2KDKA

Structure of human circadian clock protein bmal2 c-terminal pas domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
b'NSGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHNNLTDKHKAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNPDTKELEYIVSVNTLVLGHSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator-like protein
publication title Structure of human circadian clock protein BMAL2 C-terminal PAS domain
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2kdkA01
3LIEA 4NXBA 2YKHA 4LRZE 4BBVA 1T19A 4HJ6A 2L1MA 5F68A 2R78A 1S66L 2QJ7A 2ZOIA 2WKQA 3MQQA 1D7EA 5AVFA 1G28A 5DKKA 4H6JA 3LICA 1P0ZA 4HNBA 4YWZA 2H28A 4R38A 4NXGA 5IU1A 1GSXA 1N9OA 2V1BA 3LIAA 1DP6A 2QJ5A 3SW1A 5G4YA 3GDIA 4EW7A 5I5LA 4K08A 1T1AA 3LI9A 3UB7A 3NOTC 4WL9A 2V1AA 4GHIA 4EXOA 4F3LB 2D02A 3ULFA 3UMDA 5IS1A 4LRXC 3MJQA 4L9GA 2P7JA 3MQOA 2B02A 1T1CA 3FG8A 3F1PA 4HP4A 3C2WA 3OLOA 4I5SA 5A8BA 4WN5A 4HJ4A 3F1NA 1F98A 3HJIA 4DJ2A 5J4EA 4HH3A 2I9VA 3D72A 3VE3A 3H82B 4MN6A 4NXFA 3P7NA 1DRMA 5HWTA 1UWNX 3K3CA 1WA9A 1VB6A 2PR6A 3EWKA 4EEUA 2JN7A 4EERA 3IS2B 3LIDA 2K7SA 1S1YA 1P97A 4I38A 3FC7A 3CLOA 4EEPA 1T18A 1F9IA 3LIFA 3LYXA 2WKRA 1V9ZA 4WF0A 1LSXA 3G6OA 1UWPX 3VOLA 3A0VA 3H7WB 2L4RA 5HDSA 4HP9A 1S1ZA 1TS8A 3EEHA 5EFWA 1D06A 4JGRA 5F5YA 1LSWA 4PKYG 3E4OA 5HWVA 3KX0X 2W27A 3CWFA 3VE4A 4E04A 3IBRA 3F1OA 1S4RA 5AVEA 2Z6CA 4GS9B 2CMNA 2PYPA 2JHEA 4GHIB 2VLGA 1NWZA 1GSVA 5DJUA 3B33A 2J80A 2QKPA 2VV7A 3UMEA 4JGPA 1OTDA 2EA9A 3K3DA 3RH8B 1GSWA 4LLOB 3PHYA 3ICYA 3UB8A 4L9EA 4WLAA 1XFNA 1XJ2A 4HH2A 4EETB 4F3LA 4R70A 2A24A 3MR0A 2KX6A 2ZBBA 5TBMB 2PYRA 2OWHA 1XJ3A 3NJAA 4BBTA 3MXQA 4GCZA 1XJ4A 1Y28A 3BY8A 2L0WA 4XT2B 4HQAA 3E4PA 3LIBA 1T1BA 3HJKA 2M1CA 1OT6A 5HSQA 3H82A 3LI8A 2WKPA 4JGQA 3NOUC 2D01A 1KOUA 2PR5A 1X0OA 4WUJA 3T50A 4B9OA 1OTBA 3IS2A 1DP9A 5J3WA 1XJ6A 4H6JB 4HHDA 4KUKA 3BY9A 5HD3A 1OTEA 1OTAA 2GJ3A 3BWLA 3NOPC 5DJTA 4HOIA 2ZOHA 3F1OB 3LUQA 2INWA 5HD5A 5F6AA 4M4XA 2Z6DA 4HY8A 3H7WA 1OT9A 3PYPA 4PKYA 5J7EA 1DP8A 1OJ5A 4EESA 2V9AA 4RQ9A 5HWWA 4DJ3A 2PD7A 4L9FA 1JNUA 3NHQA 2V0WA 2QWSA 2OOLA 4GS9A 4I3AA 3F1PB 3F1NB 1TS7A 3E4QA 4BBUA 2VV8A 1ODVA 1S4SA 3A0SA 4I3IA 5HZHA 3GECA 2A24B 2PHYA 1N9LA 5HDDA 1N9NA 3UB6A 4MN5A 2V0UA 4R6LA 3MFXA 2VEAA 3A0RA 1UGUA 2QHKA 1LT0A 2KDKA 1OTIA 1XFQA 4EQ1A 1LL8A 2PD8A 4I39A 4NXEA 5HDCA 4HIAA 4HJ3A 4JGOA 2VV6A 4GW9A 5DKLA 2PDRA 1S67L 1LSVA 5G4ZA 3UE6A 1OJGA 3RTYA 1MZUA 4KUOA 3ZQ5A 5TBMA 4I3JA 2OWJA 3C8CA 4HI4A 2HV1A 4LRYC 1TS0A 4XT2A 2BASA 3CAXA 5KIZA 1TS6A 2W0NA 3UB9A 1BYWA 3H9WA 4LPZA 4R3AA 4KQDA 1EW0A 5F69A 1V9YA 2YKFA
chains in the Genus database with same CATH superfamily
2JKTM 1W79A 3I7JA 4HJ6A 4CLCE 3WRTA 1S66L 1P9WA 4JXSA 3OBFA 2WKQA 2G2UA 4EUZA 4O8GA 1QMFA 2WKIA 3D9YA 4LV2A 4BLMA 3IXHA 1P0ZA 3VOZA 2EWWA 3ITAA 4PM5A 4R38A 4G3VA 3PR6A 5IU1A 5EOOA 1K57A 2V20A 3A3DA 2V1BA 3LIAA 5FQ9A 4KZ9A 1DP6A 2BTFP 5FDHA 1NYMA 4E3NA 4IHQA 5I5LA 1PNEA 4ZJ1A 4K08A 4WEKA 1T1AA 2ZQ7A 1E25A 1CEFA 3NOTC 1SHVA 1YLJA 1STZA 4GHIA 3Q7ZA 3IWOA 4FSFA 1Y54A 2A2LA 2QYBA 4L9GA 3BJNA 4CLCA 2X71A 1MC0A 4ESPA 2OLUA 1XGJA 3FG8A 2ZC3B 2C6WB 3G35A 1YT4A 1M40A 3OLOA 5CXWA 4P0MA 4WN5A 1GA0A 2RL3A 1MKMA 4GOGA 2ZC4B 3Q82A 1MY8A 1H3QA 4DJ2A 1IKGA 2RCXA 1MPLA 5L8MA 3VE3A 4NXFA 2VZWA 3P7NA 4N92A 1VB6A 5FI2A 3EWKA 2ZQAA 4Y7PA 2WKHA 3QP1A 4KZBA 3N8RA 2K7SA 3T4OA 3DTIA 1S1YA 4BJPA 3ZNYA 1P97A 3MQ0A 2ACGA 4WMCD 1CJFA 2JCHA 2W3DA 4DDSA 3LIFA 3T4JA 1FSWA 3SS4A 1SDNA 3W4QA 1DJCA 2PBYA 3GTCA 3PXPA 4EQIA 2DCFA 1LSXA 3G6OA 1Q2PA 3H7WB 1S1ZA 3EEHA 5GLCA 5L07A 3T1SA 1KGFA 2M7UA 1U60A 5E2HA 3E2LA 4GB7A 4IBRA 4PKYG 3KX0X 3HREA 3AGEA 1KVLA 3UPOA 2DNSA 2W27A 4KENB 3VSLA 2X01A 1KGGA 4Y3IA 1PWCA 2WAEA 4MMNA 4OQGA 1ALQA 3B3XA 4MBKA 1MWRA 5FQIA 4GHIB 2J3WA 4S2KA 2XSSA 1GSVA 5DJUA 4BQMA 5GL9A 4IEDA 5KSHA 3S1YA 1SDEA 5JYOA 5AQBA 3MMHA 4C75A 3IXBA 5E2FA 2ZQ9A 1JVJA 3PHYA 3ICYA 3NDGA 1FCNA 1XP4A 1XJ2A 3R4KA 4HH2A 4PHTA 1S6RA 3UY6A 4DF6A 2ZBBA 4YINA 5TBMB 1MBLA 3V67A 3KO6A 2OWHA 1L2SA 5DFYA 3RFBA 4BBTA 3MXQA 2JBFA 3DTKA 5EVLA 1VETB 3U4LP 4E3LA 5F1FA 2WKEA 3CJMA 5FSRA 3T4KA 5A90A 1Y28A 3BY8A 3BFEA 5FA7A 5EV0A 1YSPA 3HUOA 4E3KA 1F2KA 3HJKA 5GLBA 5KZHA 2DRWA 2WKPA 3MF0A 3FWLA 3UNWA 4JPMA 3BFGA 4A5RA 1TVFA 2R9XA 3ZFZA 4KQOA 5HL1A 3MKEA 3T50A 4WUJA 1WYCA 2H10A 5J3WA 4EUVA 1XJ6A 4H6JB 4HHDA 1OTEA 1K0KA 4Q8IA 4DRTA 3BWLA 1K4EA 4OQHA 4EBNA 5L2FA 4LV0A 3KYZA 2OAQ1 5F6AA 3LR3A 2BG1A 5FI6A 2JKRM 2P9VB 2ZC5B 4PKYA 1AWIA 1FOFA 1KE3A 1OJ5A 4Y2FA 3O88A 4QU3A 3VP3A 3EOIA 1BSGA 4HESA 4EESA 1K55C 1IOUA 4DJ3A 1CI9A 4R3BA 1N4OA 1WYBA 1JNUA 4D2OA 3WS4A 3P09A 1KDWA 3UDIA 2V0WA 5F1GA 4JLFA 2QWSA 3N8LA 4I3AA 5E43A 4KZ5A 4E6WA 4MLLA 3ZDJA 1GHPA 3F1NB 1TS7A 3HLBA 5A93A 1CI8A 3BYDA 4NG2A 3C5AA 2BLSA 3GECA 4DXBA 1JWZA 3CPTB 1N9NA 2A49A 1TD5A 2O9AA 2XD5A 4X1LA 2H0TA 4MN5A 5AQ7A 2WGWA 3A0RA 3W8KA 1LT0A 2ZM2A 3LCEA 1OTIA 4EQ1A 1Y4OA 3HLGA 5EM0A 1O7EA 2QPNA 3MBZA 5L10A 5GHZA 5DF8A 2NUTC 3ZGAB 3UE6A 3HLCA 1OJGA 1MZUA 1XA1A 4IVKA 3G32A 1VM1A 5KSCA 3UN7A 3EQUA 4QY5A 