3AH7A 4DHZE 4HVBA 1V6EA 4XDDA 3NG0A 1YNTE 2BVCA 2QMTA 3TSSA 1GC6A 2WDRB 4PYUA 3ENEA 1TKGA 1GPXA 4ZOHC 1DOIA 1V81A 1I4QA 1P9DU 2NVUI 5KHQA 2KANA 2QCZA 1XT9B 4RGNA 2WDTB 4LNKA 2LHEA 2W3RA 2V4IB 3ALBA 1LM8B 4JLCA 3P4SB 3MJ5A 4G0NB 1QT9A 2IPKD 2LXAA 1EWCA 4LLGM 3RUIB 3V60A 3ZO5B 2FCMA 3NY5A 5H8YE 2L83A 4OZAA 4W9EA 1JQ4A 1K51A 1C4CA 3N3KB 1PYWD 1R4NB 4TQ0A 4BKSA 3H9DA 2K1FA 1WM2A 2WXPA 2ON8A 4A20A 2RDBC 1ROEA 3UINB 1IGDA 3DOWA 2TSSA 3DCGA 3PVLA 1M94A 4ZRPA 1UWXA 3VVWB 1KTKA 2BQQA 1TZOA 2QDFA 2W55A 4HJKA 3KVFB 2M0AA 1QILA 2K3UA 3L4PA 1J8CA 4BZAA 1WZ0A 2LRUA 3RNEC 5AZFA 5E6OA 2OOBB 3R66C 3U30A 4KGRA 2KO3A 4FBJB 4E3CA 3NVVA 1WRDB 1C1YB 1UBIA 5C3JB 1Y56A 4AP4C 2K9XA 1E10A 4CO7A 2LUMA 1HZ5A 3VR8B 3VHTC 4FJZA 2BGFA 3K9PB 2EMSA 1Q5WB 3NS8A 1DYQA 5LXHA 3GB1A 4MM3B 2WGSA 4G11A 2RDGA 4KGSA 1S3SG 2RGFA 1JMLA 4EUTA 5G2NA 4NZLB 3DHGC
chains in the Genus database with same CATH topology
1WY8A 4IC7B 3RZWC 3ZRFA 3KUZA 4OVUA 1UD7A 2EKEC 2HTHA 3TIXA 3VUXA 3W1SA 2FAZA 3VUYA 4B9KA 4NY0A 4CYEA 4NQLB 2D2QA 1R4MI 3DBRI 2C7NB 5JHAA 4MGIE 2DYOA 5L83A 2JVCA 1UZXB 2GBKA 4PS3A 2FUHB 3NOBA 4FA6A 3EFUA 3PV1A 2JUOA 4X57B 1YD8U 4B95A 2R2OA 4JGHB 2IBIB 4AOFA 4KZ0A 3RT3B 2WYQA 3JW0X 4W9DA 1WF9A 2K25A 2L05A 3HM6X 4MJSA 4AJYB 1EUVB 2DZKA 4WWPA 3IFWB 5J2RA 3OAWA 1WI0A 2QHOA 2GMIC 4FULA 1QZEA 1YX6B 1K8RB 4W9CA 3QA8A 4BOZB 1TGZB 2D10A 2V3SA 2WWZA 1LFDA 3ZW3A 4KDLB 4NPNA 3JSVB 4LCDE 3PPAA 1H8CA 4IWQA 4EZLA 1UGMA 3HIZA 3PS6A 3W1YA 5HKHA 4KIKB 4MGYE 1XD3B 3B1LX 1NI2A 3TBLD 2MSED 3L16A 4GSWA 4HWIB 4WJNA 3U7DA 4DDID 1Y8RC 1V5OA 4URKA 4LDTB 4M8NA 3A9KA 1P3QU 2KJRA 3AU4A 2LUEA 1HE8A 2I1JA 4EZKA 2XEWA 4RM9A 2HE7A 2FCNA 2MA9B 2KVRA 4HLEA 1TTNA 3ECIA 2KX3A 1ZGUB 3PGEA 4BKGA 1V80A 4FJYA 2BWFA 2KFKB 2MBQA 2MBEA 3VUWA 3SU8X 3Q3FA 5C1ZA 2BF8B 1J0GA 2KJHB 4FJVB 3ZNHB 2C7MB 4XC2A 4MSMB 3IG3A 4HCPB 3VH4B 3A9JA 4P7IA 2GOWA 2CHXA 4IM3A 4GN1A 4PYZA 4EKUA 1WGYA 2AEHA 1E8XA 2IY0B 2DX5B 1I42A 2KZRA 1R4NI 2JF5A 1YQBA 2O6VB 4M8MA 2WX1A 3S2AA 5D6JB 3DBLI 3ZTDA 4DK5A 3PT2B 4MSQB 2BYEA 4ZRIA 2CHWA 4DDGD 3NHEB 1RRBA 4WJPA 2MP2B 3TJPA 4A3OA 5BO4B 3HK0A 4MEMA 4GDLB 1GNUA 1V2YA 1JRUA 2N1VA 3SD5A 1VCBA 3ZVVA 2PJHA 1KLVA 2K8CA 3PHWB 3RYTA 1RFAA 2KX0A 1GG3A 4GDKA 1XQQA 3L0WB 3PLVA 2I1KA 2NS5A 3TMPB 3A1QB 4HK2A 3ZTCA 4M0WB 4KVGB 3QQ8B 4GOCA 4HCNB 4DHJD 3CSTA 4RM8A 1WX9A 3PLUA 4KDIC 2MBBB 4KV2A 2KHWB 2VRRB 3DQVA 4I6PA 1V86A 2DZJA 4MDKE 5C23A 3CSFA 3IVFA 2ZVNA 1UH6A 4ANUA 1J19A 2OJRA 2V4LA 3IBEA 3EHVA 3X0WA 2ZCCA 3OLMD 3HHMA 1WE6A 3PREA 4HDQA 3M63B 1H4RA 3N32A 4IUMB 3QWZB 2KMAA 4W9KA 4DXAB 2FIDA 4BKTA 3R7QA 3B0AA 4NAWA 4G50A 2IY1B 5D7GA 1WH3A 1Q0WB 2D07B 3DVNU 3SDLC 1AARA 4N9F4 4J6IA 1ZKHA 3A4RA 3PTFC 4KSKC 1WJNA 2GBMA 4GIVA 5DPWA 3H7PB 1SIFA 3TCAA 1E8WA 4KZCA 3ZDMC 1WXVA 2DAJA 3ZIMA 2LASA 4XX5A 4WAAA 1ZW7A 2JZZA 5TR5A 3UIOB 4JL9A 2A5UA 3H1UA 2KKCA 4FHKA 3V6EB 1EO6A 4MM3A 1WMHB 2L00B 2ZEQA 2IO0B 5L95C 3NZSA 3ZLZA 2KTRB 3VQIA 4OVVA 5GMVA 2M8SA 2N7DA 2N1WA 2KLGA 3CF6E 4EOYA 3L13A 3KW5B 2MX2A 5DPSA 2ZVOA 4CHKA 1P98A 4K7SA 2C5LC 4ASWC 1G6JA 2NBVB 1P1AA 3EECA 2G45B 3RD2A 3APDA 3V61A 4HXDA 3R3MA 3QAQA 2D11A 3UQBA 2KLCA 2M1MA 3A33B 2KC1A 1A5RA 4LJOB 1WYWB 2C7HA 2M17A 3PSEB 2DZMA 2ZPNA 3QCAA 4KSLC 5E6PA 4WWOA 1FXTB 4AWJA 3DDCB 3A9KB 2BPSA 4FADA 1RLFA 3RZFA 2LRWA 1UELA 2CHZA 2PEAA 3EC8A 3KH0A 5CHVC 3WAPA 2GBNA 4E71A 2JWZA 3JSVA 2K39A 4GU2A 2L76A 5EDSA 2MBHA 3VH3B 4AJWA 4K81A 1LXDA 4FHJA 2K6QA 3DVNV 3TL5A 2K6DB 1YJ1A 2DHZA 2IYDB 3VXWA 3L17A 4K7UA 1WE7A 2FCQA 4IG7B 2ZZPB 4II2B 1KJTA 3A9JB 4YL8A 4NJ7A 3ZUNA 5JHBA 3KYDD 2N7EA 4HPLB 2XK5A 2PE9A 4ZRJA 2DZIA 3AI5A 2LZ6A 2KQSA 4MGKE 4MGZE 2KFKA 2Y5BB 1WFYA 2BYFA 1YIWA 2IZVB 5CX3A 2BYVE 2IO3B 3W1SC 1WJ6A 2Z59B 2B3AA 2G4SA 4LDTD 4TUUA 5DCNA 1F9JA 4I6NB 1GC7A 3UQAA 2KC2A 2AYOB 1WGHA 4NNJB 1UBQA 2JPHA 2MQJA 3L54A 4EEWA 2FNJB 3WANA 3ZNZB 3QK0A 5D94A 4BOSC 2RPQA 2DYBA 2O6VA 3NZUA 2N9PC 4B6WA 2R2QA 2N9EB 3BINA 5KHOA 1OEYA 3RULA 4TKNA 4ICVA 3VTWA 1WGGA 2GBRA 4WWNA 2KDFB 2NPTA 3WALA 2NR2A 2KQ7A 2A4ZA 2EMTA 4MH0E 3CMMB 2MP2A 5AEKB 3PRMB 1T0YA 3D32A 2FCSA 2GBJA 4GDLA 3KUCB 1Z2MA 2CKHB 2RD0A 4JIOU 1TZ1A 2JRIB 2KTFA 3T8MA 3M3JA 1OQYA 2KWVB 2O2VB 2RSUA 2J0MA 2ZCBA 2O6VD 1WXSA 2DENB 4FN2A 4II3B 3JYUA 3UF8A 4DWFA 4BBNC 5AZGA 3VTUA 2ZPYA 3APFA 1CMXB 4IM2A 5J18A 1E8ZA 3A1QA 3H7SA 3L08A 3ZNGC 2J0KA 5LLIA 4EFOA 3R7RA 4ZYNA 2JT4B 2G4DB 2PPHA 2MLBA 1GUAB 1RAXA 2FIFA 1EF1A 4NAWB 5CTRC 4NQKE 1OEYJ 2L0FA 4ANXA 3DVGY 2KMCA 4WJOA 4W9FA 3UGBB 5DPRA 2IO2B 2MBOA 2WX0A 3GOEA 3OJ3A 3X23A 3QJZA 3PZDA 1NDDA 2LVQA 3GZNI 2BKFA 2JY6A 1KOTA 4A3PA 3RCZA 4IM0A 4BVUC 2G3QB 2LGDA 1U4AA 2RR9A 4ANVA 3QIJA 2LWPA 3QHTA 3BY4B 1WX8A 4IW0A 4HPMB 1ISNA 1P0RA 2KXJA 1BT0A 2YVCA 3KUDB 3L10B 1IP9A 4MELA 2MCNB 4WJQA 5G55A 3ZKJC 2LD9A 2C60A 4MJSB 3WAOA 2XBBC 4IWPA 2N9XA 5IA7A 5CHFA 2L3ZA 4NJ6A 1GJZA 2CU1A 2MRPA 3AU5A 3DPDA 4TV3A 4HDOA 3ML9A 5JZEB 4I6LB 2BKRB 4EZJA 3DVGX 1MG8A 1WJUA 1WMHA 3WIMA 2M4NA 1WZ3A 2YLMA 2KWCA 3SHQA 2NBUA 4W9IA 4GB9A 1WR1A 2KOXA 1VD2A 2KDBA 2UYZB 3ZNID 2IO1B 2Z0EB 4W9LA 2REXA 2KTRA 4ANWA 4GMVA 3HM3A 1KM7A 2PE6B 2NCNA 2KFJA 3N30A 