2KDKA

Structure of human circadian clock protein bmal2 c-terminal pas domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
NSGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHNNLTDKHKAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNPDTKELEYIVSVNTLVLGHSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator-like protein
publication title Structure of human circadian clock protein BMAL2 C-terminal PAS domain
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2kdkA01
3NHQA 1JNUA 2WKRA 2PD7A 1S1ZA 2GJ3A 1OTEA 1XFQA 4WN5A 4JGOA 1XFNA 3IS2B 4PKYG 2PR6A 2PR5A 4R38A 4HJ4A 3UB6A 2VV6A 1OT6A 2H28A 3F1OA 4HHDA 3VE4A 3HJIA 5HDCA 2QHKA 4XT2B 4L9GA 2Z6CA 1OJ5A 2J80A 1S4SA 3K3CA 4GCZA 4I5SA 1XJ4A 1VB6A 2D02A 2V1AA 2A24B 4LRYC 4NXEA 4GHIB 1V9ZA 3CAXA 4H6JB 4DJ3A 2QJ5A 2V1BA 2YKFA 4XT2A 5A8BA 4M4XA 2PYPA 5KIZA 1OTAA 4EEUA 4GHIA 4H6JA 3UMDA 4NXGA 4EERA 4BBTA 5DKKA 1UGUA 4HY8A 3RTYA 3C2WA 3IBRA 4EEPA 4HJ6A 3RH8B 3VE3A 1KOUA 3LIDA 1EW0A 1P0ZA 1DP9A 3GECA 2WKPA 5DKLA 5HDSA 4R3AA 1G28A 3UMEA 4GW9A 4R6LA 2V9AA 1OT9A 2KX6A 3MR0A 4LPZA 2KDKA 3H9WA 4K08A 3MQQA 3MJQA 3PHYA 1T1AA 1LT0A 5HWWA 2YKHA 1V9YA 2V0UA 2INWA 2L4RA 3KX0X 4F3LA 3K3DA 5HDDA 1N9LA 3F1OB 1DP6A 3UB9A 3NOTC 5HZHA 2W0NA 3LIAA 5HWTA 4GS9B 1UWPX 2QKPA 4HOIA 1OTBA 5HWVA 4WLAA 5AVFA 5J3WA 5J4EA 4EQ1A 1TS0A 4I3AA 3FC7A 4HI4A 4RQ9A 3D72A 4B9OA 4EESA 4WF0A 2OOLA 3A0VA 4GS9A 3A0RA 3F1NB 1GSVA 4HP4A 4I3IA 1LL8A 2PYRA 3UB7A 1LSVA 3NOPC 3LIEA 2D01A 1S1YA 1UWNX 1DP8A 5F6AA 4WUJA 3BWLA 1WA9A 4WL9A 4BBVA 3F1NA 1MZUA 5J7EA 3H82B 5TBMB 5G4YA 3NJAA 3PYPA 1S67L 4EW7A 1XJ6A 2HV1A 3EEHA 5HSQA 1X0OA 2M1CA 2VEAA 5F5YA 3CLOA 2ZBBA 1T19A 3H82A 5TBMA 1BYWA 2PD8A 1XJ2A 1ODVA 4MN6A 2VLGA 3LICA 4F3LB 3UB8A 4EETB 3EWKA 3A0SA 2VV7A 4JGPA 4R70A 1S4RA 4LLOB 3T50A 2EA9A 2PHYA 1S66L 4HIAA 5DJTA 4YWZA 4BBUA 2R78A 3GDIA 3H7WB 2B02A 1OTIA 2I9VA 3G6OA 3HJKA 4DJ2A 3LIFA 4JGRA 3CWFA 4HH3A 5IS1A 4KUOA 3H7WA 1T1BA 2Z6DA 2L1MA 5HD5A 1P97A 4L9FA 1F98A 4LRZE 4MN5A 1LSXA 1T1CA 2OWJA 1DRMA 5AVEA 5HD3A 2OWHA 4KUKA 1TS8A 2WKQA 5F68A 3LI8A 2P7JA 1N9NA 3C8CA 3UE6A 2CMNA 1OTDA 3IS2A 4JGQA 4NXFA 4HNBA 2JHEA 1OJGA 1NWZA 3ICYA 4EXOA 1TS6A 5I5LA 3MFXA 1LSWA 3MXQA 4I39A 3F1PB 5DJUA 5F69A 2W27A 1F9IA 2QWSA 2ZOIA 4HQAA 1GSWA 4E04A 3E4OA 3FG8A 2A24A 3LUQA 4LRXC 5G4ZA 1Y28A 3ULFA 4PKYA 4KQDA 3LYXA 3E4PA 2PDRA 3F1PA 3MQOA 3NOUC 4I38A 5EFWA 4HP9A 2V0WA 1TS7A 3LI9A 1GSXA 2K7SA 4HJ3A 1D06A 4HH2A 3ZQ5A 3OLOA 2ZOHA 3P7NA 3BY9A 2L0WA 4I3JA 3BY8A 2VV8A 3LIBA 1XJ3A 1D7EA 3B33A 2QJ7A 3E4QA 3SW1A 1N9OA 2BASA 1T18A 3VOLA 2JN7A 4NXBA 4L9EA 5IU1A
chains in the Genus database with same CATH superfamily
3NHQA 5CTMA 5EOOA 2WKRA 2GJ3A 1OTEA 4RX3A 1WYBA 2P9VB 3LR5A 4PAUA 5EV0A 3T12B 1BUEA 1XFNA 2PR6A 4R38A 3ZFZA 3C4OA 4DXCA 3HLGA 3KSGA 4X69A 1OT6A 2H28A 5E2FA 4HHDA 2PAVP 4XT2B 4L9GA 3SH9A 4X56A 5CERA 1HD8A 3K3CA 3VP0A 4QHCA 3UE1A 4QD4A 2V1AA 4LRYC 5FQIA 1V9ZA 4YFMA 3VFHA 4ZDXA 2H0YA 3CAXA 3GMWA 4MBKA 4K0XA 3UN7A 4DJ3A 2HDQA 2V1BA 2HP6A 4XT2A 1PYYA 5DFXA 5EUAA 4QU3A 2H0TA 4OQIA 3PBQA 2X02A 5KIZA 1NJ4A 2PU2A 4KZBA 5C5KA 3PBOA 3Q1FA 3VFFA 2WKEA 3UMDA 4DE3A 2JC7A 2OAP1 3NY4A 4EERA 2Y2PA 5DKKA 4HY8A 4P6ZS 3C2WA 2B18A 3Q7ZA 3HL9A 4KQQA 3PBRA 1KGGA 2JBFA 3NDGA 1EW0A 4O01A 5HDSA 2W3FA 3UMEA 4DXBA 4GDNA 3D3OA 2V9AA 3MZEA 1OT9A 1PWCA 1FSWA 3LR4A 3FZCA 3LGOA 4U0XA 5IHVA 3MQQA 4HEFA 4KZ4A 2YKHA 3QNCA 3E2LA 2V0UA 2M7UA 2L4RA 2ZC6B 5GHZA 3A3FA 3KYZA 1XXMA 2W1RA 4CLCD 3DWZA 4JPMA 3LIAA 4WMCD 1YLYA 1UWPX 2QKPA 1SDEA 1ZG6A 1BLCA 4O0PA 4B88A 5J3WA 1VETA 4OKPA 4YOFA 1TS0A 4I3AA 4RA7A 1VQQA 2HDRA 3PBSA 3VP1A 4E3MA 4WF0A 2XLNA 5HL6A 3WS0A 4HP4A 2PYRA 4LV1A 4NETA 3UB7A 3ITBA 1PW1A 4FSFA 3HLFA 4QB8A 3QNBA 1YQSA 3FKWA 2VGLS 4WUJA 5FAQA 1ES2A 2VGKA 5CECA 1MZUA 3IX3A 5J7EA 5TBMB 1ERMA 3NJAA 4MEZA 3PTEA 3C30A 3IWQA 3HUNA 5GLAA 4WEKA 2Y2MA 2O99A 2UV0E 5EVLA 3T1SA 4ID4A 5F5YA 5TBMA 4ME4A 3V5MA 1XJ2A 1ODVA 1XGJA 2VLGA 2Q9MA 3LICA 3LR0A 3BJNA 4X6TA 4DF6A 3BFGA 1O7EA 2ZQCA 3A0SA 1BULA 3IXBA 5EPHA 5HAIA 4LCMA 2IA2A 3C38A 3A3JA 2V2FF 2EA9A 3FWLA 4KZ3A 5L09A 4NK3A 2VA0A 3L7HA 4PM7A 5DJTA 4E6WA 4WM9A 4E3OA 1GA9A 1OTIA 3D4FA 3QHYA 4JF6A 4HESA 4KG6A 2NUPC 3G6OA 4KZ5A 3LIFA 3LY4A 1PIOA 3UDIA 5IS1A 4P0MA 3L9KA 4EUZA 1G68A 2WGIA 4O7DA 1ZG4A 5EVIA 4MLLA 1OPXA 2ZQ8A 4LV3A 4Q0JA 5TGFA 2Z6DA 4L9FA 4LRZE 5MC7A 2OWJA 1DRMA 2CC1A 5CTNA 1XPBA 1FR6A 5L8MA 4KUKA 1TS8A 3MQ0A 3MS6A 1H3QA 1Z6FA 1MWTA 3B47A 4OP8A 1C3BA 4PM5A 4EU0A 4Z9QA 1M40A 2H5SA 4JGQA 2XSSA 2IWCA 3MF0A 3UPPA 2JHEA 4OOMA 1OJGA 5EECA 2ZD8A 2J3WA 3MFXA 2I72A 4BL2A 4LV0A 1PW8A 4I39A 2WK0A 2W3DA 1JWZA 2XH9A 1FIKA 1F9IA 2QWSA 2ZOIA 2JKRI 1K57C 3E4OA 1L0DA 2A24A 3TOIA 1L0GA 2A2LA 5AJGA 4N9KA 2QMIA 1Y28A 1IEMA 4PKYA 2HF6A 4LFUA 3OOVA 3MSHA 5CHMA 1DJCA 5DVAA 3W2ZA 2ZMAA 2V8FA 3BEBA 3LY3A 4HP9A 1RP5A 4BD1A 3NI9A 3BECA 2OLUA 1YMXA 2PBDP 2EX2A 4ZJ1A 4B93A 5KSHA 5FL3A 1K56D 3T1XA 1D06A 2Y8HA 3OLOA 5GLDA 4BLMA 1FR1A 3JVVA 4BD0A 4NG2A 2WAFA 1TF1A 3V3RA 3NCKA 2WADA 5FQQA 4KZ8A 3B33A 1K54C 3IXDA 1T18A 1NXYA 1K4FA 1MXOA 5U47A 2JKGA 3VP3A 