5LBRA 4XT2A 2W1RA 2W0NA 2HDRA 3T1XA 4KQDA 3O86A 4YOFA 3LY3A 3LIEA 4UQIS 4RX2A 4BBVA 4UEYA 1YQSA 3P01A 1G5UA 5F68A 2QJ7A 4KQRA 2ZOIA 4EWFA 3CUEC 3PBQA 3C4PA 3T4TA 1D7EA 4CJNA 1G28A 4K0WA 2XRNA 4CPKA 4Y5FA 3VOYA 2CC1A 3OCNA 2W1TA 4OPQA 5GLAA 5FQQA 4L0LA 4YWZA 2H28A 5F83A 1GSXA 4KZ3A 3BLSA 1KDSA 1MXOA 4N9LA 4WBGA 1NY0A 4G3WA 5G4YA 3GDIA 3JPUA 1BLSA 3SZTA 3SH7A 2JKGA 2V8FA 2V1AA 2H0YA 4WYYA 5U47A 3UPPA 4EXOA 3LO7A 4F3LB 4JF5A 4CQHA 3ULFA 1XX2A 4E3MA 2WGWB 2B02A 5TJJA 1K56A 1K57C 3QP6A 4EBPA 4GKUA 1GCEA 3F1PA 3A3IA 3NECA 4HJ4A 4LGWA 1YAXA 1PW8A 3LR5A 2HDQA 1NZUA 4RX3A 5AQ9A 1F5MA 2ZQDA 3IF6A 2V1ZA 3H82B 4MN6A 1K38A 3ZVWA 4OLGA 2V8CA 2PR6A 2XD1A 3NCKA 3OPLA 1PZPA 1HZOA 1L0FA 4FTXA 2XFTA 3VFHA 4S2LA 2PBDP 2WZZA 2ZC6B 3QNCA 3WRZA 3CLOA 3BRMA 1T18A 3ZCZA 5JYPA 2JKFA 2WKRA 3R7WA 3TG9A 2JC7A 3N6IA 2GX5A 3T4LA 4ZAMA 2L4RA 1TS8A 5FAQA 1QMEA 5EFWA 3CHWP 2Y59A 3T1RA 3OPPA 3HUNA 3DTEA 2M7VA 1KE0A 2XLNA 4G3KA 3G2YA 4GJ4A 4E04A 5EVEA 1Z09A 1YM1A 3N8SA 3IXGA 3L7HA 3BFCA 2Z6CA 3S22A 4OQIA 2CMNA 3AGDA 2PYPA 1GHIA 4OLDA 3KSIA 1K4FA 3A3JA 4KZAA 1SKOA 3DWZA 1BUEA 1FQGA 4D60A 1YSQA 1NRFA 2UWXA 3HCYA 3UMEA 2ZL1B 4JXVA 2GNXA 4U0TA 3G2ZA 1G6AA 1OTDA 2EA9A 3UB5P 5BOHA 3IXDA 1VEUA 3BFFA 4R3JA 4HBUA 4EV4A 2KOIA 4GNUA 4LFUA 3W4PA 1JTDA 2PU4A 3VP0A 4OP8A 2UV0E 1MWSA 3U2AA 1YKDA 1PIOA 3LY4A 4FUWA 4DKIA 5FATA 3IWQA 4X56A 5EVIC 2J9PA 4FCFA 3UDFA 1ACFA 5FASA 5CECA 3WS0A 1XPBA 3E4PA 1W5DA 3KSFA 5KMWA 3V50A 3ZNTA 4Z9QA 3B47A 4LV3A 2WAFA 2D01A 1KOUA 2PR5A 2Y2JA 2IA2A 2WGVA 4JF4A 4B9OA 3IS2A 3FYZA 2XDMA 4ZJ3A 2MJ6A 3SH9A 4KUKA 5DTTA 4ZJ2A 5DVAA 2WYXA 2GJ3A 5FEFA 2ZMAA 4MBHA 3NOPC 2GDNA 3LEQA 2G7UA 3GSGA 3LUQA 1SZVA 2INWA 3ZG9B 5M19A 4LCMA 3WS1A 4JBFA 1MWTA 4HY8A 3D3OA 4NEED 3SS5A 1OT9A 2FFFB 1NRJA 5J7EA 4B4XA 1YLTA 3TSGA 3G30A 4MDZA 3TE8A 1FSYA 3ZYTA 4BD0A 1IYPA 4S2OA 2G2WA 1J3WA 4N9KA 4DE2A 3M2KA 2EX2A 3A3FA 3JVVA 5HWWA 4CLCB 1VQQA 1I2WA 4L9FA 4KG5A 4S2IA 4K91A 3IWIA 4GDNA 3KYEA 2OOLA 5EECA 4GS9A 4Y0UA 5EVIA 4HBTA 3T4SA 3S4XA 4OPRA 2IWDA 3FKWA 4NETA 4BBUA 4E3OA 4OPZA 2XEPA 3ZG5A 1JWVA 4I3IA 5HZHA 1MKIA 3IT9A 3MZEA 4UHUA 5DF9A 2PHYA 2XGNA 2VX8A 4UQIM 1CK3A 1C3BA 3UE0A 4R6LA 4Q0HA 3MFXA 5L09A 3P98A 3PBTA 1K6RA 4QPRA 4ZBEA 4OOLA 3NDEA 4N1XA 2HP6A 3GMWA 2Y4AA 3FPWA 4RVAA 2QMIA 4HJ3A 2ZC7A 1CEGA 2VV6A 1DJAA 5DKLA 3EGXC 3GV9A 3V3SA 5G4ZA 5CERA 3RTYA 1NZOA 4KUOA 4Y17A 4IUKA 4HI4A 2XA7S 2EX8A 2GZAA 4R4SA 4QB8A 3AGFA 4KG6A 2Y2IA 3GVBA 3HLWA 5MC7A 4XXRA 3CAXA 1GA9A 1VHMA 4MN7A 1XXMA 3ITBA 1K56D 1ZKJA 4NXBA 1NJ4A 1FCOA 1PW1A 3FZCA 5FAOA 3MKFA 4GD8A 3E2KA 1T19A 3TJZC 4QD4A 5HARA 1BLPA 1ZG4A 5FL3A 3S7PA 1BT5A 4ETXA 2Y91A 5HL6A 3VSKA 3MQQA 3HBRA 1H8ZA 3WS5A 1D1JA 4WEJA 4HNBA 1RCJA 3IHAA 1ESUA 2HDUA 4N1HA 4GN2A 3LFVA 2HGVA 5I94A 1L0DA 1H0MA 5FDSA 3HVFA 4NK3A 3A3EA 2QJ5A 4S2NA 3BW6A 1YPRA 3BEBA 4DDYA 4QWOA 5M18A 3T12B 4DE0A 3ISGA 2LB9A 3QNBA 4XUZA 4IVIA 1YLWA 2W3GA 4IUHA 3E98A 2D02A 4QY6A 3UMDA 5IS1A 1YLPA 2P7JA 3MQOA 2O99A 2H5SA 1CF0A 5C5KA 4KZ8A 4P6BA 3PAGA 3PBOA 3V3RA 1EROA 4X69A 4JXGA 4JXWA 4I5SA 3UE1A 3UO9A 2DMWA 2P08A 1ZHHB 2WZXA 2OV5A 5J4EA 2VKSA 4HH3A 2I9VA 3NULA 4GZBA 1J9MA 4OONA 1LI0A 1XA7A 3D72A 3RXXA 3BLMA 2VGKA 1SKFA 4OQ0A 5HWTA 3K3CA 3KYQA 1WA9A 2Y2OA 5DTKA 1PI4A 3Q7VA 4EEUA 3OOVA 4OP5A 4EERA 1WE4A 3LIDA 1ES3A 4I38A 4X25A 1TF1A 5DF7A 4KZ6A 1PFLA 2PU2A 5FQMA 4UAAA 3IF6C 1F9IA 5EPHA 5HX9A 3FPVA 3S7OA 1V9ZA 4E3IA 1HVBA 2Y2NA 3VOLA 3A0VA 4YFMA 4GDBA 5HDSA 3MZDA 3S7QA 4X53A 4Y0OA 1ES4A 4ARZA 1W7FA 4JGRA 1LL9A 2Q9MA 4PPRA 3DAVA 2HP9A 2WK0A 3IX3A 4Q0IA 5HWVA 3C4OA 2O9CA 3IHBA 4P85A 3F1OA 3CI6A 3HL9A 5AVEA 2VJWA 5DFXA 2ZD8A 1RGZA 1ZTUA 2J9OA 2NUPC 4DXCA 2VLGA 1NWZA 4E3JA 3UPNA 2Z2MB 3L9KA 3HLFA 3B33A 1PWGA 2VV7A 3LR0A 1FCMA 2OAP1 4JGPA 3K3DA 3GQZA 3RH8B 3C7VA 1L0EA 4ZDXA 3TOIA 3IH8A 3G4PA 4PAUA 1OMEA 2HZ5A 1ERQA 4GD6A 4L9EA 2IWCA 2Y2KA 1XFNA 2ZMFA 3QHYA 2ZQ8A 2Y2MA 3S7NA 4EETB 4S2PA 5D3OA 4R70A 3MR0A 3HLDA 2PYRA 5HW3A 2OLVA 3MZFA 1XJ3A 1ONHA 2EX9A 4DE3A 4WELA 4BMWA 1NLYA 2E8JA 1XJ4A 4PM8A 2L0WA 3G31A 3EEAA 4XT2B 1S0WA 3NBLA 4Q0JA 3N4IA 4X55A 4HQAA 2ZM8A 4PM6A 3VP4A 2XFSA 5HFOA 1OT6A 3QP8A 2Q0OA 2FZ0A 4B88A 1EI5A 2Y2GA 2QZ6A 4WZ4A 2EXAA 1TDLA 3O3VA 4MCWA 5EVID 2KLIA 1CQAA 3SS3A 5CHJA 1P9RA 1DY6A 3C7UA 3BY9A 2W1TB 4BL3A 3OZHA 3GR2A 3MSHA 4EBLA 5M1AA 5DJTA 1M6KA 4HOIA 1BLHA 3F1OB 4MEZA 5HD5A 1RGYA 2FH5A 4M4XA 3H7WA 3V5MA 1G68A 1YMSA 3EQVA 3PBRA 2C5WB 2EX6A 5CGXA 3CG5A 1MWUA 4RQ9A 1IYSA 4PM9A 3EGDC 5DTSA 5E2EA 2HP5A 4U3TA 2W3EA 4Y0TA 3IF5A 1LLBA 4II7A 4P87A 2XH9A 2XK1A 3IBJA 3F1PB 2XA7M 3DTMA 2ZJ9A 3E4QA 2OSUA 1SCWA 5GLDA 1FILA 1ODVA 3QP4A 3A0SA 4BL2A 5IHVA 5A92A 3B42A 1IEMA 1ONGA 3IF6B 4ETZA 4S2MA 3VP2A 3PBSA 2HF6A 5HAIA 4P6ZS 3Q07A 1UGUA 2QHKA 5CTMA 2Y2LA 3ZG8B 1IFQA 3IH9A 3GRJA 1LL8A 2FFYA 4OOMA 1AXBA 1YMXA 4MBFA 4BWIA 3CMZA 3MXSA 5EUAA 5HDCA 3PTEA 4HIAA 4OVDA 3LR4A 4Z1WA 3MS6A 5HPFA 2PDRA 1LSVA 3VP1A 3VMAA 3R7WB 3ZQ5A 5TBMA 4YNRA 2WADA 1XGIA 1Q2QA 3JYIA 2PRFA 3C8CA 1LI9A 1N9BA 1ZG6A 2HV1A 4FOFA 1VETA 1YLZA 3UE3A 5HAPA 5J8XA 3N7WA 