2KJ6A 3PHXB 4K1RB 3VAWA 1SE9A 1LQBA 1V9JA 2KDEB 2KN5A 4W9HA 4LJPB 1I35A 2JXXA 4DHZE 2AWTA 1V6EA 4HVBA 2JZ3B 5DPTA 3P2BA 1X1MA 2KWUB 2LVOA 4W9GA 2ASQA 2ZNVC 2HJ8A 4TQ1A 1GC6A 1WIAA 4PS8A 4KIKA 1E8YA 1S1QB 4PYUA 2DYMA 3ENEA 4K7WA 1NBFC 4WQOB 3V62A 1E90A 2L0TA 2CS4A 1OGWA 1V81A 2KD0A 2KK8A 5D2MB 3JVZX 1P9DU 2MWSB 1EF5A 2NVUI 5KHQA 2KANA 1XT9B 2K8HA 3LJ3A 2C9WB 3KYCD 2XK5B 3DBHI 4GGQA 5FR6A 2WDTB 2LXCA 4BFRA 3LDZE 1IYFA 3M95A 1E7VA 3ALBA 3M62B 1Q1OA 1LM8B 2AL3A 3AULA 3VTVA 2NBWB 5E6NA 3V6CB 3ML8A 4JLCA 3VFKA 2N4FA 1Z5SB 3MJWA 4G0NB 3PRPB 2LXAA 3Q3JA 3RUIB 3V60A 3OJ4B 2LVPA 3K9OB 3ZO5B 4DHJB 2CR5A 2BWES 2FCMA 3NY5A 3O65B 1D3ZA 2L7RA 4W9JA 5JH5C 1E5WA 4W9EA 1WGRA 3UIPB 3ZRCA 3AXCA 3N3KB 1E7UA 2M0XA 5J17A 2AL6A 4TQ0A 4BKSA 4JQWC 3H9DA 4GDKB 2K1FA 4RMAA 1WXAA 1WM2A 3VDZA 3A4SC 4A20A 4BBNF 2W9NA 3UINB 3ZDTA 3H6NA 3DOWA 2ZJDA 3DCGA 3PVLA 1M94A 1L2NA 1WM3A 2NPTB 1WX7A 1L7YA 3I3TB 3VVWB 1TBEA 2UWQA 2K8BA 2LI5A 2JRHA 1WGDA 1V5TA 4DBGA 1WJ4A 2ZNVB 2HD5B 4HJKA 3KVFB 4ZDVA 3APCA 3QARA 3B08A 1J8CA 4BKSD 2L8JA 1WZ0A 2LJ5A 3IHPC 2LRUA 3PRZA 3U8ZA 3T9LA 5AZFA 2D3GA 5E6OA 2OOBB 3MHSD 3R66C 3U30A 4FBJB 2KO3A 3C0RB 4E3CA 3MTNB 1WRDB 3QC8B 2DAFA 1C1YB 1UBIA 5AZHA 4AP4C 4CO7A 2O2VA 4GXBA 2LGXA 1WR6E 4G3XB 2LGYA 4IWOA 5CHWA 4AUQC 4F7ZA 4DHZB 1SGHA 3VHTC 4FJZA 2BGFA 2MW5A 3K9PB 3WA0A 1C3TA 4ZRKA 2EMSA 1YX5B 5LXIB 1Q5WB 3DBSA 2Z0DB 3NS8A 4F8CB 2J7QB 2KNBA 1IPGA 4PS7A 5IAAC 1OTRB 2KDIA 3WAMA 5LXHA 1WXMA 4F1SA 4E74A 2V1YA 1V49A 4G11A 2J0JA 4XZ4A 3ONSA 1S3SG 2RGFA 1PQSA 4ICUA 4EUTA 3QX1A 5G2NA 3H7PA 4FLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WY8 A;  4IC7 B;  3RZW C;  3ZRF A;  3KUZ A;  4OVU A;  1UD7 A;  2EKE C;  2HTH A;  3TIX A;  3VUX A;  3W1S A;  2FAZ A;  3VUY A;  4B9K A;  4NY0 A;  4CYE A;  4NQL B;  2D2Q A;  1R4M I;  3DBR I;  2C7N B;  5JHA A;  4MGI E;  2DYO A;  5L83 A;  2JVC A;  1UZX B;  2GBK A;  4PS3 A;  2FUH B;  3NOB A;  4FA6 A;  3EFU A;  3PV1 A;  2JUO A;  4X57 B;  1YD8 U;  4B95 A;  2R2O A;  4JGH B;  2IBI B;  4AOF A;  4KZ0 A;  3RT3 B;  2WYQ A;  3JW0 X;  4W9D A;  1WF9 A;  2K25 A;  2L05 A;  3HM6 X;  4MJS A;  4AJY B;  1EUV B;  2DZK A;  4WWP A;  3IFW B;  5J2R A;  3OAW A;  1WI0 A;  2QHO A;  2GMI C;  4FUL A;  1QZE A;  1YX6 B;  1K8R B;  4W9C A;  3QA8 A;  4BOZ B;  1TGZ B;  2D10 A;  2V3S A;  2WWZ A;  1LFD A;  3ZW3 A;  4KDL B;  4NPN A;  3JSV B;  4LCD E;  3PPA A;  1H8C A;  4IWQ A;  4EZL A;  1UGM A;  3HIZ A;  3PS6 A;  3W1Y A;  5HKH A;  4KIK B;  4MGY E;  1XD3 B;  3B1L X;  1NI2 A;  3TBL D;  2MSE D;  3L16 A;  4GSW A;  4HWI B;  4WJN A;  3U7D A;  4DDI D;  1Y8R C;  1V5O A;  4URK A;  4LDT B;  4M8N A;  3A9K A;  1P3Q U;  2KJR A;  3AU4 A;  2LUE A;  1HE8 A;  2I1J A;  4EZK A;  2XEW A;  4RM9 A;  2HE7 A;  2FCN A;  2MA9 B;  2KVR A;  4HLE A;  1TTN A;  3ECI A;  2KX3 A;  1ZGU B;  3PGE A;  4BKG A;  1V80 A;  4FJY A;  2BWF A;  2KFK B;  2MBQ A;  2MBE A;  3VUW A;  3SU8 X;  3Q3F A;  5C1Z A;  2BF8 B;  1J0G A;  2KJH B;  4FJV B;  3ZNH B;  2C7M B;  4XC2 A;  4MSM B;  3IG3 A;  4HCP B;  3VH4 B;  3A9J A;  4P7I A;  2GOW A;  2CHX A;  4IM3 A;  4GN1 A;  4PYZ A;  4EKU A;  1WGY A;  2AEH A;  1E8X A;  2IY0 B;  2DX5 B;  1I42 A;  2KZR A;  1R4N I;  2JF5 A;  1YQB A;  2O6V B;  4M8M A;  2WX1 A;  3S2A A;  5D6J B;  3DBL I;  3ZTD A;  4DK5 A;  3PT2 B;  4MSQ B;  2BYE A;  4ZRI A;  2CHW A;  4DDG D;  3NHE B;  1RRB A;  4WJP A;  2MP2 B;  3TJP A;  4A3O A;  5BO4 B;  3HK0 A;  4MEM A;  4GDL B;  1GNU A;  1V2Y A;  1JRU A;  2N1V A;  3SD5 A;  1VCB A;  3ZVV A;  2PJH A;  1KLV A;  2K8C A;  3PHW B;  3RYT A;  1RFA A;  2KX0 A;  1GG3 A;  4GDK A;  1XQQ A;  3L0W B;  3PLV A;  2I1K A;  2NS5 A;  3TMP B;  3A1Q B;  4HK2 A;  3ZTC A;  4M0W B;  4KVG B;  3QQ8 B;  4GOC A;  4HCN B;  4DHJ D;  3CST A;  4RM8 A;  1WX9 A;  3PLU A;  4KDI C;  2MBB B;  4KV2 A;  2KHW B;  2VRR B;  3DQV A;  4I6P A;  1V86 A;  2DZJ A;  4MDK E;  5C23 A;  3CSF A;  3IVF A;  2ZVN A;  1UH6 A;  4ANU A;  1J19 A;  2OJR A;  2V4L A;  3IBE A;  3EHV A;  3X0W A;  2ZCC A;  3OLM D;  3HHM A;  1WE6 A;  3PRE A;  4HDQ A;  3M63 B;  1H4R A;  3N32 A;  4IUM B;  3QWZ B;  2KMA A;  4W9K A;  4DXA B;  2FID A;  4BKT A;  3R7Q A;  3B0A A;  4NAW A;  4G50 A;  2IY1 B;  5D7G A;  1WH3 A;  1Q0W B;  2D07 B;  3DVN U;  3SDL C;  1AAR A;  4N9F 4;  4J6I A;  1ZKH A;  3A4R A;  3PTF C;  4KSK C;  1WJN A;  2GBM A;  4GIV A;  5DPW A;  3H7P B;  1SIF A;  3TCA A;  1E8W A;  4KZC A;  3ZDM C;  1WXV A;  2DAJ A;  3ZIM A;  2LAS A;  4XX5 A;  4WAA A;  1ZW7 A;  2JZZ A;  5TR5 A;  3UIO B;  4JL9 A;  2A5U A;  3H1U A;  2KKC A;  4FHK A;  3V6E B;  1EO6 A;  4MM3 A;  1WMH B;  2L00 B;  2ZEQ A;  2IO0 B;  5L95 C;  3NZS A;  3ZLZ A;  2KTR B;  3VQI A;  4OVV A;  5GMV A;  2M8S A;  2N7D A;  2N1W A;  2KLG A;  3CF6 E;  4EOY A;  3L13 A;  3KW5 B;  2MX2 A;  5DPS A;  2ZVO A;  4CHK A;  1P98 A;  4K7S A;  2C5L C;  4ASW C;  1G6J A;  2NBV B;  1P1A A;  3EEC A;  2G45 B;  3RD2 A;  3APD A;  3V61 A;  4HXD A;  3R3M A;  3QAQ A;  2D11 A;  3UQB A;  2KLC A;  2M1M A;  3A33 B;  2KC1 A;  1A5R A;  4LJO B;  1WYW B;  2C7H A;  2M17 A;  3PSE B;  2DZM A;  2ZPN A;  3QCA A;  4KSL C;  5E6P A;  4WWO