5FQJA 4NXBA 3DTMA 3NC8A 4L9EA 1PZOA 4IBXA 1K6SA 2Z2LB 5CGSA 2JCHA 3AGDA 2XA7M 5GHXA 4XUXA 2PBYA 1S1ZA 2PD7A 1ACFA 2EFUA 3P09A 4OH0A 3IS2B 4PKYG 5TR7A 2Y59A 1KGFA 3BQ8A 4S2NA 1JTDA 2VJWA 2BLSA 3ISGA 4NKPA 2VV6A 4II7A 3F1OA 1ESIA 3OZHA 3HJIA 4ETZA 2GNXA 3G31A 3T4SA 2QHKA 3LCEA 4KQRA 4WZ4A 2J80A 3WS2A 3ZG7B 4P6BA 1FCNA 3Q82A 5CGXA 5CEBA 1M6KA 2XFSA 4MNRA 4EBNA 4OPRA 3ZNTA 1TDGA 4H6JB 2QJ5A 2Y2JA 3QP4A 2A49A 3U4LP 2W1TA 3RFBA 4M4XA 2V1ZA 4ZAMA 4E3NA 5FEFA 1FILA 1YLWA 3IF6C 2IWBA 2IWDA 2V8CA 3IH9A 4H6JA 3AGEA 1CK3A 2ZL1A 3RTYA 2J3TC 2P08A 3IBRA 4EEPA 4HJ6A 3QP8A 3KO6A 1BT5A 3RH8B 3VE3A 1KOUA 3FPVA 3QP5A 2ZM2A 2FH5A 1XKZA 4EBLA 3S1YA 5AQ7A 4GW9A 3IBJA 2KLIA 4R6LA 1BLSA 2AVXA 1IYSA 4OQHA 3W4OA 5HWWA 3IXGA 4GB7A 4LV2A 4N1XA 3EQVA 5A90A 3O87A 1XP4A 5HPFA 2FFYA 5FQ9A 2INWA 3BQAA 3IT9A 3HLEA 1SHVA 4F3LA 3OPPA 3M2JA 4S2MA 4MDZA 5F83A 1N9LA 4MBHA 2J8YA 1Y54A 1K0KA 4HBTA 3ZG9B 5HPIA 2W0NA 4C6YA 4GS9B 2Y2QA 2WZZA 1STZA 1P9RA 4IUHA 5DTSA 1CI9A 4X68A 4WLAA 1I2WA 4EQ1A 4JF4A 4JXVA 4MBFA 4RQ9A 2Y2OA 3O5YA 1SKFA 2OOLA 4GS9A 2PRFA 3A0RA 4I3IA 1FCMA 3HVFA 2Q0OA 1W5DA 3ZG8B 4UQIM 2J9OA 1FSYA 3BW6A 2D01A 3SS5A 1UWNX 1XA7A 5F6AA 3NBLA 2W3EA 1ES3A 1IYQA 4BBVA 2HP9A 5FI7A 3H82B 1NRJA 2HDSA 2MJ6A 4FTXA 5G4YA 1H8MA 3PYPA 3BYDA 1S67L 4EUVA 3MXSA 3UPNA 3T4TA 2C6WB 1Q2QA 2DRWA 2HV1A 5HSQA 1L2SA 3GV9A 3HLDA 4JXSA 2ZBBA 2WUQA 3H82A 4FH2A 5D3OA 1BYWA 4MN6A 5HARA 1DJBA 1MKIA 4PM8A 5A92A 3WRZA 1Y4OA 1J3WA 1MWRA 1H8YA 1ONGA 5FQMA 2VV7A 4D60A 1K25A 5JYPA 4X53A 1U60A 4PMAA 5FA7A 1L0EA 1HVBA 1MY8A 1S4RA 4LLOB 3T50A 2GDNA 2J9PA 3O88A 4QPRA 1NZOA 1JVJA 4YWZA 3GRJA 3WS4A 1VETB 4BBUA 2R78A 3BRMA 4JXGA 4XXRA 3H7WB 4R1GA 2JKTM 2B02A 2EFXA 3CUEC 1FCOA 4FH4A 3WS1A 1IOUA 1MKMA 3QP1A 3FYZA 3HJKA 3KSIA 2X71A 4IJGA 4KUOA 3ZNYA 4RVAA 4Y2FA 4X1LA 5FEGA 2ZQAA 4DN0A 3QP2A 1E3UD 2HPBA 3H7WA 1T1BA 2ZC7A 2L1MA 1F98A 5F1GA 4ZBEA 1LSXA 5HD3A 1AXBA 1RCJA 5EVEA 2OWHA 3S7OA 2H10A 3VSLA 2VK3A 1SZVA 1PRQA 3IHBA 2WKQA 5F68A 1K55C 1W8YA 3GR2A 3LI8A 5JYOA 2ZM0A 4Y3IA 5FAPA 2CMNA 5FI2A 3Q07A 4PPRA 2EXBA 1OTDA 4Y15A 5BOHA 4NXFA 4HNBA 4OQ0A 5GLCA 3AGFA 1FQGA 1AWIA 3M6HA 3VMAA 1NWZA 3A3EA 3ICYA 2E8IA 1MPLA 4FD8A 3ZYTA 4Y7PA 4RYEA 5HAPA 3MXQA 1MWSA 5F69A 5CX7A 5CEDA 2W27A 4UHUA 2A3UA 3LEQA 4E04A 1G6OA 3V50A 2K2NA 4UA7A 1ESUA 5CHUA 2VGJA 4GDBA 1H5XA 2WYXA 3OBFA 3BM6A 3W4PA 5A91A 4I38A 1TS7A 5L2FA 1LL9A 2FFFB 5DTKA 3CJMA 2XQZA 4GOGA 4M3KA 5EVIC 4DE0A 1GSXA 2K7SA 4Q8IA 4GD8A 3LEZA 4WZ5A 1ALQA 4S2OA 1SCWA 2XA7S 3BY9A 5EVIB 4R23A 3MZDA 4G3WA 4FCFA 3IX8A 1S0WA 1ZC2A 3GSGA 3LIBA 3MKFA 4NEED 1XJ3A 4E3LA 5HAQA 1L0FA 1N9OA 1QMFA 2PU4A 2BASA 3VOLA 3UY6A 1CI8A 3LR3A 3UDFA 4GKUA 5L07A 2R9XA 4CLCB 1W79A 3G2ZA 1JNUA 4DKIA 4CLCE 1PI4A 1XFQA 4WN5A 2EWVA 3DAVA 2PR5A 3U2AA 3WWXA 3DTKA 5L10A 4DDYA 3IX4A 1KGEA 3UB6A 4CLCA 3VE4A 5HDCA 5DF8A 5TFQA 2WKIA 1W7FA 3A3DA 2Z6CA 1YLZA 4GCZA 4PM9A 1XJ4A 1F2KA 3V67A 4WMCA 1VB6A 4U0TA 2A24B 4GHIB 4G3KA 3FPWA 3V39A 3S7PA 3CZDA 4KENB 2YKFA 4WBGA 1A0KA 2ZLYA 5GLBA 2Y2LA 3KSFA 1MWUA 3RXWA 4EEUA 4GHIA 1BLHA 1YMSA 3UPOA 3SZTA 3HUOA 1UGUA 1TDLA 5E43A 4N9LA 1ZTUA 3JYIA 2EX6A 3UO9A 3DTEA 3S7QA 5EOEA 2HDUA 3OC2A 3N4IA 3KYQA 1WYCA 5KSCA 3LIDA 1K6RA 1CEFA 4GLQA 2ZC3B 2J3TD 4JF5A 1P0ZA 5CGWA 2WKPA 5DKLA 3IWIA 4R3JA 1YLJA 2KX6A 3MR0A 1JWVA 2KDKA 2P74A 4K08A 3IHAA 1NYMA 1T1AA 3EGDC 5IT5A 1LT0A 4S2NC 2Y55A 2ZQ9A 1SDNA 1VEUB 4MMNA 1V9YA 3G32A 4KQOA 1JWPA 1S6RA 1BLPA 4ZRRA 2XGNA 3MFDA 4GJ4A 4LGWA 3F1OB 1DP6A 4IVKA 3EEAA 5M18A 3T4LA 1HZOA 2Y91A 3FKVA 3T4OA 3NOTC 4DDSA 3T4JA 4S2KA 1VEUA 3P01A 3CG5A 2ZC5B 3OPHA 4KZ9A 5AQ9A 5E2GA 1OTBA 2Y2IA 3PAEA 5HWVA 3HLCA 1I5QA 2G2WA 3K2NA 1KE3A 2ZC4B 4WEJA 5M1AA 2XK1A 4UQIS 3C4PA 4X1MA 4HI4A 3D72A 4YNRA 2HJEA 1YSQA 1ES4A 2W1TB 4S2LA 4ARZA 1GHIA 3F1NB 5AQBA 2P04A 1LL8A 2VKSA 1K54A 3N8LA 1LSVA 3NOPC 3LIEA 5HL1A 4CJNA 1GA0A 2OAQ1 3VV4A 2ZL1B 5FAOA 3TRCA 1LI0A 3NDEA 3M6BA 1FOFA 1WA9A 1NLYA 3F1NA 4UEYA 4G3VA 4Y0OA 3KSHA 4OPZA 3LO7A 1WE4A 1PWDA 1XGIA 4MCWA 4EW7A 1XJ6A 3ZDJA 2R9WA 3EEHA 3C5AA 3S22A 3CMZA 1LL5A 1X0OA 4OLDA 4OLGA 4OVDA 3VP2A 3MKEA 3UE0A 3CLOA 1T19A 4L0LA 4F3LB 3UB8A 1CEGA 2O9BA 3Q7VB 4IBRA 3SS4A 4A5RA 2DNSA 4EETB 3EWKA 5DTTA 4CQHA 4BMWA 1KVLA 5EE8A 4JGPA 4GN2A 4BENA 4B4XA 2XEPA 3MXRA 5CHJA 1S66L 1BZAA 2EXAA 4HIAA 3Q7VA 3IF6A 1KE4A 1KVMA 4ZJ2A 3GDIA 4UAAA 3UNWA 1G6AA 3PR6A 4P85A 1W8QA 4KZ6A 1ERQA 1OMEA 1K56A 3PBNA 4JGRA 1N4OA 3CWFA 5DFYA 1CJFA 4MN7A 1YM1A 1YPRA 1XX2A 4BQMA 3TE8A 5K5BA 5HD5A 1P97A 4BJPA 4MN5A 1IYOA 2ZJ9A 4QY6A 4IEDA 5FSRA 3C8CA 4Y13A 4LCLA 2Q9NA 2P9VA 3G30A 3T4KA 4X55A 1ES5A 3OPRA 2XROA 5AQAA 3IF5A 2JKRM 2XFTA 4BWIA 1TS6A 2HP5A 2QPNA 1LSWA 5DF9A 4N92A 5DJUA 3E2KA 2VX8A 5TJJA 1YLTA 4ZJ3A 5FASA 5E2EA 3ZHHA 3RJUA 4GD6A 1SKOB 4LRXC 2O9CA 2HJ9C 5G4ZA 4R4SA 3N7WA 4KQDA 4S2IA 3LYXA 1IKGA 3MQOA 3PBTA 2BG1A 3VOZA 2V0WA 3G4PA 2WGVA 3T1RA 3LI9A 1K38A 4E3JA 1SKOA 2G7UA 2W3HA 1JTGA 3RXXA 4JKTA 2K31A 3N8RA 3SH7A 4HH2A 3ZQ5A 3C7UA 4GZBA 1L3LA 2XDMA 5EVID 4OQGA 5FDHA 4I3JA 3BY8A 3CPTB 4GNUA 2Y2HA 1D7EA 1BTLA 2XD1A 3OCNA 3R7WB 4JXWA 2O0YA 2JN7A 2RCXA 