2BASA 3DWKA 2VGJA 1TS6A 3H9WA 2O9BA 1EW0A 1V9YA 2Y79A 4OKPA 2YKFA 2Y2QA 2EWVA 3ZG7B 1FR1A 2LB5A 4KG2A 1KVMA 2YKHA 4LRZE 5FQKA 4H8RA 3IX4A 3M2JA 3RJUA 1NYYA 1XKZA 1PI5A 2L1MA 2R78A 1HD8A 1LHYA 4F94A 4DMZA 5FAPA 2ZM0A 3W4OA 1W63Q 2B18A 2WUQA 3BQAA 4ME4A 5AVFA 4O01A 5DKKA 4Y15A 4H6JA 4OH0A 4S2JA 3FV7A 3LICA 2HPBA 1PRQA 4M3KA 2K31A 1SKOB 1K54C 4RA7A 4X68A 4NXGA 4EU0A 4JKTA 2J3TD 2VGLS 1N9OA 3LEZA 4DN0A 5HPIA 1PZOA 1E3UD 1HLUP 1VEUB 3SW1A 2P9VA 1HTZA 4EW7A 4E6XA 3C30A 4FH4A 2ZLYA 2O0YA 3LI9A 4QHCA 3UB7A 1KGEA 2Q9NA 4WL9A 5CEBA 2K2NA 1W8QA 5FI7A 4LRXC 3MJQA 3D4FA 3G34A 3OC2A 3T1QB 3PAEA 3JVUA 1BZAA 1T1CA 4MNRA 4S2NC 2P04A 3QP5A 4HP4A 3C2WA 1A0KA 3UDXA 5A8BA 1E4DA 2W3FA 3F1NA 1F98A 4WZ5C 3HJIA 2IWBA 3Q81A 5K5BA 4UA7A 4PM7A 3CPTA 1ERMA 1DRMA 5TR7A 1I2SA 1UWNX 2Y55A 3ZHHA 3OCLA 4PMAA 2JN7A 3NI9A 3IS2B 4GLQA 3W2ZA 4NKPA 3HUMA 3FC7A 2JKRI 3OPRA 4AFIA 4EEPA 1Z6FA 1K54A 3M6BA 3LYXA 4U0XA 3TW8A 4WF0A 4C3QA 1UWPX 2J3TC 3DW0A 3T4QA 4LCLA 4HP9A 1D06A 4LV1A 3CITA 3E0YA 1FIKA 3NIAA 5F5YA 1LSWA 2HJ9C 5G18A 3E4OA 1GHMA 3IQAA 3CWFA 3VE4A 2P74A 1L3LA 3IBRA 1S4RA 4GS9B 4O0PA 4OPYA 5EVIB 4IJGA 4QJGA 2I72A 2JE5A 2JHEA 5TGFA 1H5XA 5CHMA 4B4ZA 4WZ5A 3K2NA 1EWZA 4R4RA 4WMCA 2J80A 1OPXA 2QKPA 4R1GA 3FKVA 1G6OA 1BTLA 3C38A 2PAVP 2EFXA 1GSWA 5CRFA 4LLOB 3ZG0A 3KSGA 3CZDA 1DJBA 3UB8A 2Y2HA 4WLAA 1PWDA 4UA9A 1K6SA 4HEFA 4F3LA 2A24A 2KX6A 4KZ7A 4BENA 5EOEA 1FR6A 4FD8A 1ZC2A 3NJAA 3WWXA 5CGSA 1H8MA 4GCZA 3QP2A 4X6TA 1BLCA 5F82A 1H8YA 1E3UA 2XROA 1ES2A 2J8YA 4IBXA 4LENA 1K25A 3LIBA 1T1BA 2M1CA 1L0GA 3SOIA 3VFFA 2EXBA 3O87A 5HSQA 3H82A 3LI8A 3WS2A 4JGQA 3NOUC 2EFUA 3LGOA 1X0OA 4KZ4A 1ESIA 1KE4A 2E8IA 1OTBA 5AQAA 1DP9A 4Y13A 5GHYA 4K0XA 5GHXA 5HD3A 3BFDA 4CLCD 4O7DA 4OOYA 5CX7A 1OTAA 2X02A 1I5QA 1K55A 1TDGA 2VK3A 1RP5A 4WM9A 2ZOHA 3VV4A 1JTGA 3TRCA 5AJGA 4P6ZM 2B95A 3BQ8A 2Z6DA 4RYEA 3PYPA 5CTNA 1JWPA 2J7VA 4UA6A 1DP8A 4KQQA 1IYOA 3PBNA 3M6HA 1O07A 4ZRRA 5FEGA 2B5RA 5EE8A 3Q1FA 5A91A 2V9AA 2Y2PA 4JF6A 2ZMVA 2PD7A 1YLYA 1IYQA 2AVXA 3NHQA 3OPHA 4R23A 1NLZA 1ES5A 4FH2A 2A3UA 1BULA 4C6YA 2WGIA 4XUXA 3ZVTA 2VV8A 1IKIA 1S4SA 2R9WA 2A24B 1N9LA 5HDDA 2HDSA 3UB6A 5EM1A 3BM6A 2V0UA 2ZL1A 3MXRA 1NXYA 2VEAA 4B93A 3O5YA 5TFQA 3V39A 2XR0A 5HAQA 2Z2LB 3Q7VB 3MFDA 2KDKA 4X1MA 2XQZA 3SH8A 5FQJA 3RXWA 1XFQA 3NY4A 2PT7A 4DE1A 4R0QA 2Y8HA 2JKTI 5E2GA 4ID4A 2PD8A 4I39A 4NXEA 3DBAA 5CGWA 4JGOA 4GW9A 1S67L 1W63M 4CLCC 1IELA 3BECA 5CHUA 1W8YA 3KSHA 2HJEA 1PYYA 2VGLM 1TEMA 4I3JA 2OWJA 3IX8A 2W3HA 2VA0A 5CEDA 3CUEA 1LL5A 4ARZB 4LRYC 2V2FF 2XF3A 2ZQCA 1TS0A 3HLEA 3NC8A 5KIZA 3UB9A 4BD1A 1BYWA 4LPZA 4R3AA 4ZTKA 5F69A 5IT5A
chains in the Genus database with same CATH topology
2JKTM 4YOFA 3LIEA 4NXBA 4UQIS 2LB5A 2YKHA 4LRZE 4BBVA 1T19A 4UEYA 3P01A 4HJ6A 4CLCE 3TJZC 2L1MA 5FL3A 5F68A 2R78A 1S66L 1P9WA 3S7PA 2QJ7A 2ZOIA 3OBFA 2WKQA 4DMZA 4ETXA 3CUEC 3PBQA 5HL6A 3MQQA 4O8GA 1W63Q 1D7EA 3T4TA 2B18A 3BQAA 4ME4A 5AVFA 1G28A 4O01A 2XRNA 5DKKA 4H6JA 4Y5FA 4WEJA 3LICA 1P0ZA 2W1TA 3OCNA 2K31A 4HNBA 2EWWA 4L0LA 4YWZA 2H28A 4R38A 4G3VA 3LFVA 2HGVA 3PR6A 4NXGA 5IU1A 1GSXA 4EU0A 2J3TD 2VGLS 1N9OA 4DN0A 2V1BA 3LIAA 5HPIA 1DP6A 2QJ5A 3BW6A 3SW1A 4G3WA 5G4YA 3GDIA 4IHQA 5I5LA 4EW7A 3C30A 4K08A 4WEKA 1T1AA 2O0YA 3LI9A 3UB7A 2LB9A 3NOTC 4WL9A 2V1AA 1STZA 2W3GA 4IUHA 4GHIA 3E98A 4EXOA 4F3LB 2K2NA 4FSFA 4CQHA 2A2LA 2D02A 3UMDA 3ULFA 5IS1A 4LRXC 3MJQA 2QYBA 4L9GA 3BJNA 3OC2A 4CLCA 2P7JA 3MQOA 2O99A 1MC0A 2B02A 5TJJA 5C5KA 3JVUA 1T1CA 3FG8A 2P04A 3PBOA 3F1PA 4HP4A 3C2WA 3OLOA 4I5SA 5A8BA 4WN5A 4HJ4A 3F1NA 2W3FA 1MKMA 1F98A 2DMWA 3HJIA 1YAXA 2P08A 1ZHHB 1H3QA 5K5BA 3LR5A 4DJ2A 5J4EA 2VKSA 4HH3A 2I9VA 1F5MA 3D72A 5L8MA 3VE3A 3H82B 4MN6A 4NXFA 2VZWA 1DRMA 3P7NA 5HWTA 1UWNX 3K3CA 3KYQA 1WA9A 1VB6A 2PR6A 3EWKA 3OCLA 4EEUA 2JN7A 3OOVA 4EERA 3IS2B 3LIDA 2K7SA 4GLQA 3T4OA 1S1YA 3W2ZA 4BJPA 4NKPA 1P97A 4I38A 3MQ0A 3FC7A 1TF1A 2JKRI 3CLOA 2W3DA 4AFIA 4EEPA 1T18A 1F9IA 3LIFA 3T4JA 3LYXA 3TW8A 3FPVA 2WKRA 3R7WA 3S7OA 1V9ZA 4WF0A 3PXPA 1LSXA 3G6OA 1UWPX 2GX5A 3T4LA 3VOLA 3A0VA 2J3TC 3H7WB 2L4RA 5HDSA 3T4QA 3S7QA 4HP9A 1S1ZA 1TS8A 3EEHA 4ARZA 5EFWA 1D06A 4JGRA 3CITA 3E0YA 5F5YA 1LSWA 2M7UA 2HJ9C 2M7VA 4Q0IA 4PKYG 3E4OA 5HWVA 3KX0X 4G3KA 2W27A 4GJ4A 2O9CA 3CWFA 4Y3IA 3VE4A 4E04A 4MMNA 3IBRA 3F1OA 1S4RA 3CI6A 2Z6CA 4GS9B 5AVEA 4O0PA 2CMNA 4IJGA 2VJWA 5DFXA 2PYPA 3KSIA 1ZTUA 2JHEA 2NUPC 4GHIB 2VLGA 2J3WA 1NWZA 2XSSA 3K2NA 1GSVA 5DJUA 1YSQA 3B33A 2J80A 3HCYA 1OPXA 5KSHA 2QKPA 2VV7A 3LR0A 3UMEA 2OAP1 1G6OA 4JGPA 2GNXA 3C38A 1OTDA 3MMHA 2EA9A 3K3DA 3RH8B 1GSWA 4LLOB 3KSGA 3PHYA 3ICYA 4PAUA 3UB8A 4L9EA 2KOIA 4WLAA 1XFNA 1XJ2A 3R4KA 2ZMFA 4HH2A 3S7NA 4EETB 4F3LA 4PHTA 4R70A 2A24A 3MR0A 2KX6A 2ZBBA 3U2AA 1YKDA 5TBMB 2PYRA 3V67A 3KO6A 2OWHA 1XJ3A 3NJAA 5DFYA 4WELA 3RFBA 4BMWA 4BBTA 1NLYA 3MXQA 1H8MA 4GCZA 3T4KA 1XJ4A 1Y28A 3BY8A 2XROA 2L0WA 4XT2B 3EEAA 4Q0JA 4HQAA 1YSPA 3E4PA 3LIBA 1T1BA 3HJKA 2M1CA 3KSFA 1OT6A 5HSQA 2FZ0A 3H82A 3LI8A 3B47A 2WKPA 3MF0A 4JGQA 4MCWA 3NOUC 2KLIA 2D01A 4KQOA 1KOUA 