A;  1FXT B;  4AWJ A;  3DDC B;  3A9K B;  2BPS A;  4FAD A;  1RLF A;  3RZF A;  2LRW A;  1UEL A;  2CHZ A;  2PEA A;  3EC8 A;  3KH0 A;  5CHV C;  3WAP A;  2GBN A;  4E71 A;  2JWZ A;  3JSV A;  2K39 A;  4GU2 A;  2L76 A;  5EDS A;  2MBH A;  3VH3 B;  4AJW A;  4K81 A;  1LXD A;  4FHJ A;  2K6Q A;  3DVN V;  3TL5 A;  2K6D B;  1YJ1 A;  2DHZ A;  2IYD B;  3VXW A;  3L17 A;  4K7U A;  1WE7 A;  2FCQ A;  4IG7 B;  2ZZP B;  4II2 B;  1KJT A;  3A9J B;  4YL8 A;  4NJ7 A;  3ZUN A;  5JHB A;  3KYD D;  2N7E A;  4HPL B;  2XK5 A;  2PE9 A;  4ZRJ A;  2DZI A;  3AI5 A;  2LZ6 A;  2KQS A;  4MGK E;  4MGZ E;  2KFK A;  2Y5B B;  1WFY A;  2BYF A;  1YIW A;  2IZV B;  5CX3 A;  2BYV E;  2IO3 B;  3W1S C;  1WJ6 A;  2Z59 B;  2B3A A;  2G4S A;  4LDT D;  4TUU A;  5DCN A;  1F9J A;  4I6N B;  1GC7 A;  3UQA A;  2KC2 A;  2AYO B;  1WGH A;  4NNJ B;  1UBQ A;  2JPH A;  2MQJ A;  3L54 A;  4EEW A;  2FNJ B;  3WAN A;  3ZNZ B;  3QK0 A;  5D94 A;  4BOS C;  2RPQ A;  2DYB A;  2O6V A;  3NZU A;  2N9P C;  4B6W A;  2R2Q A;  2N9E B;  3BIN A;  5KHO A;  1OEY A;  3RUL A;  4TKN A;  4ICV A;  3VTW A;  1WGG A;  2GBR A;  4WWN A;  2KDF B;  2NPT A;  3WAL A;  2NR2 A;  2KQ7 A;  2A4Z A;  2EMT A;  4MH0 E;  3CMM B;  2MP2 A;  5AEK B;  3PRM B;  1T0Y A;  3D32 A;  2FCS A;  2GBJ A;  4GDL A;  3KUC B;  1Z2M A;  2CKH B;  2RD0 A;  4JIO U;  1TZ1 A;  2JRI B;  2KTF A;  3T8M A;  3M3J A;  1OQY A;  2KWV B;  2O2V B;  2RSU A;  2J0M A;  2ZCB A;  2O6V D;  1WXS A;  2DEN B;  4FN2 A;  4II3 B;  3JYU A;  3UF8 A;  4DWF A;  4BBN C;  5AZG A;  3VTU A;  2ZPY A;  3APF A;  1CMX B;  4IM2 A;  5J18 A;  1E8Z A;  3A1Q A;  3H7S A;  3L08 A;  3ZNG C;  2J0K A;  5LLI A;  4EFO A;  3R7R A;  4ZYN A;  2JT4 B;  2G4D B;  2PPH A;  2MLB A;  1GUA B;  1RAX A;  2FIF A;  1EF1 A;  4NAW B;  5CTR C;  4NQK E;  1OEY J;  2L0F A;  4ANX A;  3DVG Y;  2KMC A;  4WJO A;  4W9F A;  3UGB B;  5DPR A;  2IO2 B;  2MBO A;  2WX0 A;  3GOE A;  3OJ3 A;  3X23 A;  3QJZ A;  3PZD A;  1NDD A;  2LVQ A;  3GZN I;  2BKF A;  2JY6 A;  1KOT A;  4A3P A;  3RCZ A;  4IM0 A;  4BVU C;  2G3Q B;  2LGD A;  1U4A A;  2RR9 A;  4ANV A;  3QIJ A;  2LWP A;  3QHT A;  3BY4 B;  1WX8 A;  4IW0 A;  4HPM B;  1ISN A;  1P0R A;  2KXJ A;  1BT0 A;  2YVC A;  3KUD B;  3L10 B;  1IP9 A;  4MEL A;  2MCN B;  4WJQ A;  5G55 A;  3ZKJ C;  2LD9 A;  2C60 A;  4MJS B;  3WAO A;  2XBB C;  4IWP A;  2N9X A;  5IA7 A;  5CHF A;  2L3Z A;  4NJ6 A;  1GJZ A;  2CU1 A;  2MRP A;  3AU5 A;  3DPD A;  4TV3 A;  4HDO A;  3ML9 A;  5JZE B;  4I6L B;  2BKR B;  4EZJ A;  3DVG X;  1MG8 A;  1WJU A;  1WMH A;  3WIM A;  2M4N A;  1WZ3 A;  2YLM A;  2KWC A;  3SHQ A;  2NBU A;  4W9I A;  4GB9 A;  1WR1 A;  2KOX A;  1VD2 A;  2KDB A;  2UYZ B;  3ZNI D;  2IO1 B;  2Z0E B;  4W9L A;  2REX A;  2KTR A;  4ANW A;  4GMV A;  3HM3 A;  1KM7 A;  2PE6 B;  2NCN A;  2KFJ A;  3N30 A;  2KJ6 A;  3PHX B;  4K1R B;  3VAW A;  1SE9 A;  1LQB A;  1V9J A;  2KDE B;  2KN5 A;  4W9H A;  4LJP B;  1I35 A;  2JXX A;  4DHZ E;  2AWT A;  1V6E A;  4HVB A;  2JZ3 B;  5DPT A;  3P2B A;  1X1M A;  2KWU B;  2LVO A;  4W9G A;  2ASQ A;  2ZNV C;  2HJ8 A;  4TQ1 A;  1GC6 A;  1WIA A;  4PS8 A;  4KIK A;  1E8Y A;  1S1Q B;  4PYU A;  2DYM A;  3ENE A;  4K7W A;  1NBF C;  4WQO B;  3V62 A;  1E90 A;  2L0T A;  2CS4 A;  1OGW A;  1V81 A;  2KD0 A;  2KK8 A;  5D2M B;  3JVZ X;  1P9D U;  2MWS B;  1EF5 A;  2NVU I;  5KHQ A;  2KAN A;  1XT9 B;  2K8H A;  3LJ3 A;  2C9W B;  3KYC D;  2XK5 B;  3DBH I;  4GGQ A;  5FR6 A;  2WDT B;  2LXC A;  4BFR A;  3LDZ E;  1IYF A;  3M95 A;  1E7V A;  3ALB A;  3M62 B;  1Q1O A;  1LM8 B;  2AL3 A;  3AUL A;  3VTV A;  2NBW B;  5E6N A;  3V6C B;  3ML8 A;  4JLC A;  3VFK A;  2N4F A;  1Z5S B;  3MJW A;  4G0N B;  3PRP B;  2LXA A;  3Q3J A;  3RUI B;  3V60 A;  3OJ4 B;  2LVP A;  3K9O B;  3ZO5 B;  4DHJ B;  2CR5 A;  2BWE S;  2FCM A;  3NY5 A;  3O65 B;  1D3Z A;  2L7R A;  4W9J A;  5JH5 C;  1E5W A;  4W9E A;  1WGR A;  3UIP B;  3ZRC A;  3AXC A;  3N3K B;  1E7U A;  2M0X A;  5J17 A;  2AL6 A;  4TQ0 A;  4BKS A;  4JQW C;  3H9D A;  4GDK B;  2K1F A;  4RMA A;  1WXA A;  1WM2 A;  3VDZ A;  3A4S C;  4A20 A;  4BBN F;  2W9N A;  3UIN B;  3ZDT A;  3H6N A;  3DOW A;  2ZJD A;  3DCG A;  3PVL A;  1M94 A;  1L2N A;  1WM3 A;  2NPT B;  1WX7 A;  1L7Y A;  3I3T B;  3VVW B;  1TBE A;  2UWQ A;  2K8B A;  2LI5 A;  2JRH A;  1WGD A;  1V5T A;  4DBG A;  1WJ4 A;  2ZNV B;  2HD5 B;  4HJK A;  3KVF B;  4ZDV A;  3APC A;  3QAR A;  3B08 A;  1J8C A;  4BKS D;  2L8J A;  1WZ0 A;  2LJ5 A;  3IHP C;  2LRU A;  3PRZ A;  3U8Z A;  3T9L A;  5AZF A;  2D3G A;  5E6O A;  2OOB B;  3MHS D;  3R66 C;  3U30 A;  4FBJ B;  2KO3 A;  3C0R B;  4E3C A;  3MTN B;  1WRD B;  3QC8 B;  2DAF A;  1C1Y B;  1UBI A;  5AZH A;  4AP4 C;  4CO7 A;  2O2V A;  4GXB A;  2LGX A;  1WR6 E;  4G3X B;  2LGY A;  4IWO A;  5CHW A;  4AUQ C;  4F7Z A;  4DHZ B;  1SGH A;  3VHT C;  4FJZ A;  2BGF A;  2MW5 A;  3K9P B;  3WA0 A;  1C3T A;  4ZRK A;  2EMS A;  1YX5 B;  5LXI B;  1Q5W B;  3DBS A;  2Z0D B;  3NS8 A;  4F8C B;  2J7Q B;  2KNB A;  1IPG A;  4PS7 A;  5IAA C;  1OTR B;  2KDI A;  3WAM A;  5LXH A;  1WXM A;  4F1S A;  4E74 A;  2V1Y A;  1V49 A;  4G11 A;  2J0J A;  4XZ4 A;  3ONS A;  1S3S G;  2RGF A;  1PQS A;  4ICU A;  4EUT A;  3QX1 A;  5G2N A;  3H7P A;  4FLH A; 