4E6XA 3P98A 5E2HA 5IU1A 1NRFA 2HZ5A 4Y5FA 2DMWA 3W8KA 2Y2KA 5KMWA 1HLUP 4FUWA 3CPTA 1LLBA 4F94A 4JGOA 1E25A 3HCYA 2E8JA 4HJ4A 4EBPA 3R7WA 2XD5A 4DMZA 2EX8A 4WYYA 3CHWP 4Y17A 4OONA 3O3VA 4JLFA 4Q0IA 2DCFA 3UE3A 5LBRA 1OJ5A 1YSPA 1S4SA 3WS5A 3G34A 1DJAA 3ZG5A 3DTIA 4I5SA 2WGWB 1ZKJA 4AFIA 2D02A 4NXEA 3CUEA 3HLWA 4LENA 5I94A 3G35A 2Y2NA 3E0YA 3VOYA 1Z09A 4H8RA 5A8BA 1NLZA 3E98A 2BTFP 1PNEA 1BSGA 3DBAA 2PYPA 3I7JA 1H0MA 2WKHA 2WGWA 3D9YA 1OTAA 3M2KA 3BFEA 4WZ5C 2J7VA 1MC0A 4ESPA 4NXGA 5GHYA 3MZFA 3Q81A 4BBTA 1GHPA 2XR0A 3DW0A 1K55A 1PWGA 3OPLA 3HBRA 2PT7A 3HREA 1XA1A 4KG5A 2ACGA 1KDSA 4R3BA 1E4DA 1DP9A 3GECA 3C7VA 4R3AA 1G28A 4Q0HA 2XRNA 3ZGAB 3IXHA 2LB9A 3BLMA 4LPZA 4E3KA 1W63M 3H9WA 3MJQA 4WELA 4P6ZM 3PHYA 2UWXA 3JVUA 4KG2A 1IFQA 4B4ZA 1IYPA 3ZVTA 3HLBA 4IUKA 3SS3A 4CLCC 3OCLA 1P9WA 3EQUA 3KX0X 1PI5A 1EI5A 4BL3A 3HUMA 2C5WB 2RL3A 3K3DA 1W63Q 3B3XA 5HDDA 3TSGA 4DE2A 2EX9A 1YT4A 1I2SA 3IWOA 3UB9A 4C3QA 5HZHA 4KZ7A 5HWTA 2KOIA 2WZXA 2W3GA 5CXWA 4EQIA 1VHMA 4HOIA 5G18A 3CITA 3PXPA 5AVFA 1J9MA 5J4EA 1F5MA 4R4RA 1K4EA 3LFVA 3FC7A 4RX2A 2QYBA 4B9OA 4E3IA 4S2JA 4EESA 3CI6A 4N1HA 4UA6A 1O07A 3T4QA 2NUTC 3A0VA 4IHQA 5KZHA 4OPQA 3S4XA 1GSVA 2VZWA 5HW3A 1QMEA 4QY5A 3V3SA 1S1YA 1E3UA 1YAXA 1DP8A 4CPKA 2OSUA 2B5RA 1VM1A 2Y4AA 3ZVWA 3VP4A 3BWLA 1H8ZA 4KZAA 4WL9A 1D1JA 3EOIA 3TJZC 5HFOA 5FDSA 3FV7A 1GCEA 1HTZA 2VGLM 4QJGA 1N9BA 4QWOA 2HGVA 3TW8A 4UA9A 2M1CA 2VEAA 2ZMVA 4OP5A 4OPYA 4K91A 3B42A 2PD8A 3S7NA 1NZUA 4Y0TA 1RGYA 2GZAA 3BFCA 2OLVA 4XUZA 3SOIA 3UDXA 1PFLA 1CQAA 4R70A 4OOYA 1K57A 3BLSA 2ZM8A 2PHYA 3A3IA 4ETXA 3GVBA 1NY0A 2JKFA 2O9AA 4K0WA 4PM6A 3IH8A 4DRTA 2I9VA 4ARZB 1ONHA 2X01A 4JBFA 4DJ2A 1KE0A 4HH3A 1G5UA 2JKTI 3MBZA 5F82A 4S2PA 3ITAA 5FATA 3ZG0A 1LHYA 3N6IA 2G2UA 1T1CA 5AVEA 2ZQ7A 1CF0A 3BFFA 3GTCA 5F1FA 3QP6A 4EWFA 4X25A 5GL9A 1GHMA 5FQKA 1YKDA 2P7JA 1N9NA 1EROA 2Y79A 3UE6A 5J8XA 5EM1A 5DF7A 3IS2A 5M19A 3VSKA 2XF3A 2V20A 4DE1A 4EXOA 5I5LA 1YLPA 2LB5A 3NULA 3ZCZA 5HX9A 3SH8A 2Y2GA 3PAGA 1Q2PA 3F1PB 3GQZA 4R0QA 1NYYA 1EWZA 4HQAA 2QZ6A 1PZPA 1TD5A 1GSWA 1DY6A 5CRFA 3FG8A 4D2OA 1IKIA 4U3TA 3LUQA 5FI6A 3BFDA 1ZHHB 2EWWA 1RGZA 3MMHA 3G2YA 3UB5P 3ULFA 4YINA 2WAEA 4HBUA 3R4KA 5A93A 1KDWA 3E4PA 2PDRA 3F1PA 3EGXC 3W4QA 3KYEA 3IF6B 3NOUC 1TVFA 4Z1WA 3NIAA 5EFWA 4PHTA 2ZQDA 2FZ0A 4IVIA 1MBLA 3IQAA 3N8SA 4HJ3A 3DWKA 4O8GA 2Z2MB 1IELA 2ZOHA 3P7NA 2L0WA 4ZTKA 2ZMFA 3NECA 3TG9A 2VV8A 2QJ7A 3E4QA 3JPUA 5EM0A 4C75A 4EV4A 1LI9A 3SW1A 2OV5A 4P87A 4OOLA 4FOFA 3T1QB 4Y0UA 1TEMA 2B95A 2M7VA 3O86A 3WRTA 2JE5A 2GX5A
chains in the Genus database with same CATH topology
3NHQA 2XA7M 1JNUA 2WKRA 4Y5FA 4CLCE 2DMWA 2PD7A 1S1ZA 2GJ3A 1OTEA 1XFQA 3LR5A 4PAUA 4WN5A 4JGOA 1XFNA 3HCYA 3IS2B 2EWVA 4PKYG 2PR6A 2PR5A 4R38A 3U2AA 4HJ4A 3R7WA 3BQ8A 2VJWA 3KSGA 4NKPA 4DMZA 3UB6A 2VV6A 4II7A 1OT6A 2H28A 3F1OA 4HHDA 3VE4A 3HJIA 4CLCA 4ETZA 4Q0IA 5HDCA 2GNXA 3T4SA 2QHKA 4XT2B 4L9GA 5LBRA 3UE3A 2Z6CA 1OJ5A 1YSPA 2J80A 1S4SA 3K3CA 4GCZA 4I5SA 1XJ4A 3V67A 4AFIA 1VB6A 2D02A 2V1AA 2A24B 4LRYC 4NXEA 4GHIB 3CUEA 1V9ZA 4G3KA 3CAXA 4H6JB 3FPWA 4DJ3A 3S7PA 2QJ5A 2V1BA 3E0YA 2YKFA 5DFXA 4XT2A 5A8BA 1NLZA 3E98A 2W1TA 3PBQA 3RFBA 4M4XA 3DBAA 2PYPA 5KIZA 3KSFA 1OTAA 4EEUA 4GHIA 5C5KA 3PBOA 1MC0A 4H6JA 3UMDA 4NXGA 2OAP1 4EERA 4BBTA 5DKKA 1UGUA 4HY8A 4P6ZS 3RTYA 3C2WA 1ZTUA 2J3TC 2P08A 3IBRA 4EEPA 2B18A 3S7QA 2PT7A 4HJ6A 3OC2A 3KO6A 3PBRA 3RH8B 3KYQA 3VE3A 1KOUA 3FPVA 3LIDA 4GLQA 1EW0A 2J3TD 1P0ZA 1DP9A 3GECA 2WKPA 5DKLA 2FH5A 4O01A 5HDSA 2W3FA 1G28A 4Q0HA 4R3AA 4GW9A 3UMEA 2XRNA 3IBJA 3D3OA 2KLIA 4R6LA 2V9AA 1OT9A 2LB9A 2KX6A 3MR0A 3LR4A 4LPZA 2KDKA 1W63M 3H9WA 4K08A 3MQQA 3MJQA 4WELA 4P6ZM 3PHYA 3EGDC 1T1AA 3JVUA 5IT5A 1LT0A 5HWWA 1IFQA 2YKHA 3EQVA 5HPFA 4MMNA 1V9YA 4IUKA 4CLCC 3OCLA 2V0UA 1P9WA 2M7UA 2INWA 3BQAA 2L4RA 4KQOA 3EQUA 3KX0X 4F3LA 3KYZA 4ZRRA 4MDZA 2W1RA 4GJ4A 3K3DA 1W63Q 4CLCD 5HDDA 1N9LA 3F1OB 1DP6A 3EEAA 3T4LA 3UB9A 5HPIA 3T4OA 3NOTC 5HZHA 3T4JA 2W0NA 3P01A 3LIAA 5HWTA 2KOIA 4GS9B 1UWPX 2W3GA 1STZA 2QKPA 1P9RA 1VHMA 4HOIA 1OTBA 3CITA 5HWVA 4IUHA 3PXPA 4O0PA 3K2NA 4WLAA 5AVFA 5J3WA 5J4EA 1F5MA 4WEJA 4EQ1A 4YOFA 1TS0A 4I3AA 4UQIS 3LFVA 3FC7A 4HI4A 4RQ9A 3D72A 2QYBA 4YNRA 2HJEA 4B9OA 3PBSA 1YSQA 2W1TB 4EESA 3O5YA 3CI6A 4ARZA 3T4QA 2NUTC 4WF0A 2OOLA 5HL6A 3A0VA 4GS9A 3A0RA 4IHQA 3F1NB 1GSVA 2VZWA 4HP4A 2P04A 4I3IA 1LL8A 2PYRA 2VKSA 3UB7A 1LSVA 3NOPC 3LIEA 4FSFA 4UQIM 3BW6A 2D01A 2OAQ1 1S1YA 1UWNX 1DP8A 1YAXA 3VV4A 3TRCA 5F6AA 2W3EA 2VGLS 4WUJA 3BWLA 1WA9A 4WL9A 1NLYA 4BBVA 3F1NA 4UEYA 3EOIA 3TJZC 1MZUA 4G3VA 5J7EA 3H82B 1NRJA 2MJ6A 5TBMB 5G4YA 1H8MA 3NJAA 3PYPA 3KSHA 1S67L 4EUVA 4MCWA 4EW7A 1XJ6A 3T4TA 2HV1A 3C30A 3EEHA 5HSQA 2VGLM 4WEKA 1X0OA 2O99A 2HGVA 3TW8A 2M1CA 2VEAA 2ZMVA 3B42A 5F5YA 3CLOA 2ZBBA 1T19A 3H82A 5TBMA 1BYWA 4ME4A 2PD8A 1XJ2A 4L0LA 1ODVA 4MN6A 2VLGA 3LICA 3S7NA 4F3LB 3UB8A 3LR0A 2O9BA 3BJNA 2GZAA 4EETB 3EWKA 3A0SA 2VV7A 4CQHA 4BMWA 4JGPA 2IA2A 3C38A 4R70A 1S4RA 4LLOB 3T50A 2EA9A 2PHYA 4QPRA 1S66L 4ETXA 4HIAA 2VA0A 5DJTA 4YWZA 4BBUA 2O9AA 2R78A 3GDIA 