2PR5A 1X0OA 4WUJA 2IA2A 3T50A 4B9OA 1OTBA 3IS2A 1P9RA 1DP9A 5J3WA 4EUVA 2MJ6A 1XJ6A 4H6JB 4HHDA 4KUKA 3BY9A 5HD3A 2W1TB 1OTEA 4CLCD 5CX7A 1OTAA 2GJ3A 3BWLA 3NOPC 5DJTA 4HOIA 2G7UA 2ZOHA 3VV4A 3F1OB 3KYZA 2OAQ1 3LUQA 3TRCA 2INWA 5HD5A 5F6AA 2FH5A 5AJGA 3LR3A 4M4XA 2JKRM 4P6ZM 3BQ8A 2Z6DA 4HY8A 3D3OA 3H7WA 4NEED 1OT9A 3PYPA 1NRJA 4PKYA 5J7EA 1DP8A 4MDZA 3TE8A 1OJ5A 3EQVA 3PBNA 3PBRA 4Y2FA 4ZRRA 3ZYTA 3EOIA 4EESA 2V9AA 1IOUA 4RQ9A 2ZMVA 3JVVA 5HWWA 3EGDC 4DJ3A 2PD7A 4CLCB 2W3EA 4L9FA 1JNUA 3NHQA 2V0WA 4II7A 1NLZA 2QWSA 2OOLA 4GS9A 4I3AA 3IBJA 3F1PB 2XA7M 3T4SA 3F1NB 1TS7A 3E4QA 4BBUA 2VV8A 1ODVA 1S4SA 3A0SA 4I3IA 5HZHA 3GECA 5DF9A 2A24B 2PHYA 3B42A 1N9LA 5HDDA 4ETZA 2VX8A 1N9NA 1TD5A 2O9AA 3UB6A 4UQIM 4MN5A 3PBSA 2HF6A 2V0UA 4R6LA 4Q0HA 3MFXA 2VEAA 3A0RA 5IT5A 4B93A 3O5YA 4P6ZS 3PBTA 1UGUA 2QHKA 4QPRA 4OOLA 1LT0A 2KDKA 1OTIA 1XFQA 1IFQA 4EQ1A 2PT7A 1LL8A 4OOMA 2Y8HA 2JKTI 4BWIA 2PD8A 4I39A 4NXEA 3FPWA 3DBAA 5HDCA 4HIAA 3LR4A 4HJ3A 4Z1WA 4JGOA 2VV6A 4GW9A 2NUTC 5DKLA 2PDRA 5HPFA 1S67L 1W63M 1LSVA 3EGXC 4CLCC 5G4ZA 3UE6A 1OJGA 3RTYA 3KSHA 3R7WB 1MZUA 2HJEA 4KUOA 3ZQ5A 4IUKA 5TBMA 4YNRA 2VGLM 4I3JA 2OWJA 2W3HA 3C8CA 4HI4A 2VA0A 2XA7S 2GZAA 2HV1A 3CUEA 4FOFA 4ARZB 3UE3A 4LRYC 3EQUA 5LBRA 1TS0A 5MC7A 4XT2A 2BASA 2W1RA 3CAXA 5KIZA 1TS6A 2W0NA 3UB9A 1BYWA 3H9WA 4LPZA 2O9BA 1VHMA 4KQDA 1EW0A 4MN7A 1V9YA 2Y79A 4R3AA 5F69A 2YKFA 2EWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIE A;  4NXB A;  2YKH A;  4LRZ E;  4BBV A;  1T19 A;  4HJ6 A;  2L1M A;  5F68 A;  2R78 A;  1S66 L;  2QJ7 A;  2ZOI A;  2WKQ A;  3MQQ A;  1D7E A;  5AVF A;  1G28 A;  5DKK A;  4H6J A;  3LIC A;  1P0Z A;  4HNB A;  4YWZ A;  2H28 A;  4R38 A;  4NXG A;  5IU1 A;  1GSX A;  1N9O A;  2V1B A;  3LIA A;  1DP6 A;  2QJ5 A;  3SW1 A;  5G4Y A;  3GDI A;  4EW7 A;  5I5L A;  4K08 A;  1T1A A;  3LI9 A;  3UB7 A;  3NOT C;  4WL9 A;  2V1A A;  4GHI A;  4EXO A;  4F3L B;  2D02 A;  3ULF A;  3UMD A;  5IS1 A;  4LRX C;  3MJQ A;  4L9G A;  2P7J A;  3MQO A;  2B02 A;  1T1C A;  3FG8 A;  3F1P A;  4HP4 A;  3C2W A;  3OLO A;  4I5S A;  5A8B A;  4WN5 A;  4HJ4 A;  3F1N A;  1F98 A;  3HJI A;  4DJ2 A;  5J4E A;  4HH3 A;  2I9V A;  3D72 A;  3VE3 A;  3H82 B;  4MN6 A;  4NXF A;  3P7N A;  1DRM A;  5HWT A;  1UWN X;  3K3C A;  1WA9 A;  1VB6 A;  2PR6 A;  3EWK A;  4EEU A;  2JN7 A;  4EER A;  3IS2 B;  3LID A;  2K7S A;  1S1Y A;  1P97 A;  4I38 A;  3FC7 A;  3CLO A;  4EEP A;  1T18 A;  1F9I A;  3LIF A;  3LYX A;  2WKR A;  1V9Z A;  4WF0 A;  1LSX A;  3G6O A;  1UWP X;  3VOL A;  3A0V A;  3H7W B;  2L4R A;  5HDS A;  4HP9 A;  1S1Z A;  1TS8 A;  3EEH A;  5EFW A;  1D06 A;  4JGR A;  5F5Y A;  1LSW A;  4PKY G;  3E4O A;  5HWV A;  3KX0 X;  2W27 A;  3CWF A;  3VE4 A;  4E04 A;  3IBR A;  3F1O A;  1S4R A;  5AVE A;  2Z6C A;  4GS9 B;  2CMN A;  2PYP A;  2JHE A;  4GHI B;  2VLG A;  1NWZ A;  1GSV A;  5DJU A;  3B33 A;  2J80 A;  2QKP A;  2VV7 A;  3UME A;  4JGP A;  1OTD A;  2EA9 A;  3K3D A;  3RH8 B;  1GSW A;  4LLO B;  3PHY A;  3ICY A;  3UB8 A;  4L9E A;  4WLA A;  1XFN A;  1XJ2 A;  4HH2 A;  4EET B;  4F3L A;  4R70 A;  2A24 A;  3MR0 A;  2KX6 A;  2ZBB A;  5TBM B;  2PYR A;  2OWH A;  1XJ3 A;  3NJA A;  4BBT A;  3MXQ A;  4GCZ A;  1XJ4 A;  1Y28 A;  3BY8 A;  2L0W A;  4XT2 B;  4HQA A;  3E4P A;  3LIB A;  1T1B A;  3HJK A;  2M1C A;  1OT6 A;  5HSQ A;  3H82 A;  3LI8 A;  2WKP A;  4JGQ A;  3NOU C;  2D01 A;  1KOU A;  2PR5 A;  1X0O A;  4WUJ A;  3T50 A;  4B9O A;  1OTB A;  3IS2 A;  1DP9 A;  5J3W A;  1XJ6 A;  4H6J B;  4HHD A;  4KUK A;  3BY9 A;  5HD3 A;  1OTE A;  1OTA A;  2GJ3 A;  3BWL A;  3NOP C;  5DJT A;  4HOI A;  2ZOH A;  3F1O B;  3LUQ A;  2INW A;  5HD5 A;  5F6A A;  4M4X A;  2Z6D A;  4HY8 A;  3H7W A;  1OT9 A;  3PYP A;  4PKY A;  5J7E A;  1DP8 A;  1OJ5 A;  4EES A;  2V9A A;  4RQ9 A;  5HWW A;  4DJ3 A;  2PD7 A;  4L9F A;  1JNU A;  3NHQ A;  2V0W A;  2QWS A;  2OOL A;  4GS9 A;  4I3A A;  3F1P B;  3F1N B;  1TS7 A;  3E4Q A;  4BBU A;  2VV8 A;  1ODV A;  1S4S A;  3A0S A;  4I3I A;  5HZH A;  3GEC A;  2A24 B;  2PHY A;  1N9L A;  5HDD A;  1N9N A;  3UB6 A;  4MN5 A;  2V0U A;  4R6L A;  3MFX A;  2VEA A;  3A0R A;  1UGU A;  2QHK A;  1LT0 A;  2KDK A;  1OTI A;  1XFQ A;  4EQ1 A;  1LL8 A;  2PD8 A;  4I39 A;  4NXE A;  5HDC A;  4HIA A;  4HJ3 A;  4JGO A;  2VV6 A;  4GW9 A;  5DKL A;  2PDR A;  1S67 L;  1LSV A;  5G4Z A;  3UE6 A;  1OJG A;  3RTY A;  1MZU A;  4KUO A;  3ZQ5 A;  5TBM A;  4I3J A;  2OWJ A;  3C8C A;  4HI4 A;  2HV1 A;  4LRY C;  1TS0 A;  4XT2 A;  2BAS A;  3CAX A;  5KIZ A;  1TS6 A;  2W0N A;  3UB9 A;  1BYW A;  3H9W A;  4LPZ A;  4R3A A;  4KQD A;  1EW0 A;  5F69 A;  1V9Y A;  2YKF A; 
#chains in the Genus database with same CATH topology