#chains in the Genus database with same CATH topology
 1WY8 A;  4YT0 B;  3KUZ A;  1VDV A;  2HTH A;  3VUX A;  1F2R I;  1KLU D;  1R4M I;  3DBR I;  5EE0 A;  4MGI E;  3AE8 B;  2FUH B;  1YD8 U;  4B95 A;  2R2O A;  1FNU A;  2WYQ A;  3JW0 X;  3IAS 1;  4MJS A;  2DZK A;  2OJW A;  1WI0 A;  2GMI C;  1QZE A;  1PGA A;  3AEG B;  3QA8 A;  2W82 A;  1TGZ B;  2BBC A;  2B76 B;  3ZW3 A;  3B2G A;  4YTP B;  3JSV B;  1M4V A;  4KIK B;  4MGY E;  1XD3 B;  2CJN A;  4GSW A;  1L4Z B;  4US8 A;  4C4V A;  3DWG C;  1FEH A;  3AU4 A;  2LUE A;  2I1J A;  2PMV A;  2AQ2 B;  2WU2 B;  1XCQ L;  2KMM A;  1TTN A;  3I9V 1;  4BKG A;  1L0V B;  1YN4 A;  1V80 A;  3I5J C;  5D3D A;  1L0X B;  3VUW A;  1V8C A;  4LNI A;  5IN7 A;  3IG3 A;  3A9J A;  1D5M C;  4IM3 A;  4WH4 A;  1E0Z A;  1WGY A;  2AEH A;  1QOB A;  1R4N I;  2JF5 A;  2J42 A;  5HG2 A;  1BUI C;  1YMH E;  3DBL I;  4ZRI A;  4L2Y A;  2KWD A;  2WXL A;  2INC C;  4N59 A;  1SF0 A;  1IBX A;  1GNU A;  1JRU A;  4MT5 A;  2DWQ A;  1VCB A;  1KLV A;  4GDK A;  1GG3 A;  4ARC A;  4ARI A;  1SIJ A;  3L0W B;  2I1K A;  4M0W B;  4MH8 A;  3QQ8 B;  3CST A;  3PLU A;  1ZPS A;  4KV2 A;  2KHW B;  1CK1 A;  2VRR B;  3DQV A;  4I6P A;  1V86 A;  2DZJ A;  4LNO A;  4MDK E;  5FR3 A;  2WDV B;  3W5U B;  1UH6 A;  3IBE A;  3HHM A;  3PRE A;  4HRS A;  4DXG A;  1H4R A;  1SJE D;  1SE2 A;  4DXA B;  3B0A A;  4G50 A;  1Q0W B;  4N9F 4;  2EKI A;  3PTF C;  1WJN A;  5EE3 A;  3TCA A;  1T3Q A;  4KZC A;  4AS1 A;  2LAS A;  3U52 E;  4XX5 A;  2Y5P A;  5TR5 A;  4UDU C;  3UIO B;  2A5U A;  3H1U A;  1EO6 A;  3Q8A A;  2ZEQ A;  3P63 A;  3NZS A;  3ZLZ A;  3VQI A;  4OVV A;  1KLG D;  2N1W A;  3CF6 E;  4EOY A;  3KW5 B;  5DPS A;  2ZVO A;  2ICI A;  3P42 A;  3RD2 A;  4N58 A;  1JAL A;  2D11 A;  5BYR A;  1I4G A;  4JWS C;  2IGD A;  1WYW B;  1J7A A;  2DZM A;  2ZPN A;  3FKY A;  4KSL C;  1FXT B;  3DDC B;  2IGG A;  2BPS A;  1RLF A;  2UU7 A;  1UEL A;  3WAP A;  2K39 A;  4RGT A;  4AJW A;  3VH3 B;  1LXD A;  3P1M A;  3ZJT A;  3HVZ A;  1ENF A;  2IYD B;  3NJT A;  3VXW A;  5IP4 D;  4WUR A;  2M19 A;  1KRH A;  2IND C;  2N7E A;  4HPL B;  2DZI A;  3AI5 A;  3I63 C;  3ZGZ A;  2LZ6 A;  2QJL A;  1FO4 A;  3LXF A;  2Z59 B;  2G4S A;  4TUU A;  4YTM B;  2HDE A;  2IDY A;  4I6N B;  3AE4 B;  4IKG A;  2JPH A;  3WAN A;  4BOS C;  2O6V A;  4B6W A;  2R2Q A;  3BIN A;  1JWU D;  3SR6 A;  2GBR A;  3B2F A;  2NR2 A;  2A4Z A;  3CMM B;  2MP2 A;  3PRM B;  4NJC A;  1VZ6 A;  5GXG B;  3Q6B A;  1TS5 A;  4GDL A;  3KUC B;  2JWU A;  3EA6 A;  1TZ1 A;  2VH2 A;  3M3J A;  2KWV B;  3RPF C;  4FN2 A;  4ZYS A;  3UF8 A;  4BBN C;  1I4P A;  3VTU A;  3APF A;  1CMX B;  1LGR A;  1E8Z A;  5LLI A;  4EFO A;  2JT4 B;  2MLB A;  3W2D A;  1GUA B;  2Y3A A;  1TT5 B;  2WXK A;  1SSN A;  3EFC A;  1OEY J;  2MJ3 A;  4NQK E;  2KMC A;  4WJO A;  4W9F A;  5HI1 A;  3GOE A;  3OJ3 A;  3X23 A;  1JWB D;  2JZP A;  1YQ4 B;  2JY6 A;  4A3P A;  2OED A;  4XYC A;  4RFB A;  4BVU C;  2LGD A;  1PFD A;  3AN1 A;  4IW0 A;  5AUK A;  1BT0 A;  3L10 B;  3UI3 A;  4WJQ A;  5G55 A;  4MJS B;  2C60 A;  3WAO A;  1V97 A;  5CHF A;  4TV3 A;  1F52 A;  4O1N A;  2QSD A;  3DVG X;  1MG8 A;  1WJU A;  1WMH A;  4RH6 A;  1WZ3 A;  1WXQ A;  4W9I A;  4GB9 A;  1WR1 A;  4A9A A;  2N9L A;  2Z0E B;  2L1A A;  2REX A;  1TY0 A;  4GMV A;  1XF5 L;  3HM3 A;  2KYW A;  3ZQ4 A;  3ETR A;  1SE9 A;  1T0S C;  1V9J A;  2KAC A;  4W9H A;  3RMK C;  5I4D A;  2JZ3 B;  4W9G A;  2ASQ A;  4XWT A;  5HHD G;  2ZNV C;  1WIA A;  4KIK A;  4K7W A;  3V62 A;  1OGW A;  2K8H A;  1Q10 A;  2SEB D;  1C9F A;  3DBH I;  5FR6 A;  5BYQ A;  3Q2A C;  1IYF A;  2GLS A;  1Q1O A;  3VTV A;  2NBW B;  3AEB B;  5E6N A;  3V6C B;  1Z5S B;  3MJW A;  1JRP A;  4ZRQ A;  2LVP A;  2Z8L A;  1D3Z A;  4W9J A;  5JH5 C;  1E5W A;  3UIP B;  2I2Y A;  3AEF B;  3AXC A;  2WNM A;  2M0X A;  4RF0 A;  2AL6 A;  1GB4 A;  3BVG A;  4GDK B;  1WXA A;  3VDZ A;  1ACC A;  2AX5 A;  1VR9 A;  2W9N A;  5AUI A;  3H6N A;  4BAX A;  3VRA B;  3BVZ A;  2UWQ A;  2X38 A;  3N1Z C;  1TS2 A;  5EE1 A;  1V5T A;  4B0E A;  1WJ4 A;  2ZNV B;  2HD5 B;  2K5P A;  4BKS D;  5D3I B;  2L8J A;  3Q8C A;  2LJ5 A;  3SEB A;  3IHP C;  3KLS X;  3MHS D;  4RF1 A;  4ACF A;  1B9R A;  2PVG C;  4HKQ A;  1FIQ A;  2W3S A;  4HPP A;  1WR6 E;  2LGY A;  2DNF A;  1SGH A;  3WA0 A;  1C3T A;  4ZRK A;  1YX5 B;  5LXI B;  2KNB A;  4KGT A;  1D5X C;  1OTR B;  3MFG A;  4E74 A;  1V49 A;  1PQS A;  2PIA A;  1ET6 A;  1V1O A;  1UD7 A;  3OWE B;  3URY A;  1RWS A;  3HUI A;  4OHJ A;  3MP9 A;  2OHF A;  3DBR B;  2DYO A;  2GBK A;  3NOB A;  2Y5C A;  2N7J A;  1WWT A;  4JGH B;  3T3O A;  4PK1 A;  1WF9 A;  2L05 A;  4XDC A;  2QHO A;  1N60 A;  1YX6 B;  1K8R B;  4W9C A;  4M00 A;  3AE5 B;  3PPA A;  1ESF A;  2MSE D;  3L16 A;  4HWI B;  1VJK A;  3U4E G;  4A6Q A;  2KJR A;  2WDQ B;  1HE8 A;  3N1Y C;  2XEW A;  4RM9 A;  4OZB A;  1I7H A;  2FCN A;  2KVR A;  3ZJU A;  1ZGU B;  1TJE A;  1PGX A;  3SU8 X;  3RFZ B;  3FIL B;  5C1Z A;  1J0G A;  2JSV X;  3KWL A;  3ZNH B;  2C7M B;  4XC2 A;  3NUH B;  1E8X A;  1I42 A;  2RPV A;  2KZR A;  3ZYY X;  4HEA 1;  1YQB