3H7WB 2JKTM 2B02A 1OTIA 2I9VA 3CUEC 1IOUA 4ARZB 1MKMA 2NUPC 3G6OA 3PR6A 3HJKA 3KSIA 4DJ2A 3LIFA 3PBNA 4JGRA 3CWFA 5DFYA 4HH3A 4IJGA 5IS1A 4MN7A 4KUOA 4Y2FA 2JKTI 4DN0A 3H7WA 1OPXA 1T1BA 4Q0JA 2Z6DA 2L1MA 3TE8A 5K5BA 5HD5A 1P97A 4L9FA 4BJPA 1F98A 4LRZE 5MC7A 4MN5A 1LSXA 1T1CA 2OWJA 1DRMA 5AVEA 5HD3A 5L8MA 2OWHA 3S7OA 4KUKA 1TS8A 3MQ0A 2WKQA 1H3QA 5F68A 1YKDA 3LI8A 2P7JA 1N9NA 4Y3IA 3C8CA 3B47A 2Y79A 3UE6A 2CMNA 4EU0A 1OTDA 3T4KA 3IS2A 4JGQA 4NXFA 4HNBA 2XROA 2XSSA 3MF0A 2JKRM 4BWIA 2JHEA 4OOMA 1OJGA 1NWZA 3ICYA 4EXOA 1TS6A 5I5LA 2J3WA 2LB5A 3MFXA 1LSWA 3ZYTA 5DF9A 3MXQA 4I39A 3F1PB 2W3DA 5DJUA 5F69A 2VX8A 5CX7A 5TJJA 2W27A 1F9IA 2QWSA 2ZOIA 2JKRI 4HQAA 1TD5A 1GSWA 4E04A 3E4OA 3FG8A 2A24A 1G6OA 2K2NA 3LUQA 2A2LA 4LRXC 5AJGA 2O9CA 2HJ9C 1ZHHB 2EWWA 5G4ZA 1Y28A 3MMHA 3ULFA 4PKYA 3OBFA 3R4KA 4KQDA 2HF6A 3LYXA 3OOVA 3E4PA 2PDRA 3F1PA 3EGXC 3MQOA 3PBTA 3NOUC 3W2ZA 4Z1WA 4I38A 5EFWA 4PHTA 4HP9A 2V0WA 2FZ0A 1TS7A 3LI9A 4B93A 5KSHA 2G7UA 5FL3A 2W3HA 1GSXA 2K7SA 2K31A 4HJ3A 1D06A 4HH2A 2Y8HA 4O8GA 3ZQ5A 3OLOA 2ZOHA 3P7NA 3JVVA 2XA7S 3BY9A 2L0WA 4I3JA 3BY8A 2ZMFA 4G3WA 1TF1A 2VV8A 3LIBA 4NEED 1XJ3A 1D7EA 3B33A 2QJ7A 3E4QA 3SW1A 1N9OA 2BASA 1T18A 3VOLA 3OCNA 4OOLA 4FOFA 3R7WB 2O0YA 3LR3A 2JN7A 4NXBA 4L9EA 2M7VA 5IU1A 2GX5A 4CLCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHQ A;  1JNU A;  2WKR A;  2PD7 A;  1S1Z A;  2GJ3 A;  1OTE A;  1XFQ A;  4WN5 A;  4JGO A;  1XFN A;  3IS2 B;  4PKY G;  2PR6 A;  2PR5 A;  4R38 A;  4HJ4 A;  3UB6 A;  2VV6 A;  1OT6 A;  2H28 A;  3F1O A;  4HHD A;  3VE4 A;  3HJI A;  5HDC A;  2QHK A;  4XT2 B;  4L9G A;  2Z6C A;  1OJ5 A;  2J80 A;  1S4S A;  3K3C A;  4GCZ A;  4I5S A;  1XJ4 A;  1VB6 A;  2D02 A;  2V1A A;  2A24 B;  4LRY C;  4NXE A;  4GHI B;  1V9Z A;  3CAX A;  4H6J B;  4DJ3 A;  2QJ5 A;  2V1B A;  2YKF A;  4XT2 A;  5A8B A;  4M4X A;  2PYP A;  5KIZ A;  1OTA A;  4EEU A;  4GHI A;  4H6J A;  3UMD A;  4NXG A;  4EER A;  4BBT A;  5DKK A;  1UGU A;  4HY8 A;  3RTY A;  3C2W A;  3IBR A;  4EEP A;  4HJ6 A;  3RH8 B;  3VE3 A;  1KOU A;  3LID A;  1EW0 A;  1P0Z A;  1DP9 A;  3GEC A;  2WKP A;  5DKL A;  5HDS A;  4R3A A;  1G28 A;  3UME A;  4GW9 A;  4R6L A;  2V9A A;  1OT9 A;  2KX6 A;  3MR0 A;  4LPZ A;  2KDK A;  3H9W A;  4K08 A;  3MQQ A;  3MJQ A;  3PHY A;  1T1A A;  1LT0 A;  5HWW A;  2YKH A;  1V9Y A;  2V0U A;  2INW A;  2L4R A;  3KX0 X;  4F3L A;  3K3D A;  5HDD A;  1N9L A;  3F1O B;  1DP6 A;  3UB9 A;  3NOT C;  5HZH A;  2W0N A;  3LIA A;  5HWT A;  4GS9 B;  1UWP X;  2QKP A;  4HOI A;  1OTB A;  5HWV A;  4WLA A;  5AVF A;  5J3W A;  5J4E A;  4EQ1 A;  1TS0 A;  4I3A A;  3FC7 A;  4HI4 A;  4RQ9 A;  3D72 A;  4B9O A;  4EES A;  4WF0 A;  2OOL A;  3A0V A;  4GS9 A;  3A0R A;  3F1N B;  1GSV A;  4HP4 A;  4I3I A;  1LL8 A;  2PYR A;  3UB7 A;  1LSV A;  3NOP C;  3LIE A;  2D01 A;  1S1Y A;  1UWN X;  1DP8 A;  5F6A A;  4WUJ A;  3BWL A;  1WA9 A;  4WL9 A;  4BBV A;  3F1N A;  1MZU A;  5J7E A;  3H82 B;  5TBM B;  5G4Y A;  3NJA A;  3PYP A;  1S67 L;  4EW7 A;  1XJ6 A;  2HV1 A;  3EEH A;  5HSQ A;  1X0O A;  2M1C A;  2VEA A;  5F5Y A;  3CLO A;  2ZBB A;  1T19 A;  3H82 A;  5TBM A;  1BYW A;  2PD8 A;  1XJ2 A;  1ODV A;  4MN6 A;  2VLG A;  3LIC A;  4F3L B;  3UB8 A;  4EET B;  3EWK A;  3A0S A;  2VV7 A;  4JGP A;  4R70 A;  1S4R A;  4LLO B;  3T50 A;  2EA9 A;  2PHY A;  1S66 L;  4HIA A;  5DJT A;  4YWZ A;  4BBU A;  2R78 A;  3GDI A;  3H7W B;  2B02 A;  1OTI A;  2I9V A;  3G6O A;  3HJK A;  4DJ2 A;  3LIF A;  4JGR A;  3CWF A;  4HH3 A;  5IS1 A;  4KUO A;  3H7W A;  1T1B A;  2Z6D A;  2L1M A;  5HD5 A;  1P97 A;  4L9F A;  1F98 A;  4LRZ E;  4MN5 A;  1LSX A;  1T1C A;  2OWJ A;  1DRM A;  5AVE A;  5HD3 A;  2OWH A;  4KUK A;  1TS8 A;  2WKQ A;  5F68 A;  3LI8 A;  2P7J A;  1N9N A;  3C8C A;  3UE6 A;  2CMN A;  1OTD A;  3IS2 A;  4JGQ A;  4NXF A;  4HNB A;  2JHE A;  1OJG A;  1NWZ A;  3ICY A;  4EXO A;  1TS6 A;  5I5L A;  3MFX A;  1LSW A;  3MXQ A;  4I39 A;  3F1P B;  5DJU A;  5F69 A;  2W27 A;  1F9I A;  2QWS A;  2ZOI A;  4HQA A;  1GSW A;  4E04 A;  3E4O A;  3FG8 A;  2A24 A;  3LUQ A;  4LRX C;  5G4Z A;  1Y28 A;  3ULF A;  4PKY A;  4KQD A;  3LYX A;  3E4P A;  2PDR A;  3F1P A;  3MQO A;  3NOU C;  4I38 A;  5EFW A;  4HP9 A;  2V0W A;  1TS7 A;  3LI9 A;  1GSX A;  2K7S A;  4HJ3 A;  1D06 A;  4HH2 A;  3ZQ5 A;  3OLO A;  2ZOH A;  3P7N A;  3BY9 A;  2L0W A;  4I3J A;  3BY8 A;  2VV8 A;  3LIB A;  1XJ3 A;  1D7E A;  3B33 A;  2QJ7 A;  3E4Q A;  3SW1 A;  1N9O A;  2BAS A;  1T18 A;  3VOL A;  2JN7 A;  4NXB A;  4L9E A;  5IU1 A; 
#chains in the Genus database with same CATH topology