 2JKT M;  1W79 A;  3I7J A;  4HJ6 A;  4CLC E;  3WRT A;  1S66 L;  1P9W A;  4JXS A;  3OBF A;  2WKQ A;  2G2U A;  4EUZ A;  4O8G A;  1QMF A;  2WKI A;  3D9Y A;  4LV2 A;  4BLM A;  3IXH A;  1P0Z A;  3VOZ A;  2EWW A;  3ITA A;  4PM5 A;  4R38 A;  4G3V A;  3PR6 A;  5IU1 A;  5EOO A;  1K57 A;  2V20 A;  3A3D A;  2V1B A;  3LIA A;  5FQ9 A;  4KZ9 A;  1DP6 A;  2BTF P;  5FDH A;  1NYM A;  4E3N A;  4IHQ A;  5I5L A;  1PNE A;  4ZJ1 A;  4K08 A;  4WEK A;  1T1A A;  2ZQ7 A;  1E25 A;  1CEF A;  3NOT C;  1SHV A;  1YLJ A;  1STZ A;  4GHI A;  3Q7Z A;  3IWO A;  4FSF A;  1Y54 A;  2A2L A;  2QYB A;  4L9G A;  3BJN A;  4CLC A;  2X71 A;  1MC0 A;  4ESP A;  2OLU A;  1XGJ A;  3FG8 A;  2ZC3 B;  2C6W B;  3G35 A;  1YT4 A;  1M40 A;  3OLO A;  5CXW A;  4P0M A;  4WN5 A;  1GA0 A;  2RL3 A;  1MKM A;  4GOG A;  2ZC4 B;  3Q82 A;  1MY8 A;  1H3Q A;  4DJ2 A;  1IKG A;  2RCX A;  1MPL A;  5L8M A;  3VE3 A;  4NXF A;  2VZW A;  3P7N A;  4N92 A;  1VB6 A;  5FI2 A;  3EWK A;  2ZQA A;  4Y7P A;  2WKH A;  3QP1 A;  4KZB A;  3N8R A;  2K7S A;  3T4O A;  3DTI A;  1S1Y A;  4BJP A;  3ZNY A;  1P97 A;  3MQ0 A;  2ACG A;  4WMC D;  1CJF A;  2JCH A;  2W3D A;  4DDS A;  3LIF A;  3T4J A;  1FSW A;  3SS4 A;  1SDN A;  3W4Q A;  1DJC A;  2PBY A;  3GTC A;  3PXP A;  4EQI A;  2DCF A;  1LSX A;  3G6O A;  1Q2P A;  3H7W B;  1S1Z A;  3EEH A;  5GLC A;  5L07 A;  3T1S A;  1KGF A;  2M7U A;  1U60 A;  5E2H A;  3E2L A;  4GB7 A;  4IBR A;  4PKY G;  3KX0 X;  3HRE A;  3AGE A;  1KVL A;  3UPO A;  2DNS A;  2W27 A;  4KEN B;  3VSL A;  2X01 A;  1KGG A;  4Y3I A;  1PWC A;  2WAE A;  4MMN A;  4OQG A;  1ALQ A;  3B3X A;  4MBK A;  1MWR A;  5FQI A;  4GHI B;  2J3W A;  4S2K A;  2XSS A;  1GSV A;  5DJU A;  4BQM A;  5GL9 A;  4IED A;  5KSH A;  3S1Y A;  1SDE A;  5JYO A;  5AQB A;  3MMH A;  4C75 A;  3IXB A;  5E2F A;  2ZQ9 A;  1JVJ A;  3PHY A;  3ICY A;  3NDG A;  1FCN A;  1XP4 A;  1XJ2 A;  3R4K A;  4HH2 A;  4PHT A;  1S6R A;  3UY6 A;  4DF6 A;  2ZBB A;  4YIN A;  5TBM B;  1MBL A;  3V67 A;  3KO6 A;  2OWH A;  1L2S A;  5DFY A;  3RFB A;  4BBT A;  3MXQ A;  2JBF A;  3DTK A;  5EVL A;  1VET B;  3U4L P;  4E3L A;  5F1F A;  2WKE A;  3CJM A;  5FSR A;  3T4K A;  5A90 A;  1Y28 A;  3BY8 A;  3BFE A;  5FA7 A;  5EV0 A;  1YSP A;  3HUO A;  4E3K A;  1F2K A;  3HJK A;  5GLB A;  5KZH A;  2DRW A;  2WKP A;  3MF0 A;  3FWL A;  3UNW A;  4JPM A;  3BFG A;  4A5R A;  1TVF A;  2R9X A;  3ZFZ A;  4KQO A;  5HL1 A;  3MKE A;  3T50 A;  4WUJ A;  1WYC A;  2H10 A;  5J3W A;  4EUV A;  1XJ6 A;  4H6J B;  4HHD A;  1OTE A;  1K0K A;  4Q8I A;  4DRT A;  3BWL A;  1K4E A;  4OQH A;  4EBN A;  5L2F A;  4LV0 A;  3KYZ A;  2OAQ 1;  5F6A A;  3LR3 A;  2BG1 A;  5FI6 A;  2JKR M;  2P9V B;  2ZC5 B;  4PKY A;  1AWI A;  1FOF A;  1KE3 A;  1OJ5 A;  4Y2F A;  3O88 A;  4QU3 A;  3VP3 A;  3EOI A;  1BSG A;  4HES A;  4EES A;  1K55 C;  1IOU A;  4DJ3 A;  1CI9 A;  4R3B A;  1N4O A;  1WYB A;  1JNU A;  4D2O A;  3WS4 A;  3P09 A;  1KDW A;  3UDI A;  2V0W A;  5F1G A;  4JLF A;  2QWS A;  3N8L A;  4I3A A;  5E43 A;  4KZ5 A;  4E6W A;  4MLL A;  3ZDJ A;  1GHP A;  3F1N B;  1TS7 A;  3HLB A;  5A93 A;  1CI8 A;  3BYD A;  4NG2 A;  3C5A A;  2BLS A;  3GEC A;  4DXB A;  1JWZ A;  3CPT B;  1N9N A;  2A49 A;  1TD5 A;  2O9A A;  2XD5 A;  4X1L A;  2H0T A;  4MN5 A;  5AQ7 A;  2WGW A;  3A0R A;  3W8K A;  1LT0 A;  2ZM2 A;  3LCE A;  1OTI A;  4EQ1 A;  1Y4O A;  3HLG A;  5EM0 A;  1O7E A;  2QPN A;  3MBZ A;  5L10 A;  5GHZ A;  5DF8 A;  2NUT C;  3ZGA B;  3UE6 A;  3HLC A;  1OJG A;  1MZU A;  1XA1 A;  4IVK A;  3G32 A;  1VM1 A;  5KSC A;  3UN7 A;  3EQU A;  4QY5 A;  5LBR A;  4XT2 A;  2W1R A;  2W0N A;  2HDR A;  3T1X A;  4KQD A;  3O86 A;  4YOF A;  3LY3 A;  3LIE A;  4UQI S;  4RX2 A;  4BBV A;  4UEY A;  1YQS A;  3P01 A;  1G5U A;  5F68 A;  2QJ7 A;  4KQR A;  2ZOI A;  4EWF A;  3CUE C;  3PBQ A;  3C4P A;  3T4T A;  1D7E A;  4CJN A;  1G28 A;  4K0W A;  2XRN A;  4CPK A;  4Y5F A;  3VOY A;  2CC1 A;  3OCN A;  2W1T A;  4OPQ A;  5GLA A;  5FQQ A;  4L0L A;  4YWZ A;  2H28 A;  5F83 A;  1GSX A;  4KZ3 A;  3BLS A;  1KDS A;  1MXO A;  4N9L A;  4WBG A;  1NY0 A;  4G3W A;  5G4Y A;  3GDI A;  3JPU A;  1BLS A;  3SZT A;  3SH7 A;  2JKG A;  2V8F A;  2V1A A;  2H0Y A;  4WYY A;  5U47 A;  3UPP A;  4EXO A;  3LO7 A;  4F3L B;  4JF5 A;  4CQH A;  3ULF A;  1XX2 A;  4E3M A;  2WGW B;  2B02 A;  5TJJ A;  1K56 A;  1K57 C;  3QP6 A;  4EBP A;  4GKU A;  1GCE A;  3F1P A;  3A3I A;  3NEC A;  4HJ4 A;  4LGW A;  1YAX A;  1PW8 A;  3LR5 A;  2HDQ A;  1NZU A;  4RX3 A;  5AQ9 A;  1F5M A;  2ZQD A;  3IF6 A;  2V1Z A;  3H82 B;  4MN6 A;  1K38 A;  3ZVW A;  4OLG A;  2V8C A;  2PR6 A;  2XD1 A;  3NCK A;  3OPL A;  1PZP A;  1HZO A;  1L0F A;  4FTX A;  2XFT A;  3VFH A;  4S2L A;  2PBD P;  2WZZ A;  2ZC6 B;  3QNC A;  3WRZ A;  3CLO A;  3BRM A;  1T18 A;  3ZCZ A;  5JYP A;  2JKF A;  2WKR A;  3R7W A;  3TG9 A;  2JC7 A;  3N6I A;  2GX5 A;  3T4L A;  4ZAM A;  2L4R A;  1TS8 A;  5FAQ A;  1QME A;  5EFW A;  3CHW P;  2Y59 A;  3T1R A;  3OPP A;  3HUN A;  3DTE A;  2M7V A;  1KE0 A;  2XLN A;  4G3K A;  3G2Y A;  4GJ4 A;  4E04 A;  5EVE A;  1Z09 A;  1YM1 A;  3N8S A;  3IXG A;  3L7H A;  3BFC A;  2Z6C A;  3S22 A;  4OQI A;  2CMN A;  3AGD A;  2PYP A;  1GHI A;  4OLD A;  3KSI A;  1K4F A;  3A3J A;  4KZA A;  1SKO A;  3DWZ A;  1BUE A;  1FQG A;  4D60 A;  1YSQ A;  1NRF A;  2UWX A;  3HCY A;  3UME A;  2ZL1 B;  4JXV A;  2GNX A;  4U0T A;  3G2Z A;  1G6A A;  1OTD A;  2EA9 A;  3UB5 P;  5BOH A;  3IXD A;  1VEU A;  3BFF