A;  2O6V B;  4M8M A;  1CQV A;  1TKY A;  3BII D;  4MSQ B;  3DBL B;  4DDG D;  3BK2 A;  1MHH E;  1RRB A;  4P16 A;  4WJP A;  2MP2 B;  3TJP A;  5BO4 B;  1FRR A;  4GDL B;  1V2Y A;  3SD5 A;  4M01 A;  3ZVV A;  4S17 A;  2K8C A;  3PHW B;  2KX0 A;  4AQ7 A;  1JW9 D;  1XQQ A;  3PLV A;  2J4X A;  3TMP B;  1YN5 A;  4M02 A;  3AB5 A;  3LYY A;  2W54 A;  3RN9 C;  2MBB B;  2DLB A;  4OZC A;  3CSF A;  1KF6 B;  3GE3 C;  3X0W A;  2BT6 A;  5FK9 C;  3OLM D;  1WE6 A;  4C7Y A;  3M63 B;  3N32 A;  1A70 A;  1QF6 A;  2JXT A;  2PVO D;  2M56 B;  5BMH A;  1TS3 A;  1RFK A;  1AAR A;  4IDI A;  3BYT B;  3A4R A;  2GBM A;  3H7P B;  1XXG A;  1E8W A;  1ZW7 A;  2AQ1 B;  4YSY B;  3W9C B;  4FHK A;  3U2S C;  4A55 A;  1WMH B;  3SFE B;  2LGI A;  2Q5W D;  1QOG A;  2MX2 A;  4TMA B;  3RNF C;  2C5L C;  4ASW C;  2VZK B;  2G45 B;  1UUP A;  1J7C A;  3UQB A;  2KLC A;  2M1M A;  4REZ A;  1MFW A;  2L52 A;  1A5R A;  4LJO B;  5H92 C;  4KX6 B;  4ZHO A;  4OVZ A;  2M17 A;  4YXD B;  5E6P A;  3MHZ A;  3A9K B;  2LRW A;  2CHZ A;  3I57 A;  3KH0 A;  5CHV C;  2WXN A;  1ZUD 2;  3CIR B;  5EDS A;  4OW0 A;  4YSX B;  2GB1 A;  3TL5 A;  2I38 A;  2IGH A;  3ZXR A;  4II2 B;  5JHB A;  2D3C A;  2PE9 A;  1YJI A;  2PLP A;  4C80 A;  4MGK E;  1WFY A;  2VH1 A;  5CX3 A;  2BYV E;  5DCN A;  2FBW B;  1ZP0 B;  2D5G A;  4EEW A;  4EE2 A;  5D94 A;  1FXA A;  2N9P C;  1N62 A;  5KHO A;  3R8B A;  4TKN A;  4ICV A;  3TUO A;  1FFU A;  4WWN A;  2KQ7 A;  1T0Y A;  3D32 A;  2FCS A;  2GBJ A;  2CKH B;  3WCQ A;  2RSU A;  2O6V D;  2DEN B;  4LTU A;  4DWF A;  2BS4 B;  2ZPY A;  4IM2 A;  3H7S A;  2MEK A;  3ZNG C;  4ZYN A;  1RAX A;  3E56 A;  3MC0 B;  5EE9 A;  5CTR C;  2WXQ A;  4ANX A;  1L5P A;  3DVG Y;  1C77 A;  4S0R A;  2X8X X;  4JE3 B;  2MBO A;  1K53 A;  3IXS A;  2LVQ A;  3AE3 B;  4ANV A;  1FNW A;  1J7B A;  1WX8 A;  3BY4 B;  2KXJ A;  1P0R A;  2WXF A;  2YVC A;  2MCN B;  1FD6 A;  3ZKJ C;  4IWP A;  4RNA A;  4NJ6 A;  1TY2 A;  2BW2 A;  3N9Y C;  2KQ4 X;  3AU5 A;  3DPD A;  3ML9 A;  3WIM A;  3N1X C;  2ONQ A;  2KWC A;  2YLM A;  4K3C A;  1F0Z A;  2UYZ B;  1MVK A;  1SE4 A;  2KDB A;  2KTR A;  1D5Z C;  4ANW A;  1KM7 A;  2RDH A;  2KFJ A;  2QIL A;  2KDE B;  4LJP B;  1I35 A;  2AWT A;  5DPT A;  3P2B A;  1X1M A;  2KWU B;  2LVO A;  1ZDV A;  2HJ8 A;  4TQ1 A;  1F77 A;  2DYM A;  3NVZ A;  1E7P B;  1R7S A;  2L0T A;  2KD0 A;  2KK8 A;  2MWS B;  1EF5 A;  2VZK D;  1MHX A;  1NEN B;  3KYC D;  5BMG A;  2LXC A;  3DBH B;  4BFR A;  3LDZ E;  3M95 A;  3M62 B;  1YJJ A;  3AUL A;  3FIL A;  2NTS A;  3VFK A;  2N4F A;  3PRP B;  2JQR B;  3Q3J A;  4K3B A;  2NTT A;  4DHJ B;  2BWE S;  3O65 B;  2BB5 A;  1WGR A;  3ZRC A;  5J17 A;  1I4H A;  1RM6 C;  4JQW C;  3U7Z A;  1XLO A;  4RMA A;  3A4S C;  3FC4 A;  4BBN F;  1C4P A;  3ZDT A;  3EUB 2;  2ZJD A;  5IKC M;  1WM3 A;  1BXT A;  1NI3 A;  2QC8 A;  3I3T B;  4Q2J A;  2JRH A;  5JXV A;  1YOV B;  4ZDV A;  3QAR A;  1ET9 A;  3PRZ A;  3U8Z A;  3RNB C;  3T9L A;  2D3G A;  2MHJ A;  3C0R B;  3MTN B;  2D3B A;  2DAF A;  5AZH A;  2O2V A;  4GXB A;  1EU3 A;  4WAF A;  4G3X B;  5CHW A;  1MJD A;  4IWO A;  2LFI A;  2MW5 A;  1L0Y B;  4NAM A;  1IPG A;  4PS7 A;  5IAA C;  3DWM A;  2V1Y A;  4LNF A;  4XZ4 A;  4ICU A;  3ZXV A;  3QX1 A;  4QAY A;  3H7P A;  4FLH A;  2EEL A;  3RZW C;  3ZRF A;  1MG4 A;  4OVU A;  2EKE C;  1L4D B;  1KFY B;  3TIX A;  1TKE A;  3VUY A;  4NY0 A;  4NQL B;  2D2Q A;  3AEE B;  1ZDX A;  1STE A;  5JHA A;  1JWA D;  1UZX B;  3NVW A;  1HA5 A;  3AV8 A;  4FA6 A;  3PV1 A;  2JUO A;  4X57 B;  4AOF A;  3SFD B;  3J9C A;  2K25 A;  3HM6 X;  3P4R B;  4WWP A;  5T8I A;  3OAW A;  4RCO A;  1FRD A;  4FUL A;  4JPS A;  4BOZ B;  2WWZ A;  1LFD A;  3CWI A;  3AMZ A;  2L32 A;  4US9 A;  1H8C A;  4IWQ A;  1UGM A;  3HIZ A;  3PS6 A;  3W1Y A;  4C56 C;  1NI2 A;  1XLN A;  3U7D A;  3R2T A;  1EWY C;  4DDI D;  1SBB B;  4URK A;  4JX1 C;  3A9K A;  3B9J A;  1DGJ A;  1P3Q U;  4EZK A;  2HE7 A;  2MA9 B;  1PDX A;  3V05 A;  4HLE A;  3ECI A;  4FJY A;  2BWF A;  3NRZ A;  1XEE A;  1YQ3 B;  3AEA B;  3Q3F A;  1GAQ B;  3TEY A;  2ACZ B;  4MSM B;  4P7I A;  2GOW A;  2KN4 A;  2H89 B;  4PYZ A;  4XGA B;  4YTN B;  3Q3M C;  4C00 A;  3AED B;  1N61 A;  1FFV A;  3HVD A;  2WX1 A;  1TYG B;  3S2A A;  1NEK B;  5D6J B;  3ZTD A;  4TSS A;  4DK5 A;  2V3P A;  2BYE A;  4KKJ A;  1C78 A;  1VLB A;  3NHE B;  4A3O A;  2KVZ A;  3ZJV A;  1PUT A;  2E3T A;  2N1V A;  1WGK A;  2J53 A;  1RFA A;  2HJ1 A;  4KKI A;  3NVY A;  3ZTC A;  4GOC A;  4DHJ D;  4RM8 A;  1N5W A;  1K52 A;  1TS4 A;  2QIE B;  5C23 A;  3IVF A;  2ZVN A;  1J19 A;  2MH7 A;  3EHV A;  3TEX A;  4HDQ A;  3VRB B;  2D3A A;  2IJ0 A;  1BML C;  4L23 A;  2IY1 B;  1P7E A;  3P4P B;  5D7G A;  1WH3 A;  3SDL C;  2D07 B;  3DVN U;  4J6I A;  1ZKH A;  5G5H A;  4GIV A;  2J52 A;  2PKO A;  5DPW A;  1SIF A;  1WXV A;  5TSS A;  2DAJ A;  3ZIM A;  4WAA A;  3GZN B;  2YEP B;  2KKC A;  3V6E B;  2BTE A;  2L00 B;  2N9K A;  4C7Z A;  3MC9 A;  3AM9 A;  2KTR B;  3GS2 A;  5GMV A;  2KT7 A;  2KLG A;  3L13 A;  1L6U A;  5MPO A;  1G6J A;  1P98 A;  4K7S A;  2NBV B;  1P1A A;  3V61 A;  4HXD A;  1XLP A;  3R3M A;  3QAQ A;  3A33 B;  2KC1 A;  1HXY