 3NHQ A;  5CTM A;  5EOO A;  2WKR A;  2GJ3 A;  1OTE A;  4RX3 A;  1WYB A;  2P9V B;  3LR5 A;  4PAU A;  5EV0 A;  3T12 B;  1BUE A;  1XFN A;  2PR6 A;  4R38 A;  3ZFZ A;  3C4O A;  4DXC A;  3HLG A;  3KSG A;  4X69 A;  1OT6 A;  2H28 A;  5E2F A;  4HHD A;  2PAV P;  4XT2 B;  4L9G A;  3SH9 A;  4X56 A;  5CER A;  1HD8 A;  3K3C A;  3VP0 A;  4QHC A;  3UE1 A;  4QD4 A;  2V1A A;  4LRY C;  5FQI A;  1V9Z A;  4YFM A;  3VFH A;  4ZDX A;  2H0Y A;  3CAX A;  3GMW A;  4MBK A;  4K0X A;  3UN7 A;  4DJ3 A;  2HDQ A;  2V1B A;  2HP6 A;  4XT2 A;  1PYY A;  5DFX A;  5EUA A;  4QU3 A;  2H0T A;  4OQI A;  3PBQ A;  2X02 A;  5KIZ A;  1NJ4 A;  2PU2 A;  4KZB A;  5C5K A;  3PBO A;  3Q1F A;  3VFF A;  2WKE A;  3UMD A;  4DE3 A;  2JC7 A;  2OAP 1;  3NY4 A;  4EER A;  2Y2P A;  5DKK A;  4HY8 A;  4P6Z S;  3C2W A;  2B18 A;  3Q7Z A;  3HL9 A;  4KQQ A;  3PBR A;  1KGG A;  2JBF A;  3NDG A;  1EW0 A;  4O01 A;  5HDS A;  2W3F A;  3UME A;  4DXB A;  4GDN A;  3D3O A;  2V9A A;  3MZE A;  1OT9 A;  1PWC A;  1FSW A;  3LR4 A;  3FZC A;  3LGO A;  4U0X A;  5IHV A;  3MQQ A;  4HEF A;  4KZ4 A;  2YKH A;  3QNC A;  3E2L A;  2V0U A;  2M7U A;  2L4R A;  2ZC6 B;  5GHZ A;  3A3F A;  3KYZ A;  1XXM A;  2W1R A;  4CLC D;  3DWZ A;  4JPM A;  3LIA A;  4WMC D;  1YLY A;  1UWP X;  2QKP A;  1SDE A;  1ZG6 A;  1BLC A;  4O0P A;  4B88 A;  5J3W A;  1VET A;  4OKP A;  4YOF A;  1TS0 A;  4I3A A;  4RA7 A;  1VQQ A;  2HDR A;  3PBS A;  3VP1 A;  4E3M A;  4WF0 A;  2XLN A;  5HL6 A;  3WS0 A;  4HP4 A;  2PYR A;  4LV1 A;  4NET A;  3UB7 A;  3ITB A;  1PW1 A;  4FSF A;  3HLF A;  4QB8 A;  3QNB A;  1YQS A;  3FKW A;  2VGL S;  4WUJ A;  5FAQ A;  1ES2 A;  2VGK A;  5CEC A;  1MZU A;  3IX3 A;  5J7E A;  5TBM B;  1ERM A;  3NJA A;  4MEZ A;  3PTE A;  3C30 A;  3IWQ A;  3HUN A;  5GLA A;  4WEK A;  2Y2M A;  2O99 A;  2UV0 E;  5EVL A;  3T1S A;  4ID4 A;  5F5Y A;  5TBM A;  4ME4 A;  3V5M A;  1XJ2 A;  1ODV A;  1XGJ A;  2VLG A;  2Q9M A;  3LIC A;  3LR0 A;  3BJN A;  4X6T A;  4DF6 A;  3BFG A;  1O7E A;  2ZQC A;  3A0S A;  1BUL A;  3IXB A;  5EPH A;  5HAI A;  4LCM A;  2IA2 A;  3C38 A;  3A3J A;  2V2F F;  2EA9 A;  3FWL A;  4KZ3 A;  5L09 A;  4NK3 A;  2VA0 A;  3L7H A;  4PM7 A;  5DJT A;  4E6W A;  4WM9 A;  4E3O A;  1GA9 A;  1OTI A;  3D4F A;  3QHY A;  4JF6 A;  4HES A;  4KG6 A;  2NUP C;  3G6O A;  4KZ5 A;  3LIF A;  3LY4 A;  1PIO A;  3UDI A;  5IS1 A;  4P0M A;  3L9K A;  4EUZ A;  1G68 A;  2WGI A;  4O7D A;  1ZG4 A;  5EVI A;  4MLL A;  1OPX A;  2ZQ8 A;  4LV3 A;  4Q0J A;  5TGF A;  2Z6D A;  4L9F A;  4LRZ E;  5MC7 A;  2OWJ A;  1DRM A;  2CC1 A;  5CTN A;  1XPB A;  1FR6 A;  5L8M A;  4KUK A;  1TS8 A;  3MQ0 A;  3MS6 A;  1H3Q A;  1Z6F A;  1MWT A;  3B47 A;  4OP8 A;  1C3B A;  4PM5 A;  4EU0 A;  4Z9Q A;  1M40 A;  2H5S A;  4JGQ A;  2XSS A;  2IWC A;  3MF0 A;  3UPP A;  2JHE A;  4OOM A;  1OJG A;  5EEC A;  2ZD8 A;  2J3W A;  3MFX A;  2I72 A;  4BL2 A;  4LV0 A;  1PW8 A;  4I39 A;  2WK0 A;  2W3D A;  1JWZ A;  2XH9 A;  1FIK A;  1F9I A;  2QWS A;  2ZOI A;  2JKR I;  1K57 C;  3E4O A;  1L0D A;  2A24 A;  3TOI A;  1L0G A;  2A2L A;  5AJG A;  4N9K A;  2QMI A;  1Y28 A;  1IEM A;  4PKY A;  2HF6 A;  4LFU A;  3OOV A;  3MSH A;  5CHM A;  1DJC A;  5DVA A;  3W2Z A;  2ZMA A;  2V8F A;  3BEB A;  3LY3 A;  4HP9 A;  1RP5 A;  4BD1 A;  3NI9 A;  3BEC A;  2OLU A;  1YMX A;  2PBD P;  2EX2 A;  4ZJ1 A;  4B93 A;  5KSH A;  5FL3 A;  1K56 D;  3T1X A;  1D06 A;  2Y8H A;  3OLO A;  5GLD A;  4BLM A;  1FR1 A;  3JVV A;  4BD0 A;  4NG2 A;  2WAF A;  1TF1 A;  3V3R A;  3NCK A;  2WAD A;  5FQQ A;  4KZ8 A;  3B33 A;  1K54 C;  3IXD A;  1T18 A;  1NXY A;  1K4F A;  1MXO A;  5U47 A;  2JKG A;  3VP3 A;  5FQJ A;  4NXB A;  3DTM A;  3NC8 A;  4L9E A;  1PZO A;  4IBX A;  1K6S A;  2Z2L B;  5CGS A;  2JCH A;  3AGD A;  2XA7 M;  5GHX A;  4XUX A;  2PBY A;  1S1Z A;  2PD7 A;  1ACF A;  2EFU A;  3P09 A;  4OH0 A;  3IS2 B;  4PKY G;  5TR7 A;  2Y59 A;  1KGF A;  3BQ8 A;  4S2N A;  1JTD A;  2VJW A;  2BLS A;  3ISG A;  4NKP A;  2VV6 A;  4II7 A;  3F1O A;  1ESI A;  3OZH A;  3HJI A;  4ETZ A;  2GNX A;  3G31 A;  3T4S A;  2QHK A;  3LCE A;  4KQR A;  4WZ4 A;  2J80 A;  3WS2 A;  3ZG7 B;  4P6B A;  1FCN A;  3Q82 A;  5CGX A;  5CEB A;  1M6K A;  2XFS A;  4MNR A;  4EBN A;  4OPR A;  3ZNT A;  1TDG A;  4H6J B;  2QJ5 A;  2Y2J A;  3QP4 A;  2A49 A;  3U4L P;  2W1T A;  3RFB A;  4M4X A;  2V1Z A;  4ZAM A;  4E3N A;  5FEF A;  1FIL A;  1YLW A;  3IF6 C;  2IWB A;  2IWD A;  2V8C A;  3IH9 A;  4H6J A;  3AGE A;  1CK3 A;  2ZL1 A;  3RTY A;  2J3T C;  2P08 A;  3IBR A;  4EEP A;  4HJ6 A;  3QP8 A;  3KO6 A;  1BT5 A;  3RH8 B;  3VE3 A;  1KOU A;  3FPV A;  3QP5 A;  2ZM2 A;  2FH5 A;  1XKZ A;  4EBL A;  3S1Y A;  5AQ7 A;  4GW9 A;  3IBJ A;  2KLI A;  4R6L A;  1BLS A;  2AVX A;  1IYS A;  4OQH A;  3W4O A;  5HWW A;  3IXG A;  4GB7 A;  4LV2 A;  4N1X A;  3EQV A;  5A90 A;  3O87 A;  1XP4 A;  5HPF A;  2FFY A;  5FQ9 A;  2INW A;  3BQA A;  3IT9 A;  3HLE A;  1SHV A;  4F3L A;  3OPP A;  3M2J A;  4S2M A;  4MDZ A;  5F83 A;  1N9L A;  4MBH A;  2J8Y A;  1Y54 A;  1K0K A;  4HBT A;  3ZG9 B;  5HPI A;  2W0N A;  4C6Y A;  4GS9 B;  2Y2Q A;  2WZZ A;  1STZ A;  1P9R A;  4IUH A;  5DTS A;  1CI9 A;  4X68 A;  4WLA A;  1I2W A;  4EQ1 A;  4JF4 A;  4JXV A;  4MBF A;  4RQ9 A;  2Y2O A;  3O5Y A;  1SKF A;  2OOL A;  4GS9 A;  2PRF A;  3A0R A;  4I3I A;  1FCM A;  3HVF A;  2Q0O A;  1W5D A;  3ZG8 B;  4UQI M;  2J9O A;  1FSY A;  3BW6 A;  2D01 A;  3SS5 A;  1UWN X;  1XA7 A;  5F6A A;  3NBL A;  2W3E A;  1ES3 A;  1IYQ A;  4BBV A;  2HP9 A;  5FI7 A;  3H82 B;  1NRJ A;  2HDS A;  2MJ6 A;  4FTX A;  5G4Y A;  1H8M A;  3PYP A;  3BYD A;  1S67 L;  4EUV A;  3MXS A;  3UPN A;  3T4T A;  2C6W B;  