A;  4R3J A;  4HBU A;  4EV4 A;  2KOI A;  4GNU A;  4LFU A;  3W4P A;  1JTD A;  2PU4 A;  3VP0 A;  4OP8 A;  2UV0 E;  1MWS A;  3U2A A;  1YKD A;  1PIO A;  3LY4 A;  4FUW A;  4DKI A;  5FAT A;  3IWQ A;  4X56 A;  5EVI C;  2J9P A;  4FCF A;  3UDF A;  1ACF A;  5FAS A;  5CEC A;  3WS0 A;  1XPB A;  3E4P A;  1W5D A;  3KSF A;  5KMW A;  3V50 A;  3ZNT A;  4Z9Q A;  3B47 A;  4LV3 A;  2WAF A;  2D01 A;  1KOU A;  2PR5 A;  2Y2J A;  2IA2 A;  2WGV A;  4JF4 A;  4B9O A;  3IS2 A;  3FYZ A;  2XDM A;  4ZJ3 A;  2MJ6 A;  3SH9 A;  4KUK A;  5DTT A;  4ZJ2 A;  5DVA A;  2WYX A;  2GJ3 A;  5FEF A;  2ZMA A;  4MBH A;  3NOP C;  2GDN A;  3LEQ A;  2G7U A;  3GSG A;  3LUQ A;  1SZV A;  2INW A;  3ZG9 B;  5M19 A;  4LCM A;  3WS1 A;  4JBF A;  1MWT A;  4HY8 A;  3D3O A;  4NEE D;  3SS5 A;  1OT9 A;  2FFF B;  1NRJ A;  5J7E A;  4B4X A;  1YLT A;  3TSG A;  3G30 A;  4MDZ A;  3TE8 A;  1FSY A;  3ZYT A;  4BD0 A;  1IYP A;  4S2O A;  2G2W A;  1J3W A;  4N9K A;  4DE2 A;  3M2K A;  2EX2 A;  3A3F A;  3JVV A;  5HWW A;  4CLC B;  1VQQ A;  1I2W A;  4L9F A;  4KG5 A;  4S2I A;  4K91 A;  3IWI A;  4GDN A;  3KYE A;  2OOL A;  5EEC A;  4GS9 A;  4Y0U A;  5EVI A;  4HBT A;  3T4S A;  3S4X A;  4OPR A;  2IWD A;  3FKW A;  4NET A;  4BBU A;  4E3O A;  4OPZ A;  2XEP A;  3ZG5 A;  1JWV A;  4I3I A;  5HZH A;  1MKI A;  3IT9 A;  3MZE A;  4UHU A;  5DF9 A;  2PHY A;  2XGN A;  2VX8 A;  4UQI M;  1CK3 A;  1C3B A;  3UE0 A;  4R6L A;  4Q0H A;  3MFX A;  5L09 A;  3P98 A;  3PBT A;  1K6R A;  4QPR A;  4ZBE A;  4OOL A;  3NDE A;  4N1X A;  2HP6 A;  3GMW A;  2Y4A A;  3FPW A;  4RVA A;  2QMI A;  4HJ3 A;  2ZC7 A;  1CEG A;  2VV6 A;  1DJA A;  5DKL A;  3EGX C;  3GV9 A;  3V3S A;  5G4Z A;  5CER A;  3RTY A;  1NZO A;  4KUO A;  4Y17 A;  4IUK A;  4HI4 A;  2XA7 S;  2EX8 A;  2GZA A;  4R4S A;  4QB8 A;  3AGF A;  4KG6 A;  2Y2I A;  3GVB A;  3HLW A;  5MC7 A;  4XXR A;  3CAX A;  1GA9 A;  1VHM A;  4MN7 A;  1XXM A;  3ITB A;  1K56 D;  1ZKJ A;  4NXB A;  1NJ4 A;  1FCO A;  1PW1 A;  3FZC A;  5FAO A;  3MKF A;  4GD8 A;  3E2K A;  1T19 A;  3TJZ C;  4QD4 A;  5HAR A;  1BLP A;  1ZG4 A;  5FL3 A;  3S7P A;  1BT5 A;  4ETX A;  2Y91 A;  5HL6 A;  3VSK A;  3MQQ A;  3HBR A;  1H8Z A;  3WS5 A;  1D1J A;  4WEJ A;  4HNB A;  1RCJ A;  3IHA A;  1ESU A;  2HDU A;  4N1H A;  4GN2 A;  3LFV A;  2HGV A;  5I94 A;  1L0D A;  1H0M A;  5FDS A;  3HVF A;  4NK3 A;  3A3E A;  2QJ5 A;  4S2N A;  3BW6 A;  1YPR A;  3BEB A;  4DDY A;  4QWO A;  5M18 A;  3T12 B;  4DE0 A;  3ISG A;  2LB9 A;  3QNB A;  4XUZ A;  4IVI A;  1YLW A;  2W3G A;  4IUH A;  3E98 A;  2D02 A;  4QY6 A;  3UMD A;  5IS1 A;  1YLP A;  2P7J A;  3MQO A;  2O99 A;  2H5S A;  1CF0 A;  5C5K A;  4KZ8 A;  4P6B A;  3PAG A;  3PBO A;  3V3R A;  1ERO A;  4X69 A;  4JXG A;  4JXW A;  4I5S A;  3UE1 A;  3UO9 A;  2DMW A;  2P08 A;  1ZHH B;  2WZX A;  2OV5 A;  5J4E A;  2VKS A;  4HH3 A;  2I9V A;  3NUL A;  4GZB A;  1J9M A;  4OON A;  1LI0 A;  1XA7 A;  3D72 A;  3RXX A;  3BLM A;  2VGK A;  1SKF A;  4OQ0 A;  5HWT A;  3K3C A;  3KYQ A;  1WA9 A;  2Y2O A;  5DTK A;  1PI4 A;  3Q7V A;  4EEU A;  3OOV A;  4OP5 A;  4EER A;  1WE4 A;  3LID A;  1ES3 A;  4I38 A;  4X25 A;  1TF1 A;  5DF7 A;  4KZ6 A;  1PFL A;  2PU2 A;  5FQM A;  4UAA A;  3IF6 C;  1F9I A;  5EPH A;  5HX9 A;  3FPV A;  3S7O A;  1V9Z A;  4E3I A;  1HVB A;  2Y2N A;  3VOL A;  3A0V A;  4YFM A;  4GDB A;  5HDS A;  3MZD A;  3S7Q A;  4X53 A;  4Y0O A;  1ES4 A;  4ARZ A;  1W7F A;  4JGR A;  1LL9 A;  2Q9M A;  4PPR A;  3DAV A;  2HP9 A;  2WK0 A;  3IX3 A;  4Q0I A;  5HWV A;  3C4O A;  2O9C A;  3IHB A;  4P85 A;  3F1O A;  3CI6 A;  3HL9 A;  5AVE A;  2VJW A;  5DFX A;  2ZD8 A;  1RGZ A;  1ZTU A;  2J9O A;  2NUP C;  4DXC A;  2VLG A;  1NWZ A;  4E3J A;  3UPN A;  2Z2M B;  3L9K A;  3HLF A;  3B33 A;  1PWG A;  2VV7 A;  3LR0 A;  1FCM A;  2OAP 1;  4JGP A;  3K3D A;  3GQZ A;  3RH8 B;  3C7V A;  1L0E A;  4ZDX A;  3TOI A;  3IH8 A;  3G4P A;  4PAU A;  1OME A;  2HZ5 A;  1ERQ A;  4GD6 A;  4L9E A;  2IWC A;  2Y2K A;  1XFN A;  2ZMF A;  3QHY A;  2ZQ8 A;  2Y2M A;  3S7N A;  4EET B;  4S2P A;  5D3O A;  4R70 A;  3MR0 A;  3HLD A;  2PYR A;  5HW3 A;  2OLV A;  3MZF A;  1XJ3 A;  1ONH A;  2EX9 A;  4DE3 A;  4WEL A;  4BMW A;  1NLY A;  2E8J A;  1XJ4 A;  4PM8 A;  2L0W A;  3G31 A;  3EEA A;  4XT2 B;  1S0W A;  3NBL A;  4Q0J A;  3N4I A;  4X55 A;  4HQA A;  2ZM8 A;  4PM6 A;  3VP4 A;  2XFS A;  5HFO A;  1OT6 A;  3QP8 A;  2Q0O A;  2FZ0 A;  4B88 A;  1EI5 A;  2Y2G A;  2QZ6 A;  4WZ4 A;  2EXA A;  1TDL A;  3O3V A;  4MCW A;  5EVI D;  2KLI A;  1CQA A;  3SS3 A;  5CHJ A;  1P9R A;  1DY6 A;  3C7U A;  3BY9 A;  2W1T B;  4BL3 A;  3OZH A;  3GR2 A;  3MSH A;  4EBL A;  5M1A A;  5DJT A;  1M6K A;  4HOI A;  1BLH A;  3F1O B;  4MEZ A;  5HD5 A;  1RGY A;  2FH5 A;  4M4X A;  3H7W A;  3V5M A;  1G68 A;  1YMS A;  3EQV A;  3PBR A;  2C5W B;  2EX6 A;  5CGX A;  3CG5 A;  1MWU A;  4RQ9 A;  1IYS A;  4PM9 A;  3EGD C;  5DTS A;  5E2E A;  2HP5 A;  4U3T A;  2W3E A;  4Y0T A;  3IF5 A;  1LLB A;  4II7 A;  4P87 A;  2XH9 A;  2XK1 A;  3IBJ A;  3F1P B;  2XA7 M;  3DTM A;  2ZJ9 A;  3E4Q A;  2OSU A;  1SCW A;  5GLD A;  1FIL