D;  3Q8F A;  1ZOY B;  1VZ8 A;  3QCA A;  1XCT L;  4WQM A;  4FAD A;  3EC8 A;  3VR9 B;  2PEA A;  2GBN A;  4E71 A;  2MJD A;  4GU2 A;  2L76 A;  4GLS C;  3MC8 A;  2WQY B;  3BYY B;  4FHJ A;  3TEW A;  2DHZ A;  4DQO C;  3Q3N C;  3GE8 C;  1WE7 A;  4K7U A;  3PZ7 A;  1KJT A;  2LMC A;  4YL8 A;  1V1P A;  4NJ7 A;  3KYD D;  4ZRJ A;  2KQS A;  3P4Q B;  2KFK A;  2JU6 X;  2Y5B B;  1YIW A;  2IZV B;  2SAK A;  2IO3 B;  2B3A A;  1XLQ A;  3LB8 C;  1N63 A;  5IOI A;  1AN8 A;  1F9J A;  2G9H D;  1GC7 A;  3UQA A;  4NNJ B;  4N6E B;  2MQJ A;  3L54 A;  2FNJ B;  5FKA C;  1WRI A;  2RPQ A;  2DYB A;  4LNN A;  3RUL A;  1AWD A;  2N0S B;  2KDF B;  3WAL A;  4WIP A;  2V3N A;  4MH0 E;  2RD0 A;  2JRI B;  1FNV A;  2KTF A;  3T8M A;  1OQY A;  2WXR A;  1C79 A;  1UF0 A;  2O2V B;  2ZCB A;  1WXS A;  4CQN A;  1E9M A;  3A1Q A;  2RMM A;  3L08 A;  2J0K A;  1EF1 A;  4NAW B;  2L0F A;  5BMI A;  5DPR A;  2IO2 B;  2K0P A;  2WX0 A;  3QJZ A;  3PZD A;  3GZN I;  3RNC C;  2BS2 B;  2WXI A;  1KOT A;  1MI0 A;  4P1C C;  3RCZ A;  4IM0 A;  2MJE A;  2G3Q B;  1U4A A;  3QIJ A;  4HPM B;  1ISN A;  3KUD B;  4MEL A;  1YN3 A;  5LNK 1;  2LD9 A;  2XBB C;  1GJZ A;  2CU1 A;  2MRP A;  1XO3 A;  3IAM 1;  5JZE B;  1T0R C;  4I6L B;  3AE9 B;  4J3O D;  4EZJ A;  1JCK B;  2M4N A;  2KOX A;  1VD2 A;  3ZNI D;  3N30 A;  4K1R B;  2KJ6 A;  3PHX B;  1UNS A;  2KN5 A;  2JXX A;  3BWU D;  2WLB A;  4PS8 A;  4HRO A;  1FCC C;  1QLB B;  1E8Y A;  1S1Q B;  1JWM D;  1NBF C;  1UGJ A;  2WXH A;  4WQO B;  1E90 A;  2CS4 A;  1MPE A;  5D2M B;  3JVZ X;  3C8Y A;  5BYS A;  1AW7 A;  3LJ3 A;  2C9W B;  2AQ3 B;  1ZXH A;  2XK5 B;  4GGQ A;  3Q14 C;  2H88 B;  4H2A A;  1E7V A;  2AL3 A;  4IOI E;  1T0Q C;  3ML8 A;  3Q8E A;  3OJ4 B;  3PZ8 A;  3K9O B;  2CR5 A;  1TIF A;  4RGM A;  2L7R A;  1E7U A;  1N5X A;  1GOZ A;  1CZP A;  4A90 A;  1OFF A;  1D4B A;  1DOX A;  3R2I A;  2XN9 C;  1L2N A;  2NPT B;  3N20 C;  1D6E C;  1L7Y A;  1WX7 A;  1TBE A;  3DHI C;  2K8B A;  2LI5 A;  1WGD A;  4DBG A;  2WXG A;  2K22 A;  3APC A;  3B08 A;  1I4X A;  4JWU C;  3RI7 C;  3AE6 B;  2KAJ A;  1PGB A;  3QC8 B;  3E9S A;  2LGX A;  4AUQ C;  4F7Z A;  4DHZ B;  4LK0 M;  1HQR D;  1T6B X;  3OG5 A;  3DBS A;  4R3D A;  2Z0D B;  4F8C B;  2J7Q B;  2WP9 B;  2KDI A;  3WAM A;  1WXM A;  4F1S A;  2WU5 B;  2J0J A;  2GI9 A;  3ONS A;  4HDO A;  3TBL D;  4IC7 B;  2LHD A;  3W1S A;  4B9K A;  2FAZ A;  4CYE A;  3V3X A;  2C7N B;  2GRI A;  5E6J A;  5L83 A;  2JVC A;  4PS3 A;  3EFU A;  2IBI B;  4KZ0 A;  4L1B A;  3RT3 B;  4W9D A;  1SXT A;  4AJY B;  1EUV B;  3IFW B;  5J2R A;  1UWM A;  2D10 A;  2V3S A;  4KDL B;  4NPN A;  4LCD E;  4EZL A;  5HKH A;  3B1L X;  3GP7 A;  2JX5 A;  4WJN A;  1Y8R C;  3FAH A;  1V5O A;  4LDT B;  4M8N A;  2CJO A;  4WWM A;  1FPY A;  1V1P B;  2QEJ C;  2KX3 A;  3PGE A;  2G1E A;  2WHI A;  2KFK B;  2MBQ A;  2MBE A;  1NVI D;  2BF8 B;  2KJH B;  4FJV B;  3KWV A;  2BYT A;  4HCP B;  3VH4 B;  2CHX A;  3DHH C;  4GN1 A;  1VRA B;  2WXM A;  4EKU A;  2IY0 B;  2DX5 B;  3C19 A;  2ZW1 A;  2HTM E;  1SE3 A;  3PT2 B;  3NS1 A;  1OQR A;  2CHW A;  4USA A;  1FMA D;  1SB3 C;  3HK0 A;  3BVM A;  4MEM A;  1C4A A;  2R61 A;  2PJH A;  3RYT A;  3W5V B;  2PTL A;  1NYR A;  2NS5 A;  3A1Q B;  4HK2 A;  4KVG B;  1CJE A;  3IT6 B;  4HCN B;  1WX9 A;  4KDI C;  2KDM A;  4RGO S;  2LEK A;  3BK1 A;  2BB6 A;  4ANU A;  1QKZ A;  2OJR A;  2V4L A;  1NYQ A;  2ZCC A;  3BZD B;  4IUM B;  3QWZ B;  2KMA A;  4W9K A;  2FID A;  4BKT A;  1HEZ E;  3R7Q A;  4NAW A;  2WS3 B;  4XE0 A;  4HKZ E;  2JYT A;  2WXJ A;  4KSK C;  5HFY A;  3ZDM C;  5G5G A;  2E6X A;  3NZ3 A;  2JZZ A;  3ABV B;  4JL9 A;  1FXI A;  2FUG 1;  4MM3 A;  3AE1 B;  5IO9 A;  2IO0 B;  5L95 C;  2JYE A;  2M8S A;  2N7D A;  4P1B C;  3AE2 B;  1JRO A;  4CHK A;  1F1H A;  3EEC A;  4MAC A;  2NMQ A;  3APD A;  4A8X C;  1P7F A;  1QOA A;  4DXF A;  4B0M A;  4YSZ B;  2C7H A;  3AEC B;  3PSE B;  1SJH D;  1IGC A;  4WWO A;  4C4V B;  1HTQ A;  4AWJ A;  2ZW0 A;  2WXO A;  3RZF A;  1FM0 D;  3TEZ A;  2JWZ A;  3JSV A;  2MBH A;  4K81 A;  2LJI A;  2FE8 A;  2K6Q A;  3DVN V;  2K6D B;  1YJ1 A;  3L17 A;  2YEP F;  2FCQ A;  4IG7 B;  2ZZP B;  4FXC A;  3A9J B;  3ZUN A;  2XK5 A;  1E6E B;  1KH0 A;  4MGZ E;  2BYF A;  3W1S C;  1WJ6 A;  1I4R A;  1WYG A;  2DBY A;  2V9H A;  4LDT D;  3AE7 B;  4YWG G;  2KC2 A;  3RNG C;  2AYO B;  4P6V F;  1WGH A;  1UBQ A;  2BS3 B;  3ZNZ B;  3EGR A;  3QK0 A;  1IBX B;  4ITK A;  3NZU A;  4HJG E;  3H8H A;  1B1Z A;  2N9E B;  2INP E;  1OEY A;  1OQQ A;  3VTW A;  1F2R C;  1WGG A;  2NPT A;  2EMT A;  5AEK B;  2PW9 A;  1HZ6 A;  1Z2M A;  4JIO U;  3KQ4 A;  1QQR A;  2CU3 A;  2INN E;  2J0M A;  3Q3O C;  4II3 B;  3JYU A;  1N6Z A;  1K50 A;  5AZG A;  5J18 A;  3IT4 B;  1SEB D;  1FCL A;  3Q8B A;  1ZXI A;  4M0W A;  3PO0 A;  3R7R A;  2PPH A;  2G4D B;  1DOY A;  2FIF A;  5C2T B;  3UGB B;  1C76 A;  2V0G A;  1EM7 A;  1NDD A;  2BKF A;  3RNA C;  3T3N A;  1GB1 A;  1EU4 A;  4XWW A;  2RR9 A;  3HRD D;  2LWP A;  3QHT A;  1T5X D;  1IP9 A;  3O13 A;  1LO5 D;  1IUE A;  1WSP A;  2N9X A;  5IA7 A;  2L3Z A;  1JWS D;  1AYF A;  1RYJ A;  2XNA C;  1L6V A;  1ZE3 D;  2BKR B;  1R4M B;  