1Q2Q A;  2DRW A;  2HV1 A;  5HSQ A;  1L2S A;  3GV9 A;  3HLD A;  4JXS A;  2ZBB A;  2WUQ A;  3H82 A;  4FH2 A;  5D3O A;  1BYW A;  4MN6 A;  5HAR A;  1DJB A;  1MKI A;  4PM8 A;  5A92 A;  3WRZ A;  1Y4O A;  1J3W A;  1MWR A;  1H8Y A;  1ONG A;  5FQM A;  2VV7 A;  4D60 A;  1K25 A;  5JYP A;  4X53 A;  1U60 A;  4PMA A;  5FA7 A;  1L0E A;  1HVB A;  1MY8 A;  1S4R A;  4LLO B;  3T50 A;  2GDN A;  2J9P A;  3O88 A;  4QPR A;  1NZO A;  1JVJ A;  4YWZ A;  3GRJ A;  3WS4 A;  1VET B;  4BBU A;  2R78 A;  3BRM A;  4JXG A;  4XXR A;  3H7W B;  4R1G A;  2JKT M;  2B02 A;  2EFX A;  3CUE C;  1FCO A;  4FH4 A;  3WS1 A;  1IOU A;  1MKM A;  3QP1 A;  3FYZ A;  3HJK A;  3KSI A;  2X71 A;  4IJG A;  4KUO A;  3ZNY A;  4RVA A;  4Y2F A;  4X1L A;  5FEG A;  2ZQA A;  4DN0 A;  3QP2 A;  1E3U D;  2HPB A;  3H7W A;  1T1B A;  2ZC7 A;  2L1M A;  1F98 A;  5F1G A;  4ZBE A;  1LSX A;  5HD3 A;  1AXB A;  1RCJ A;  5EVE A;  2OWH A;  3S7O A;  2H10 A;  3VSL A;  2VK3 A;  1SZV A;  1PRQ A;  3IHB A;  2WKQ A;  5F68 A;  1K55 C;  1W8Y A;  3GR2 A;  3LI8 A;  5JYO A;  2ZM0 A;  4Y3I A;  5FAP A;  2CMN A;  5FI2 A;  3Q07 A;  4PPR A;  2EXB A;  1OTD A;  4Y15 A;  5BOH A;  4NXF A;  4HNB A;  4OQ0 A;  5GLC A;  3AGF A;  1FQG A;  1AWI A;  3M6H A;  3VMA A;  1NWZ A;  3A3E A;  3ICY A;  2E8I A;  1MPL A;  4FD8 A;  3ZYT A;  4Y7P A;  4RYE A;  5HAP A;  3MXQ A;  1MWS A;  5F69 A;  5CX7 A;  5CED A;  2W27 A;  4UHU A;  2A3U A;  3LEQ A;  4E04 A;  1G6O A;  3V50 A;  2K2N A;  4UA7 A;  1ESU A;  5CHU A;  2VGJ A;  4GDB A;  1H5X A;  2WYX A;  3OBF A;  3BM6 A;  3W4P A;  5A91 A;  4I38 A;  1TS7 A;  5L2F A;  1LL9 A;  2FFF B;  5DTK A;  3CJM A;  2XQZ A;  4GOG A;  4M3K A;  5EVI C;  4DE0 A;  1GSX A;  2K7S A;  4Q8I A;  4GD8 A;  3LEZ A;  4WZ5 A;  1ALQ A;  4S2O A;  1SCW A;  2XA7 S;  3BY9 A;  5EVI B;  4R23 A;  3MZD A;  4G3W A;  4FCF A;  3IX8 A;  1S0W A;  1ZC2 A;  3GSG A;  3LIB A;  3MKF A;  4NEE D;  1XJ3 A;  4E3L A;  5HAQ A;  1L0F A;  1N9O A;  1QMF A;  2PU4 A;  2BAS A;  3VOL A;  3UY6 A;  1CI8 A;  3LR3 A;  3UDF A;  4GKU A;  5L07 A;  2R9X A;  4CLC B;  1W79 A;  3G2Z A;  1JNU A;  4DKI A;  4CLC E;  1PI4 A;  1XFQ A;  4WN5 A;  2EWV A;  3DAV A;  2PR5 A;  3U2A A;  3WWX A;  3DTK A;  5L10 A;  4DDY A;  3IX4 A;  1KGE A;  3UB6 A;  4CLC A;  3VE4 A;  5HDC A;  5DF8 A;  5TFQ A;  2WKI A;  1W7F A;  3A3D A;  2Z6C A;  1YLZ A;  4GCZ A;  4PM9 A;  1XJ4 A;  1F2K A;  3V67 A;  4WMC A;  1VB6 A;  4U0T A;  2A24 B;  4GHI B;  4G3K A;  3FPW A;  3V39 A;  3S7P A;  3CZD A;  4KEN B;  2YKF A;  4WBG A;  1A0K A;  2ZLY A;  5GLB A;  2Y2L A;  3KSF A;  1MWU A;  3RXW A;  4EEU A;  4GHI A;  1BLH A;  1YMS A;  3UPO A;  3SZT A;  3HUO A;  1UGU A;  1TDL A;  5E43 A;  4N9L A;  1ZTU A;  3JYI A;  2EX6 A;  3UO9 A;  3DTE A;  3S7Q A;  5EOE A;  2HDU A;  3OC2 A;  3N4I A;  3KYQ A;  1WYC A;  5KSC A;  3LID A;  1K6R A;  1CEF A;  4GLQ A;  2ZC3 B;  2J3T D;  4JF5 A;  1P0Z A;  5CGW A;  2WKP A;  5DKL A;  3IWI A;  4R3J A;  1YLJ A;  2KX6 A;  3MR0 A;  1JWV A;  2KDK A;  2P74 A;  4K08 A;  3IHA A;  1NYM A;  1T1A A;  3EGD C;  5IT5 A;  1LT0 A;  4S2N C;  2Y55 A;  2ZQ9 A;  1SDN A;  1VEU B;  4MMN A;  1V9Y A;  3G32 A;  4KQO A;  1JWP A;  1S6R A;  1BLP A;  4ZRR A;  2XGN A;  3MFD A;  4GJ4 A;  4LGW A;  3F1O B;  1DP6 A;  4IVK A;  3EEA A;  5M18 A;  3T4L A;  1HZO A;  2Y91 A;  3FKV A;  3T4O A;  3NOT C;  4DDS A;  3T4J A;  4S2K A;  1VEU A;  3P01 A;  3CG5 A;  2ZC5 B;  3OPH A;  4KZ9 A;  5AQ9 A;  5E2G A;  1OTB A;  2Y2I A;  3PAE A;  5HWV A;  3HLC A;  1I5Q A;  2G2W A;  3K2N A;  1KE3 A;  2ZC4 B;  4WEJ A;  5M1A A;  2XK1 A;  4UQI S;  3C4P A;  4X1M A;  4HI4 A;  3D72 A;  4YNR A;  2HJE A;  1YSQ A;  1ES4 A;  2W1T B;  4S2L A;  4ARZ A;  1GHI A;  3F1N B;  5AQB A;  2P04 A;  1LL8 A;  2VKS A;  1K54 A;  3N8L A;  1LSV A;  3NOP C;  3LIE A;  5HL1 A;  4CJN A;  1GA0 A;  2OAQ 1;  3VV4 A;  2ZL1 B;  5FAO A;  3TRC A;  1LI0 A;  3NDE A;  3M6B A;  1FOF A;  1WA9 A;  1NLY A;  3F1N A;  4UEY A;  4G3V A;  4Y0O A;  3KSH A;  4OPZ A;  3LO7 A;  1WE4 A;  1PWD A;  1XGI A;  4MCW A;  4EW7 A;  1XJ6 A;  3ZDJ A;  2R9W A;  3EEH A;  3C5A A;  3S22 A;  3CMZ A;  1LL5 A;  1X0O A;  4OLD A;  4OLG A;  4OVD A;  3VP2 A;  3MKE A;  3UE0 A;  3CLO A;  1T19 A;  4L0L A;  4F3L B;  3UB8 A;  1CEG A;  2O9B A;  3Q7V B;  4IBR A;  3SS4 A;  4A5R A;  2DNS A;  4EET B;  3EWK A;  5DTT A;  4CQH A;  4BMW A;  1KVL A;  5EE8 A;  4JGP A;  4GN2 A;  4BEN A;  4B4X A;  2XEP A;  3MXR A;  5CHJ A;  1S66 L;  1BZA A;  2EXA A;  4HIA A;  3Q7V A;  3IF6 A;  1KE4 A;  1KVM A;  4ZJ2 A;  3GDI A;  4UAA A;  3UNW A;  1G6A A;  3PR6 A;  4P85 A;  1W8Q A;  4KZ6 A;  1ERQ A;  1OME A;  1K56 A;  3PBN A;  4JGR A;  1N4O A;  3CWF A;  5DFY A;  1CJF A;  4MN7 A;  1YM1 A;  1YPR A;  1XX2 A;  4BQM A;  3TE8 A;  5K5B A;  5HD5 A;  1P97 A;  4BJP A;  4MN5 A;  1IYO A;  2ZJ9 A;  4QY6 A;  4IED A;  5FSR A;  3C8C A;  4Y13 A;  4LCL A;  2Q9N A;  2P9V A;  3G30 A;  3T4K A;  4X55 A;  1ES5 A;  3OPR A;  2XRO A;  5AQA A;  3IF5 A;  2JKR M;  2XFT A;  4BWI A;  1TS6 A;  2HP5 A;  2QPN A;  1LSW A;  5DF9 A;  4N92 A;  5DJU A;  3E2K A;  2VX8 A;  5TJJ A;  1YLT A;  4ZJ3 A;  5FAS A;  