A;  1ODV A;  3QP4 A;  3A0S A;  4BL2 A;  5IHV A;  5A92 A;  3B42 A;  1IEM A;  1ONG A;  3IF6 B;  4ETZ A;  4S2M A;  3VP2 A;  3PBS A;  2HF6 A;  5HAI A;  4P6Z S;  3Q07 A;  1UGU A;  2QHK A;  5CTM A;  2Y2L A;  3ZG8 B;  1IFQ A;  3IH9 A;  3GRJ A;  1LL8 A;  2FFY A;  4OOM A;  1AXB A;  1YMX A;  4MBF A;  4BWI A;  3CMZ A;  3MXS A;  5EUA A;  5HDC A;  3PTE A;  4HIA A;  4OVD A;  3LR4 A;  4Z1W A;  3MS6 A;  5HPF A;  2PDR A;  1LSV A;  3VP1 A;  3VMA A;  3R7W B;  3ZQ5 A;  5TBM A;  4YNR A;  2WAD A;  1XGI A;  1Q2Q A;  3JYI A;  2PRF A;  3C8C A;  1LI9 A;  1N9B A;  1ZG6 A;  2HV1 A;  4FOF A;  1VET A;  1YLZ A;  3UE3 A;  5HAP A;  5J8X A;  3N7W A;  2BAS A;  3DWK A;  2VGJ A;  1TS6 A;  3H9W A;  2O9B A;  1EW0 A;  1V9Y A;  2Y79 A;  4OKP A;  2YKF A;  2Y2Q A;  2EWV A;  3ZG7 B;  1FR1 A;  2LB5 A;  4KG2 A;  1KVM A;  2YKH A;  4LRZ E;  5FQK A;  4H8R A;  3IX4 A;  3M2J A;  3RJU A;  1NYY A;  1XKZ A;  1PI5 A;  2L1M A;  2R78 A;  1HD8 A;  1LHY A;  4F94 A;  4DMZ A;  5FAP A;  2ZM0 A;  3W4O A;  1W63 Q;  2B18 A;  2WUQ A;  3BQA A;  4ME4 A;  5AVF A;  4O01 A;  5DKK A;  4Y15 A;  4H6J A;  4OH0 A;  4S2J A;  3FV7 A;  3LIC A;  2HPB A;  1PRQ A;  4M3K A;  2K31 A;  1SKO B;  1K54 C;  4RA7 A;  4X68 A;  4NXG A;  4EU0 A;  4JKT A;  2J3T D;  2VGL S;  1N9O A;  3LEZ A;  4DN0 A;  5HPI A;  1PZO A;  1E3U D;  1HLU P;  1VEU B;  3SW1 A;  2P9V A;  1HTZ A;  4EW7 A;  4E6X A;  3C30 A;  4FH4 A;  2ZLY A;  2O0Y A;  3LI9 A;  4QHC A;  3UB7 A;  1KGE A;  2Q9N A;  4WL9 A;  5CEB A;  2K2N A;  1W8Q A;  5FI7 A;  4LRX C;  3MJQ A;  3D4F A;  3G34 A;  3OC2 A;  3T1Q B;  3PAE A;  3JVU A;  1BZA A;  1T1C A;  4MNR A;  4S2N C;  2P04 A;  3QP5 A;  4HP4 A;  3C2W A;  1A0K A;  3UDX A;  5A8B A;  1E4D A;  2W3F A;  3F1N A;  1F98 A;  4WZ5 C;  3HJI A;  2IWB A;  3Q81 A;  5K5B A;  4UA7 A;  4PM7 A;  3CPT A;  1ERM A;  1DRM A;  5TR7 A;  1I2S A;  1UWN X;  2Y55 A;  3ZHH A;  3OCL A;  4PMA A;  2JN7 A;  3NI9 A;  3IS2 B;  4GLQ A;  3W2Z A;  4NKP A;  3HUM A;  3FC7 A;  2JKR I;  3OPR A;  4AFI A;  4EEP A;  1Z6F A;  1K54 A;  3M6B A;  3LYX A;  4U0X A;  3TW8 A;  4WF0 A;  4C3Q A;  1UWP X;  2J3T C;  3DW0 A;  3T4Q A;  4LCL A;  4HP9 A;  1D06 A;  4LV1 A;  3CIT A;  3E0Y A;  1FIK A;  3NIA A;  5F5Y A;  1LSW A;  2HJ9 C;  5G18 A;  3E4O A;  1GHM A;  3IQA A;  3CWF A;  3VE4 A;  2P74 A;  1L3L A;  3IBR A;  1S4R A;  4GS9 B;  4O0P A;  4OPY A;  5EVI B;  4IJG A;  4QJG A;  2I72 A;  2JE5 A;  2JHE A;  5TGF A;  1H5X A;  5CHM A;  4B4Z A;  4WZ5 A;  3K2N A;  1EWZ A;  4R4R A;  4WMC A;  2J80 A;  1OPX A;  2QKP A;  4R1G A;  3FKV A;  1G6O A;  1BTL A;  3C38 A;  2PAV P;  2EFX A;  1GSW A;  5CRF A;  4LLO B;  3ZG0 A;  3KSG A;  3CZD A;  1DJB A;  3UB8 A;  2Y2H A;  4WLA A;  1PWD A;  4UA9 A;  1K6S A;  4HEF A;  4F3L A;  2A24 A;  2KX6 A;  4KZ7 A;  4BEN A;  5EOE A;  1FR6 A;  4FD8 A;  1ZC2 A;  3NJA A;  3WWX A;  5CGS A;  1H8M A;  4GCZ A;  3QP2 A;  4X6T A;  1BLC A;  5F82 A;  1H8Y A;  1E3U A;  2XRO A;  1ES2 A;  2J8Y A;  4IBX A;  4LEN A;  1K25 A;  3LIB A;  1T1B A;  2M1C A;  1L0G A;  3SOI A;  3VFF A;  2EXB A;  3O87 A;  5HSQ A;  3H82 A;  3LI8 A;  3WS2 A;  4JGQ A;  3NOU C;  2EFU A;  3LGO A;  1X0O A;  4KZ4 A;  1ESI A;  1KE4 A;  2E8I A;  1OTB A;  5AQA A;  1DP9 A;  4Y13 A;  5GHY A;  4K0X A;  5GHX A;  5HD3 A;  3BFD A;  4CLC D;  4O7D A;  4OOY A;  5CX7 A;  1OTA A;  2X02 A;  1I5Q A;  1K55 A;  1TDG A;  2VK3 A;  1RP5 A;  4WM9 A;  2ZOH A;  3VV4 A;  1JTG A;  3TRC A;  5AJG A;  4P6Z M;  2B95 A;  3BQ8 A;  2Z6D A;  4RYE A;  3PYP A;  5CTN A;  1JWP A;  2J7V A;  4UA6 A;  1DP8 A;  4KQQ A;  1IYO A;  3PBN A;  3M6H A;  1O07 A;  4ZRR A;  5FEG A;  2B5R A;  5EE8 A;  3Q1F A;  5A91 A;  2V9A A;  2Y2P A;  4JF6 A;  2ZMV A;  2PD7 A;  1YLY A;  1IYQ A;  2AVX A;  3NHQ A;  3OPH A;  4R23 A;  1NLZ A;  1ES5 A;  4FH2 A;  2A3U A;  1BUL A;  4C6Y A;  2WGI A;  4XUX A;  3ZVT A;  2VV8 A;  1IKI A;  1S4S A;  2R9W A;  2A24 B;  1N9L A;  5HDD A;  2HDS A;  3UB6 A;  5EM1 A;  3BM6 A;  2V0U A;  2ZL1 A;  3MXR A;  1NXY A;  2VEA A;  4B93 A;  3O5Y A;  5TFQ A;  3V39 A;  2XR0 A;  5HAQ A;  2Z2L B;  3Q7V B;  3MFD A;  2KDK A;  4X1M A;  2XQZ A;  3SH8 A;  5FQJ A;  3RXW A;  1XFQ A;  3NY4 A;  2PT7 A;  4DE1 A;  4R0Q A;  2Y8H A;  2JKT I;  5E2G A;  4ID4 A;  2PD8 A;  4I39 A;  4NXE A;  3DBA A;  5CGW A;  4JGO A;  4GW9 A;  1S67 L;  1W63 M;  4CLC C;  1IEL A;  3BEC A;  5CHU A;  1W8Y A;  3KSH A;  2HJE A;  1PYY A;  2VGL M;  1TEM A;  4I3J A;  2OWJ A;  3IX8 A;  2W3H A;  2VA0 A;  5CED A;  3CUE A;  1LL5 A;  4ARZ B;  4LRY C;  2V2F F;  2XF3 A;  2ZQC A;  1TS0 A;  3HLE A;  3NC8 A;  5KIZ A;  3UB9 A;  4BD1 A;  1BYW A;  4LPZ A;  4R3A A;  4ZTK A;  5F69 A;  5IT5 A; 
#chains in the Genus database with same CATH homology