4PT5 A;  3SHQ A;  2NBU A;  1VZ7 A;  4ZHP A;  1QOF A;  2LGS A;  2IO1 B;  4W9L A;  3Q69 A;  2PE6 B;  2NCN A;  4D2K A;  3VAW A;  1LQB A;  1HTO A;  3AH7 A;  4DHZ E;  4HVB A;  1V6E A;  4XDD A;  3NG0 A;  1YNT E;  2BVC A;  2QMT A;  3TSS A;  1GC6 A;  2WDR B;  4PYU A;  3ENE A;  1TKG A;  1GPX A;  4ZOH C;  1DOI A;  1V81 A;  1I4Q A;  1P9D U;  2NVU I;  5KHQ A;  2KAN A;  2QCZ A;  1XT9 B;  4RGN A;  2WDT B;  4LNK A;  2LHE A;  2W3R A;  2V4I B;  3ALB A;  1LM8 B;  4JLC A;  3P4S B;  3MJ5 A;  4G0N B;  1QT9 A;  2IPK D;  2LXA A;  1EWC A;  4LLG M;  3RUI B;  3V60 A;  3ZO5 B;  2FCM A;  3NY5 A;  5H8Y E;  2L83 A;  4OZA A;  4W9E A;  1JQ4 A;  1K51 A;  1C4C A;  3N3K B;  1PYW D;  1R4N B;  4TQ0 A;  4BKS A;  3H9D A;  2K1F A;  1WM2 A;  2WXP A;  2ON8 A;  4A20 A;  2RDB C;  1ROE A;  3UIN B;  1IGD A;  3DOW A;  2TSS A;  3DCG A;  3PVL A;  1M94 A;  4ZRP A;  1UWX A;  3VVW B;  1KTK A;  2BQQ A;  1TZO A;  2QDF A;  2W55 A;  4HJK A;  3KVF B;  2M0A A;  1QIL A;  2K3U A;  3L4P A;  1J8C A;  4BZA A;  1WZ0 A;  2LRU A;  3RNE C;  5AZF A;  5E6O A;  2OOB B;  3R66 C;  3U30 A;  4KGR A;  2KO3 A;  4FBJ B;  4E3C A;  3NVV A;  1WRD B;  1C1Y B;  1UBI A;  5C3J B;  1Y56 A;  4AP4 C;  2K9X A;  1E10 A;  4CO7 A;  2LUM A;  1HZ5 A;  3VR8 B;  3VHT C;  4FJZ A;  2BGF A;  3K9P B;  2EMS A;  1Q5W B;  3NS8 A;  1DYQ A;  5LXH A;  3GB1 A;  4MM3 B;  2WGS A;  4G11 A;  2RDG A;  4KGS A;  1S3S G;  2RGF A;  1JML A;  4EUT A;  5G2N A;  4NZL B;  3DHG C; 
#chains in the Genus database with same CATH homology
 1WY8 A;  4IC7 B;  3RZW C;  3ZRF A;  3KUZ A;  4OVU A;  1UD7 A;  2EKE C;  2HTH A;  3TIX A;  3VUX A;  3W1S A;  2FAZ A;  3VUY A;  4B9K A;  4NY0 A;  4CYE A;  4NQL B;  2D2Q A;  1R4M I;  3DBR I;  2C7N B;  5JHA A;  4MGI E;  2DYO A;  5L83 A;  2JVC A;  1UZX B;  2GBK A;  4PS3 A;  2FUH B;  3NOB A;  4FA6 A;  3EFU A;  3PV1 A;  2JUO A;  4X57 B;  1YD8 U;  4B95 A;  2R2O A;  4JGH B;  2IBI B;  4AOF A;  4KZ0 A;  3RT3 B;  2WYQ A;  3JW0 X;  4W9D A;  1WF9 A;  2K25 A;  2L05 A;  3HM6 X;  4MJS A;  4AJY B;  1EUV B;  2DZK A;  4WWP A;  3IFW B;  5J2R A;  3OAW A;  1WI0 A;  2QHO A;  2GMI C;  4FUL A;  1QZE A;  1YX6 B;  1K8R B;  4W9C A;  3QA8 A;  4BOZ B;  1TGZ B;  2D10 A;  2V3S A;  2WWZ A;  1LFD A;  3ZW3 A;  4KDL B;  4NPN A;  3JSV B;  4LCD E;  3PPA A;  1H8C A;  4IWQ A;  4EZL A;  1UGM A;  3HIZ A;  3PS6 A;  3W1Y A;  5HKH A;  4KIK B;  4MGY E;  1XD3 B;  3B1L X;  1NI2 A;  3TBL D;  2MSE D;  3L16 A;  4GSW A;  4HWI B;  4WJN A;  3U7D A;  4DDI D;  1Y8R C;  1V5O A;  4URK A;  4LDT B;  4M8N A;  3A9K A;  1P3Q U;  2KJR A;  3AU4 A;  2LUE A;  1HE8 A;  2I1J A;  4EZK A;  2XEW A;  4RM9 A;  2HE7 A;  2FCN A;  2MA9 B;  2KVR A;  4HLE A;  1TTN A;  3ECI A;  2KX3 A;  1ZGU B;  3PGE A;  4BKG A;  1V80 A;  4FJY A;  2BWF A;  2KFK B;  2MBQ A;  2MBE A;  3VUW A;  3SU8 X;  3Q3F A;  5C1Z A;  2BF8 B;  1J0G A;  2KJH B;  4FJV B;  3ZNH B;  2C7M B;  4XC2 A;  4MSM B;  3IG3 A;  4HCP B;  3VH4 B;  3A9J A;  4P7I A;  2GOW A;  2CHX A;  4IM3 A;  4GN1 A;  4PYZ A;  4EKU A;  1WGY A;  2AEH A;  1E8X A;  2IY0 B;  2DX5 B;  1I42 A;  2KZR A;  1R4N I;  2JF5 A;  1YQB A;  2O6V B;  4M8M A;  2WX1 A;  3S2A A;  5D6J B;  3DBL I;  3ZTD A;  4DK5 A;  3PT2 B;  4MSQ B;  2BYE A;  4ZRI A;  2CHW A;  4DDG D;  3NHE B;  1RRB A;  4WJP A;  2MP2 B;  3TJP A;  4A3O A;  5BO4 B;  3HK0 A;  4MEM A;  4GDL B;  1GNU A;  1V2Y A;  1JRU A;  2N1V A;  3SD5 A;  1VCB A;  3ZVV A;  2PJH A;  1KLV A;  2K8C A;  3PHW B;  3RYT A;  1RFA A;  2KX0 A;  1GG3 A;  4GDK A;  1XQQ A;  3L0W B;  3PLV A;  2I1K A;  2NS5 A;  3TMP B;  3A1Q B;  4HK2 A;  3ZTC A;  4M0W B;  4KVG B;  3QQ8 B;  4GOC A;  4HCN B;  4DHJ D;  3CST A;  4RM8 A;  1WX9 A;  3PLU A;  4KDI C;  2MBB B;  4KV2 A;  2KHW B;  2VRR B;  3DQV A;  4I6P A;  1V86 A;  2DZJ A;  4MDK E;  5C23 A;  3CSF A;  3IVF A;  2ZVN A;  1UH6 A;  4ANU A;  1J19 A;  2OJR A;  2V4L A;  3IBE A;  3EHV A;  3X0W A;  2ZCC A;  3OLM D;  3HHM A;  1WE6 A;  3PRE A;  4HDQ A;  3M63 B;  1H4R A;  3N32 A;  4IUM B;  3QWZ B;  2KMA A;  4W9K A;  4DXA B;  2FID A;  4BKT A;  3R7Q A;  3B0A A;  4NAW A;  4G50 A;  2IY1 B;  5D7G A;  1WH3 A;  1Q0W B;  2D07 B;  3DVN U;  3SDL C;  1AAR A;  4N9F 4;  4J6I A;  1ZKH A;  3A4R A;  3PTF C;  4KSK C;  1WJN A;  2GBM A;  4GIV A;  5DPW A;  3H7P B;  1SIF A;  3TCA A;  1E8W A;  4KZC A;  3ZDM C;  1WXV A;  2DAJ A;  3ZIM A;  2LAS A;  4XX5 A;  4WAA A;  1ZW7 A;  2JZZ A;  5TR5 A;  3UIO B;  4JL9 A;  2A5U A;  3H1U A;  2KKC A;  4FHK A;  3V6E B;  1EO6 A;  4MM3 A;  1WMH B;  2L00 B;  2ZEQ A;  2IO0 B;  5L95 C;  3NZS A;  3ZLZ A;  2KTR B;  3VQI A;  4OVV A;  5GMV A;  2M8S A;  2N7D A;  2N1W A;  2KLG A;  3CF6 E;  4EOY A;  3L13 A;  3KW5 B;  2MX2 A;  5DPS A;  2ZVO A;  4CHK A;  1P98 A;  4K7S A;  2C5L C;  4ASW C;  1G6J A;  2NBV B;  1P1A A;  3EEC A;  2G45 B;  3RD2 A;  3APD A;  3V61 A;  4HXD A;  3R3M A;  3QAQ A;  2D11 A;  3UQB A;  2KLC A;  2M1M A;  3A33 B;  2KC1 A;  1A5R A;  4LJO B;  1WYW B;  2C7H A;  2M17 A;  3PSE B;  2DZM A;  2ZPN A;  3QCA A;  4KSL C;  5E6P A;  4WWO A;  1FXT B;  4AWJ A;  3DDC B;  3A9K B;  2BPS A;  4FAD A;  1RLF A;  3RZF A;  2LRW A;  1UEL A;  2CHZ A;  2PEA A;  