5E2E A;  3ZHH A;  3RJU A;  4GD6 A;  1SKO B;  4LRX C;  2O9C A;  2HJ9 C;  5G4Z A;  4R4S A;  3N7W A;  4KQD A;  4S2I A;  3LYX A;  1IKG A;  3MQO A;  3PBT A;  2BG1 A;  3VOZ A;  2V0W A;  3G4P A;  2WGV A;  3T1R A;  3LI9 A;  1K38 A;  4E3J A;  1SKO A;  2G7U A;  2W3H A;  1JTG A;  3RXX A;  4JKT A;  2K31 A;  3N8R A;  3SH7 A;  4HH2 A;  3ZQ5 A;  3C7U A;  4GZB A;  1L3L A;  2XDM A;  5EVI D;  4OQG A;  5FDH A;  4I3J A;  3BY8 A;  3CPT B;  4GNU A;  2Y2H A;  1D7E A;  1BTL A;  2XD1 A;  3OCN A;  3R7W B;  4JXW A;  2O0Y A;  2JN7 A;  2RCX A;  4E6X A;  3P98 A;  5E2H A;  5IU1 A;  1NRF A;  2HZ5 A;  4Y5F A;  2DMW A;  3W8K A;  2Y2K A;  5KMW A;  1HLU P;  4FUW A;  3CPT A;  1LLB A;  4F94 A;  4JGO A;  1E25 A;  3HCY A;  2E8J A;  4HJ4 A;  4EBP A;  3R7W A;  2XD5 A;  4DMZ A;  2EX8 A;  4WYY A;  3CHW P;  4Y17 A;  4OON A;  3O3V A;  4JLF A;  4Q0I A;  2DCF A;  3UE3 A;  5LBR A;  1OJ5 A;  1YSP A;  1S4S A;  3WS5 A;  3G34 A;  1DJA A;  3ZG5 A;  3DTI A;  4I5S A;  2WGW B;  1ZKJ A;  4AFI A;  2D02 A;  4NXE A;  3CUE A;  3HLW A;  4LEN A;  5I94 A;  3G35 A;  2Y2N A;  3E0Y A;  3VOY A;  1Z09 A;  4H8R A;  5A8B A;  1NLZ A;  3E98 A;  2BTF P;  1PNE A;  1BSG A;  3DBA A;  2PYP A;  3I7J A;  1H0M A;  2WKH A;  2WGW A;  3D9Y A;  1OTA A;  3M2K A;  3BFE A;  4WZ5 C;  2J7V A;  1MC0 A;  4ESP A;  4NXG A;  5GHY A;  3MZF A;  3Q81 A;  4BBT A;  1GHP A;  2XR0 A;  3DW0 A;  1K55 A;  1PWG A;  3OPL A;  3HBR A;  2PT7 A;  3HRE A;  1XA1 A;  4KG5 A;  2ACG A;  1KDS A;  4R3B A;  1E4D A;  1DP9 A;  3GEC A;  3C7V A;  4R3A A;  1G28 A;  4Q0H A;  2XRN A;  3ZGA B;  3IXH A;  2LB9 A;  3BLM A;  4LPZ A;  4E3K A;  1W63 M;  3H9W A;  3MJQ A;  4WEL A;  4P6Z M;  3PHY A;  2UWX A;  3JVU A;  4KG2 A;  1IFQ A;  4B4Z A;  1IYP A;  3ZVT A;  3HLB A;  4IUK A;  3SS3 A;  4CLC C;  3OCL A;  1P9W A;  3EQU A;  3KX0 X;  1PI5 A;  1EI5 A;  4BL3 A;  3HUM A;  2C5W B;  2RL3 A;  3K3D A;  1W63 Q;  3B3X A;  5HDD A;  3TSG A;  4DE2 A;  2EX9 A;  1YT4 A;  1I2S A;  3IWO A;  3UB9 A;  4C3Q A;  5HZH A;  4KZ7 A;  5HWT A;  2KOI A;  2WZX A;  2W3G A;  5CXW A;  4EQI A;  1VHM A;  4HOI A;  5G18 A;  3CIT A;  3PXP A;  5AVF A;  1J9M A;  5J4E A;  1F5M A;  4R4R A;  1K4E A;  3LFV A;  3FC7 A;  4RX2 A;  2QYB A;  4B9O A;  4E3I A;  4S2J A;  4EES A;  3CI6 A;  4N1H A;  4UA6 A;  1O07 A;  3T4Q A;  2NUT C;  3A0V A;  4IHQ A;  5KZH A;  4OPQ A;  3S4X A;  1GSV A;  2VZW A;  5HW3 A;  1QME A;  4QY5 A;  3V3S A;  1S1Y A;  1E3U A;  1YAX A;  1DP8 A;  4CPK A;  2OSU A;  2B5R A;  1VM1 A;  2Y4A A;  3ZVW A;  3VP4 A;  3BWL A;  1H8Z A;  4KZA A;  4WL9 A;  1D1J A;  3EOI A;  3TJZ C;  5HFO A;  5FDS A;  3FV7 A;  1GCE A;  1HTZ A;  2VGL M;  4QJG A;  1N9B A;  4QWO A;  2HGV A;  3TW8 A;  4UA9 A;  2M1C A;  2VEA A;  2ZMV A;  4OP5 A;  4OPY A;  4K91 A;  3B42 A;  2PD8 A;  3S7N A;  1NZU A;  4Y0T A;  1RGY A;  2GZA A;  3BFC A;  2OLV A;  4XUZ A;  3SOI A;  3UDX A;  1PFL A;  1CQA A;  4R70 A;  4OOY A;  1K57 A;  3BLS A;  2ZM8 A;  2PHY A;  3A3I A;  4ETX A;  3GVB A;  1NY0 A;  2JKF A;  2O9A A;  4K0W A;  4PM6 A;  3IH8 A;  4DRT A;  2I9V A;  4ARZ B;  1ONH A;  2X01 A;  4JBF A;  4DJ2 A;  1KE0 A;  4HH3 A;  1G5U A;  2JKT I;  3MBZ A;  5F82 A;  4S2P A;  3ITA A;  5FAT A;  3ZG0 A;  1LHY A;  3N6I A;  2G2U A;  1T1C A;  5AVE A;  2ZQ7 A;  1CF0 A;  3BFF A;  3GTC A;  5F1F A;  3QP6 A;  4EWF A;  4X25 A;  5GL9 A;  1GHM A;  5FQK A;  1YKD A;  2P7J A;  1N9N A;  1ERO A;  2Y79 A;  3UE6 A;  5J8X A;  5EM1 A;  5DF7 A;  3IS2 A;  5M19 A;  3VSK A;  2XF3 A;  2V20 A;  4DE1 A;  4EXO A;  5I5L A;  1YLP A;  2LB5 A;  3NUL A;  3ZCZ A;  5HX9 A;  3SH8 A;  2Y2G A;  3PAG A;  1Q2P A;  3F1P B;  3GQZ A;  4R0Q A;  1NYY A;  1EWZ A;  4HQA A;  2QZ6 A;  1PZP A;  1TD5 A;  1GSW A;  1DY6 A;  5CRF A;  3FG8 A;  4D2O A;  1IKI A;  4U3T A;  3LUQ A;  5FI6 A;  3BFD A;  1ZHH B;  2EWW A;  1RGZ A;  3MMH A;  3G2Y A;  3UB5 P;  3ULF A;  4YIN A;  2WAE A;  4HBU A;  3R4K A;  5A93 A;  1KDW A;  3E4P A;  2PDR A;  3F1P A;  3EGX C;  3W4Q A;  3KYE A;  3IF6 B;  3NOU C;  1TVF A;  4Z1W A;  3NIA A;  5EFW A;  4PHT A;  2ZQD A;  2FZ0 A;  4IVI A;  1MBL A;  3IQA A;  3N8S A;  4HJ3 A;  3DWK A;  4O8G A;  2Z2M B;  1IEL A;  2ZOH A;  3P7N A;  2L0W A;  4ZTK A;  2ZMF A;  3NEC A;  3TG9 A;  2VV8 A;  2QJ7 A;  3E4Q A;  3JPU A;  5EM0 A;  4C75 A;  4EV4 A;  1LI9 A;  3SW1 A;  2OV5 A;  4P87 A;  4OOL A;  4FOF A;  3T1Q B;  4Y0U A;  1TEM A;  2B95 A;  2M7V A;  3O86 A;  3WRT A;  2JE5 A;  2GX5 A; 
#chains in the Genus database with same CATH homology