3EC8 A;  3KH0 A;  5CHV C;  3WAP A;  2GBN A;  4E71 A;  2JWZ A;  3JSV A;  2K39 A;  4GU2 A;  2L76 A;  5EDS A;  2MBH A;  3VH3 B;  4AJW A;  4K81 A;  1LXD A;  4FHJ A;  2K6Q A;  3DVN V;  3TL5 A;  2K6D B;  1YJ1 A;  2DHZ A;  2IYD B;  3VXW A;  3L17 A;  4K7U A;  1WE7 A;  2FCQ A;  4IG7 B;  2ZZP B;  4II2 B;  1KJT A;  3A9J B;  4YL8 A;  4NJ7 A;  3ZUN A;  5JHB A;  3KYD D;  2N7E A;  4HPL B;  2XK5 A;  2PE9 A;  4ZRJ A;  2DZI A;  3AI5 A;  2LZ6 A;  2KQS A;  4MGK E;  4MGZ E;  2KFK A;  2Y5B B;  1WFY A;  2BYF A;  1YIW A;  2IZV B;  5CX3 A;  2BYV E;  2IO3 B;  3W1S C;  1WJ6 A;  2Z59 B;  2B3A A;  2G4S A;  4LDT D;  4TUU A;  5DCN A;  1F9J A;  4I6N B;  1GC7 A;  3UQA A;  2KC2 A;  2AYO B;  1WGH A;  4NNJ B;  1UBQ A;  2JPH A;  2MQJ A;  3L54 A;  4EEW A;  2FNJ B;  3WAN A;  3ZNZ B;  3QK0 A;  5D94 A;  4BOS C;  2RPQ A;  2DYB A;  2O6V A;  3NZU A;  2N9P C;  4B6W A;  2R2Q A;  2N9E B;  3BIN A;  5KHO A;  1OEY A;  3RUL A;  4TKN A;  4ICV A;  3VTW A;  1WGG A;  2GBR A;  4WWN A;  2KDF B;  2NPT A;  3WAL A;  2NR2 A;  2KQ7 A;  2A4Z A;  2EMT A;  4MH0 E;  3CMM B;  2MP2 A;  5AEK B;  3PRM B;  1T0Y A;  3D32 A;  2FCS A;  2GBJ A;  4GDL A;  3KUC B;  1Z2M A;  2CKH B;  2RD0 A;  4JIO U;  1TZ1 A;  2JRI B;  2KTF A;  3T8M A;  3M3J A;  1OQY A;  2KWV B;  2O2V B;  2RSU A;  2J0M A;  2ZCB A;  2O6V D;  1WXS A;  2DEN B;  4FN2 A;  4II3 B;  3JYU A;  3UF8 A;  4DWF A;  4BBN C;  5AZG A;  3VTU A;  2ZPY A;  3APF A;  1CMX B;  4IM2 A;  5J18 A;  1E8Z A;  3A1Q A;  3H7S A;  3L08 A;  3ZNG C;  2J0K A;  5LLI A;  4EFO A;  3R7R A;  4ZYN A;  2JT4 B;  2G4D B;  2PPH A;  2MLB A;  1GUA B;  1RAX A;  2FIF A;  1EF1 A;  4NAW B;  5CTR C;  4NQK E;  1OEY J;  2L0F A;  4ANX A;  3DVG Y;  2KMC A;  4WJO A;  4W9F A;  3UGB B;  5DPR A;  2IO2 B;  2MBO A;  2WX0 A;  3GOE A;  3OJ3 A;  3X23 A;  3QJZ A;  3PZD A;  1NDD A;  2LVQ A;  3GZN I;  2BKF A;  2JY6 A;  1KOT A;  4A3P A;  3RCZ A;  4IM0 A;  4BVU C;  2G3Q B;  2LGD A;  1U4A A;  2RR9 A;  4ANV A;  3QIJ A;  2LWP A;  3QHT A;  3BY4 B;  1WX8 A;  4IW0 A;  4HPM B;  1ISN A;  1P0R A;  2KXJ A;  1BT0 A;  2YVC A;  3KUD B;  3L10 B;  1IP9 A;  4MEL A;  2MCN B;  4WJQ A;  5G55 A;  3ZKJ C;  2LD9 A;  2C60 A;  4MJS B;  3WAO A;  2XBB C;  4IWP A;  2N9X A;  5IA7 A;  5CHF A;  2L3Z A;  4NJ6 A;  1GJZ A;  2CU1 A;  2MRP A;  3AU5 A;  3DPD A;  4TV3 A;  4HDO A;  3ML9 A;  5JZE B;  4I6L B;  2BKR B;  4EZJ A;  3DVG X;  1MG8 A;  1WJU A;  1WMH A;  3WIM A;  2M4N A;  1WZ3 A;  2YLM A;  2KWC A;  3SHQ A;  2NBU A;  4W9I A;  4GB9 A;  1WR1 A;  2KOX A;  1VD2 A;  2KDB A;  2UYZ B;  3ZNI D;  2IO1 B;  2Z0E B;  4W9L A;  2REX A;  2KTR A;  4ANW A;  4GMV A;  3HM3 A;  1KM7 A;  2PE6 B;  2NCN A;  2KFJ A;  3N30 A;  2KJ6 A;  3PHX B;  4K1R B;  3VAW A;  1SE9 A;  1LQB A;  1V9J A;  2KDE B;  2KN5 A;  4W9H A;  4LJP B;  1I35 A;  2JXX A;  4DHZ E;  2AWT A;  1V6E A;  4HVB A;  2JZ3 B;  5DPT A;  3P2B A;  1X1M A;  2KWU B;  2LVO A;  4W9G A;  2ASQ A;  2ZNV C;  2HJ8 A;  4TQ1 A;  1GC6 A;  1WIA A;  4PS8 A;  4KIK A;  1E8Y A;  1S1Q B;  4PYU A;  2DYM A;  3ENE A;  4K7W A;  1NBF C;  4WQO B;  3V62 A;  1E90 A;  2L0T A;  2CS4 A;  1OGW A;  1V81 A;  2KD0 A;  2KK8 A;  5D2M B;  3JVZ X;  1P9D U;  2MWS B;  1EF5 A;  2NVU I;  5KHQ A;  2KAN A;  1XT9 B;  2K8H A;  3LJ3 A;  2C9W B;  3KYC D;  2XK5 B;  3DBH I;  4GGQ A;  5FR6 A;  2WDT B;  2LXC A;  4BFR A;  3LDZ E;  1IYF A;  3M95 A;  1E7V A;  3ALB A;  3M62 B;  1Q1O A;  1LM8 B;  2AL3 A;  3AUL A;  3VTV A;  2NBW B;  5E6N A;  3V6C B;  3ML8 A;  4JLC A;  3VFK A;  2N4F A;  1Z5S B;  3MJW A;  4G0N B;  3PRP B;  2LXA A;  3Q3J A;  3RUI B;  3V60 A;  3OJ4 B;  2LVP A;  3K9O B;  3ZO5 B;  4DHJ B;  2CR5 A;  2BWE S;  2FCM A;  3NY5 A;  3O65 B;  1D3Z A;  2L7R A;  4W9J A;  5JH5 C;  1E5W A;  4W9E A;  1WGR A;  3UIP B;  3ZRC A;  3AXC A;  3N3K B;  1E7U A;  2M0X A;  5J17 A;  2AL6 A;  4TQ0 A;  4BKS A;  4JQW C;  3H9D A;  4GDK B;  2K1F A;  4RMA A;  1WXA A;  1WM2 A;  3VDZ A;  3A4S C;  4A20 A;  4BBN F;  2W9N A;  3UIN B;  3ZDT A;  3H6N A;  3DOW A;  2ZJD A;  3DCG A;  3PVL A;  1M94 A;  1L2N A;  1WM3 A;  2NPT B;  1WX7 A;  1L7Y A;  3I3T B;  3VVW B;  1TBE A;  2UWQ A;  2K8B A;  2LI5 A;  2JRH A;  1WGD A;  1V5T A;  4DBG A;  1WJ4 A;  2ZNV B;  2HD5 B;  4HJK A;  3KVF B;  4ZDV A;  3APC A;  3QAR A;  3B08 A;  1J8C A;  4BKS D;  2L8J A;  1WZ0 A;  2LJ5 A;  3IHP C;  2LRU A;  3PRZ A;  3U8Z A;  3T9L A;  5AZF A;  2D3G A;  5E6O A;  2OOB B;  3MHS D;  3R66 C;  3U30 A;  4FBJ B;  2KO3 A;  3C0R B;  4E3C A;  3MTN B;  1WRD B;  3QC8 B;  2DAF A;  1C1Y B;  1UBI A;  5AZH A;  4AP4 C;  4CO7 A;  2O2V A;  4GXB A;  2LGX A;  1WR6 E;  4G3X B;  2LGY A;  4IWO A;  5CHW A;  4AUQ C;  4F7Z A;  4DHZ B;  1SGH A;  3VHT C;  4FJZ A;  2BGF A;  2MW5 A;  3K9P B;  3WA0 A;  1C3T A;  4ZRK A;  2EMS A;  1YX5 B;  5LXI B;  1Q5W B;  3DBS A;  2Z0D B;  3NS8 A;  4F8C B;  2J7Q B;  2KNB A;  1IPG A;  4PS7 A;  5IAA C;  1OTR B;  2KDI A;  3WAM A;  5LXH A;  1WXM A;  4F1S A;  4E74 A;  2V1Y A;  1V49 A;  4G11 A;  2J0J A;  4XZ4 A;  3ONS A;  1S3S G;  2RGF A;  1PQS A;  4ICU A;  4EUT A;  3QX1 A;  5G2N A;  3H7P A;  4FLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...