 3NHQ A;  2XA7 M;  1JNU A;  2WKR A;  4Y5F A;  4CLC E;  2DMW A;  2PD7 A;  1S1Z A;  2GJ3 A;  1OTE A;  1XFQ A;  3LR5 A;  4PAU A;  4WN5 A;  4JGO A;  1XFN A;  3HCY A;  3IS2 B;  2EWV A;  4PKY G;  2PR6 A;  2PR5 A;  4R38 A;  3U2A A;  4HJ4 A;  3R7W A;  3BQ8 A;  2VJW A;  3KSG A;  4NKP A;  4DMZ A;  3UB6 A;  2VV6 A;  4II7 A;  1OT6 A;  2H28 A;  3F1O A;  4HHD A;  3VE4 A;  3HJI A;  4CLC A;  4ETZ A;  4Q0I A;  5HDC A;  2GNX A;  3T4S A;  2QHK A;  4XT2 B;  4L9G A;  5LBR A;  3UE3 A;  2Z6C A;  1OJ5 A;  1YSP A;  2J80 A;  1S4S A;  3K3C A;  4GCZ A;  4I5S A;  1XJ4 A;  3V67 A;  4AFI A;  1VB6 A;  2D02 A;  2V1A A;  2A24 B;  4LRY C;  4NXE A;  4GHI B;  3CUE A;  1V9Z A;  4G3K A;  3CAX A;  4H6J B;  3FPW A;  4DJ3 A;  3S7P A;  2QJ5 A;  2V1B A;  3E0Y A;  2YKF A;  5DFX A;  4XT2 A;  5A8B A;  1NLZ A;  3E98 A;  2W1T A;  3PBQ A;  3RFB A;  4M4X A;  3DBA A;  2PYP A;  5KIZ A;  3KSF A;  1OTA A;  4EEU A;  4GHI A;  5C5K A;  3PBO A;  1MC0 A;  4H6J A;  3UMD A;  4NXG A;  2OAP 1;  4EER A;  4BBT A;  5DKK A;  1UGU A;  4HY8 A;  4P6Z S;  3RTY A;  3C2W A;  1ZTU A;  2J3T C;  2P08 A;  3IBR A;  4EEP A;  2B18 A;  3S7Q A;  2PT7 A;  4HJ6 A;  3OC2 A;  3KO6 A;  3PBR A;  3RH8 B;  3KYQ A;  3VE3 A;  1KOU A;  3FPV A;  3LID A;  4GLQ A;  1EW0 A;  2J3T D;  1P0Z A;  1DP9 A;  3GEC A;  2WKP A;  5DKL A;  2FH5 A;  4O01 A;  5HDS A;  2W3F A;  1G28 A;  4Q0H A;  4R3A A;  4GW9 A;  3UME A;  2XRN A;  3IBJ A;  3D3O A;  2KLI A;  4R6L A;  2V9A A;  1OT9 A;  2LB9 A;  2KX6 A;  3MR0 A;  3LR4 A;  4LPZ A;  2KDK A;  1W63 M;  3H9W A;  4K08 A;  3MQQ A;  3MJQ A;  4WEL A;  4P6Z M;  3PHY A;  3EGD C;  1T1A A;  3JVU A;  5IT5 A;  1LT0 A;  5HWW A;  1IFQ A;  2YKH A;  3EQV A;  5HPF A;  4MMN A;  1V9Y A;  4IUK A;  4CLC C;  3OCL A;  2V0U A;  1P9W A;  2M7U A;  2INW A;  3BQA A;  2L4R A;  4KQO A;  3EQU A;  3KX0 X;  4F3L A;  3KYZ A;  4ZRR A;  4MDZ A;  2W1R A;  4GJ4 A;  3K3D A;  1W63 Q;  4CLC D;  5HDD A;  1N9L A;  3F1O B;  1DP6 A;  3EEA A;  3T4L A;  3UB9 A;  5HPI A;  3T4O A;  3NOT C;  5HZH A;  3T4J A;  2W0N A;  3P01 A;  3LIA A;  5HWT A;  2KOI A;  4GS9 B;  1UWP X;  2W3G A;  1STZ A;  2QKP A;  1P9R A;  1VHM A;  4HOI A;  1OTB A;  3CIT A;  5HWV A;  4IUH A;  3PXP A;  4O0P A;  3K2N A;  4WLA A;  5AVF A;  5J3W A;  5J4E A;  1F5M A;  4WEJ A;  4EQ1 A;  4YOF A;  1TS0 A;  4I3A A;  4UQI S;  3LFV A;  3FC7 A;  4HI4 A;  4RQ9 A;  3D72 A;  2QYB A;  4YNR A;  2HJE A;  4B9O A;  3PBS A;  1YSQ A;  2W1T B;  4EES A;  3O5Y A;  3CI6 A;  4ARZ A;  3T4Q A;  2NUT C;  4WF0 A;  2OOL A;  5HL6 A;  3A0V A;  4GS9 A;  3A0R A;  4IHQ A;  3F1N B;  1GSV A;  2VZW A;  4HP4 A;  2P04 A;  4I3I A;  1LL8 A;  2PYR A;  2VKS A;  3UB7 A;  1LSV A;  3NOP C;  3LIE A;  4FSF A;  4UQI M;  3BW6 A;  2D01 A;  2OAQ 1;  1S1Y A;  1UWN X;  1DP8 A;  1YAX A;  3VV4 A;  3TRC A;  5F6A A;  2W3E A;  2VGL S;  4WUJ A;  3BWL A;  1WA9 A;  4WL9 A;  1NLY A;  4BBV A;  3F1N A;  4UEY A;  3EOI A;  3TJZ C;  1MZU A;  4G3V A;  5J7E A;  3H82 B;  1NRJ A;  2MJ6 A;  5TBM B;  5G4Y A;  1H8M A;  3NJA A;  3PYP A;  3KSH A;  1S67 L;  4EUV A;  4MCW A;  4EW7 A;  1XJ6 A;  3T4T A;  2HV1 A;  3C30 A;  3EEH A;  5HSQ A;  2VGL M;  4WEK A;  1X0O A;  2O99 A;  2HGV A;  3TW8 A;  2M1C A;  2VEA A;  2ZMV A;  3B42 A;  5F5Y A;  3CLO A;  2ZBB A;  1T19 A;  3H82 A;  5TBM A;  1BYW A;  4ME4 A;  2PD8 A;  1XJ2 A;  4L0L A;  1ODV A;  4MN6 A;  2VLG A;  3LIC A;  3S7N A;  4F3L B;  3UB8 A;  3LR0 A;  2O9B A;  3BJN A;  2GZA A;  4EET B;  3EWK A;  3A0S A;  2VV7 A;  4CQH A;  4BMW A;  4JGP A;  2IA2 A;  3C38 A;  4R70 A;  1S4R A;  4LLO B;  3T50 A;  2EA9 A;  2PHY A;  4QPR A;  1S66 L;  4ETX A;  4HIA A;  2VA0 A;  5DJT A;  4YWZ A;  4BBU A;  2O9A A;  2R78 A;  3GDI A;  3H7W B;  2JKT M;  2B02 A;  1OTI A;  2I9V A;  3CUE C;  1IOU A;  4ARZ B;  1MKM A;  2NUP C;  3G6O A;  3PR6 A;  3HJK A;  3KSI A;  4DJ2 A;  3LIF A;  3PBN A;  4JGR A;  3CWF A;  5DFY A;  4HH3 A;  4IJG A;  5IS1 A;  4MN7 A;  4KUO A;  4Y2F A;  2JKT I;  4DN0 A;  3H7W A;  1OPX A;  1T1B A;  4Q0J A;  2Z6D A;  2L1M A;  3TE8 A;  5K5B A;  5HD5 A;  1P97 A;  4L9F A;  4BJP A;  1F98 A;  4LRZ E;  5MC7 A;  4MN5 A;  1LSX A;  1T1C A;  2OWJ A;  1DRM A;  5AVE A;  5HD3 A;  5L8M A;  2OWH A;  3S7O A;  4KUK A;  1TS8 A;  3MQ0 A;  2WKQ A;  1H3Q A;  5F68 A;  1YKD A;  3LI8 A;  2P7J A;  1N9N A;  4Y3I A;  3C8C A;  3B47 A;  2Y79 A;  3UE6 A;  2CMN A;  4EU0 A;  1OTD A;  3T4K A;  3IS2 A;  4JGQ A;  4NXF A;  4HNB A;  2XRO A;  2XSS A;  3MF0 A;  2JKR M;  4BWI A;  2JHE A;  4OOM A;  1OJG A;  1NWZ A;  3ICY A;  4EXO A;  1TS6 A;  5I5L A;  2J3W A;  2LB5 A;  3MFX A;  1LSW A;  3ZYT A;  5DF9 A;  3MXQ A;  4I39 A;  3F1P B;  2W3D A;  5DJU A;  5F69 A;  2VX8 A;  5CX7 A;  5TJJ A;  2W27 A;  1F9I A;  2QWS A;  2ZOI A;  2JKR I;  4HQA A;  1TD5 A;  1GSW A;  4E04 A;  3E4O A;  3FG8 A;  2A24 A;  1G6O A;  2K2N A;  3LUQ A;  2A2L A;  4LRX C;  5AJG A;  2O9C A;  2HJ9 C;  1ZHH B;  2EWW A;  5G4Z A;  1Y28 A;  3MMH A;  3ULF A;  4PKY A;  3OBF A;  3R4K A;  4KQD A;  2HF6 A;  3LYX A;  3OOV A;  3E4P A;  2PDR A;  3F1P A;  3EGX C;  3MQO A;  3PBT A;  3NOU C;  3W2Z A;  4Z1W A;  4I38 A;  5EFW A;  4PHT A;  4HP9 A;  2V0W A;  2FZ0 A;  1TS7 A;  3LI9 A;  4B93 A;  5KSH A;  2G7U A;  5FL3 A;  2W3H A;  1GSX A;  2K7S A;  2K31 A;  4HJ3 A;  1D06 A;  4HH2 A;  2Y8H A;  4O8G A;  3ZQ5 A;  3OLO A;  2ZOH A;  3P7N A;  3JVV A;  2XA7 S;  3BY9 A;  2L0W A;  4I3J A;  3BY8 A;  2ZMF A;  4G3W A;  1TF1 A;  2VV8 A;  3LIB A;  4NEE D;  1XJ3 A;  1D7E A;  3B33 A;  2QJ7 A;  3E4Q A;  3SW1 A;  1N9O A;  2BAS A;  1T18 A;  3VOL A;  3OCN A;  4OOL A;  4FOF A;  3R7W B;  2O0Y A;  3LR3 A;  2JN7 A;  4NXB A;  4L9E A;  2M7V A;  5IU1 A;  2GX5 A;  4CLC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...