 2JKT M;  4YOF A;  3LIE A;  4NXB A;  4UQI S;  2LB5 A;  2YKH A;  4LRZ E;  4BBV A;  1T19 A;  4UEY A;  3P01 A;  4HJ6 A;  4CLC E;  3TJZ C;  2L1M A;  5FL3 A;  5F68 A;  2R78 A;  1S66 L;  1P9W A;  3S7P A;  2QJ7 A;  2ZOI A;  3OBF A;  2WKQ A;  4DMZ A;  4ETX A;  3CUE C;  3PBQ A;  5HL6 A;  3MQQ A;  4O8G A;  1W63 Q;  1D7E A;  3T4T A;  2B18 A;  3BQA A;  4ME4 A;  5AVF A;  1G28 A;  4O01 A;  2XRN A;  5DKK A;  4H6J A;  4Y5F A;  4WEJ A;  3LIC A;  1P0Z A;  2W1T A;  3OCN A;  2K31 A;  4HNB A;  2EWW A;  4L0L A;  4YWZ A;  2H28 A;  4R38 A;  4G3V A;  3LFV A;  2HGV A;  3PR6 A;  4NXG A;  5IU1 A;  1GSX A;  4EU0 A;  2J3T D;  2VGL S;  1N9O A;  4DN0 A;  2V1B A;  3LIA A;  5HPI A;  1DP6 A;  2QJ5 A;  3BW6 A;  3SW1 A;  4G3W A;  5G4Y A;  3GDI A;  4IHQ A;  5I5L A;  4EW7 A;  3C30 A;  4K08 A;  4WEK A;  1T1A A;  2O0Y A;  3LI9 A;  3UB7 A;  2LB9 A;  3NOT C;  4WL9 A;  2V1A A;  1STZ A;  2W3G A;  4IUH A;  4GHI A;  3E98 A;  4EXO A;  4F3L B;  2K2N A;  4FSF A;  4CQH A;  2A2L A;  2D02 A;  3UMD A;  3ULF A;  5IS1 A;  4LRX C;  3MJQ A;  2QYB A;  4L9G A;  3BJN A;  3OC2 A;  4CLC A;  2P7J A;  3MQO A;  2O99 A;  1MC0 A;  2B02 A;  5TJJ A;  5C5K A;  3JVU A;  1T1C A;  3FG8 A;  2P04 A;  3PBO A;  3F1P A;  4HP4 A;  3C2W A;  3OLO A;  4I5S A;  5A8B A;  4WN5 A;  4HJ4 A;  3F1N A;  2W3F A;  1MKM A;  1F98 A;  2DMW A;  3HJI A;  1YAX A;  2P08 A;  1ZHH B;  1H3Q A;  5K5B A;  3LR5 A;  4DJ2 A;  5J4E A;  2VKS A;  4HH3 A;  2I9V A;  1F5M A;  3D72 A;  5L8M A;  3VE3 A;  3H82 B;  4MN6 A;  4NXF A;  2VZW A;  1DRM A;  3P7N A;  5HWT A;  1UWN X;  3K3C A;  3KYQ A;  1WA9 A;  1VB6 A;  2PR6 A;  3EWK A;  3OCL A;  4EEU A;  2JN7 A;  3OOV A;  4EER A;  3IS2 B;  3LID A;  2K7S A;  4GLQ A;  3T4O A;  1S1Y A;  3W2Z A;  4BJP A;  4NKP A;  1P97 A;  4I38 A;  3MQ0 A;  3FC7 A;  1TF1 A;  2JKR I;  3CLO A;  2W3D A;  4AFI A;  4EEP A;  1T18 A;  1F9I A;  3LIF A;  3T4J A;  3LYX A;  3TW8 A;  3FPV A;  2WKR A;  3R7W A;  3S7O A;  1V9Z A;  4WF0 A;  3PXP A;  1LSX A;  3G6O A;  1UWP X;  2GX5 A;  3T4L A;  3VOL A;  3A0V A;  2J3T C;  3H7W B;  2L4R A;  5HDS A;  3T4Q A;  3S7Q A;  4HP9 A;  1S1Z A;  1TS8 A;  3EEH A;  4ARZ A;  5EFW A;  1D06 A;  4JGR A;  3CIT A;  3E0Y A;  5F5Y A;  1LSW A;  2M7U A;  2HJ9 C;  2M7V A;  4Q0I A;  4PKY G;  3E4O A;  5HWV A;  3KX0 X;  4G3K A;  2W27 A;  4GJ4 A;  2O9C A;  3CWF A;  4Y3I A;  3VE4 A;  4E04 A;  4MMN A;  3IBR A;  3F1O A;  1S4R A;  3CI6 A;  2Z6C A;  4GS9 B;  5AVE A;  4O0P A;  2CMN A;  4IJG A;  2VJW A;  5DFX A;  2PYP A;  3KSI A;  1ZTU A;  2JHE A;  2NUP C;  4GHI B;  2VLG A;  2J3W A;  1NWZ A;  2XSS A;  3K2N A;  1GSV A;  5DJU A;  1YSQ A;  3B33 A;  2J80 A;  3HCY A;  1OPX A;  5KSH A;  2QKP A;  2VV7 A;  3LR0 A;  3UME A;  2OAP 1;  1G6O A;  4JGP A;  2GNX A;  3C38 A;  1OTD A;  3MMH A;  2EA9 A;  3K3D A;  3RH8 B;  1GSW A;  4LLO B;  3KSG A;  3PHY A;  3ICY A;  4PAU A;  3UB8 A;  4L9E A;  2KOI A;  4WLA A;  1XFN A;  1XJ2 A;  3R4K A;  2ZMF A;  4HH2 A;  3S7N A;  4EET B;  4F3L A;  4PHT A;  4R70 A;  2A24 A;  3MR0 A;  2KX6 A;  2ZBB A;  3U2A A;  1YKD A;  5TBM B;  2PYR A;  3V67 A;  3KO6 A;  2OWH A;  1XJ3 A;  3NJA A;  5DFY A;  4WEL A;  3RFB A;  4BMW A;  4BBT A;  1NLY A;  3MXQ A;  1H8M A;  4GCZ A;  3T4K A;  1XJ4 A;  1Y28 A;  3BY8 A;  2XRO A;  2L0W A;  4XT2 B;  3EEA A;  4Q0J A;  4HQA A;  1YSP A;  3E4P A;  3LIB A;  1T1B A;  3HJK A;  2M1C A;  3KSF A;  1OT6 A;  5HSQ A;  2FZ0 A;  3H82 A;  3LI8 A;  3B47 A;  2WKP A;  3MF0 A;  4JGQ A;  4MCW A;  3NOU C;  2KLI A;  2D01 A;  4KQO A;  1KOU A;  2PR5 A;  1X0O A;  4WUJ A;  2IA2 A;  3T50 A;  4B9O A;  1OTB A;  3IS2 A;  1P9R A;  1DP9 A;  5J3W A;  4EUV A;  2MJ6 A;  1XJ6 A;  4H6J B;  4HHD A;  4KUK A;  3BY9 A;  5HD3 A;  2W1T B;  1OTE A;  4CLC D;  5CX7 A;  1OTA A;  2GJ3 A;  3BWL A;  3NOP C;  5DJT A;  4HOI A;  2G7U A;  2ZOH A;  3VV4 A;  3F1O B;  3KYZ A;  2OAQ 1;  3LUQ A;  3TRC A;  2INW A;  5HD5 A;  5F6A A;  2FH5 A;  5AJG A;  3LR3 A;  4M4X A;  2JKR M;  4P6Z M;  3BQ8 A;  2Z6D A;  4HY8 A;  3D3O A;  3H7W A;  4NEE D;  1OT9 A;  3PYP A;  1NRJ A;  4PKY A;  5J7E A;  1DP8 A;  4MDZ A;  3TE8 A;  1OJ5 A;  3EQV A;  3PBN A;  3PBR A;  4Y2F A;  4ZRR A;  3ZYT A;  3EOI A;  4EES A;  2V9A A;  1IOU A;  4RQ9 A;  2ZMV A;  3JVV A;  5HWW A;  3EGD C;  4DJ3 A;  2PD7 A;  4CLC B;  2W3E A;  4L9F A;  1JNU A;  3NHQ A;  2V0W A;  4II7 A;  1NLZ A;  2QWS A;  2OOL A;  4GS9 A;  4I3A A;  3IBJ A;  3F1P B;  2XA7 M;  3T4S A;  3F1N B;  1TS7 A;  3E4Q A;  4BBU A;  2VV8 A;  1ODV A;  1S4S A;  3A0S A;  4I3I A;  5HZH A;  3GEC A;  5DF9 A;  2A24 B;  2PHY A;  3B42 A;  1N9L A;  5HDD A;  4ETZ A;  2VX8 A;  1N9N A;  1TD5 A;  2O9A A;  3UB6 A;  4UQI M;  4MN5 A;  3PBS A;  2HF6 A;  2V0U A;  4R6L A;  4Q0H A;  3MFX A;  2VEA A;  3A0R A;  5IT5 A;  4B93 A;  3O5Y A;  4P6Z S;  3PBT A;  1UGU A;  2QHK A;  4QPR A;  4OOL A;  1LT0 A;  2KDK A;  1OTI A;  1XFQ A;  1IFQ A;  4EQ1 A;  2PT7 A;  1LL8 A;  4OOM A;  2Y8H A;  2JKT I;  4BWI A;  2PD8 A;  4I39 A;  4NXE A;  3FPW A;  3DBA A;  5HDC A;  4HIA A;  3LR4 A;  4HJ3 A;  4Z1W A;  4JGO A;  2VV6 A;  4GW9 A;  2NUT C;  5DKL A;  2PDR A;  5HPF A;  1S67 L;  1W63 M;  1LSV A;  3EGX C;  4CLC C;  5G4Z A;  3UE6 A;  1OJG A;  3RTY A;  3KSH A;  3R7W B;  1MZU A;  2HJE A;  4KUO A;  3ZQ5 A;  4IUK A;  5TBM A;  4YNR A;  2VGL M;  4I3J A;  2OWJ A;  2W3H A;  3C8C A;  4HI4 A;  2VA0 A;  2XA7 S;  2GZA A;  2HV1 A;  3CUE A;  4FOF A;  4ARZ B;  3UE3 A;  4LRY C;  3EQU A;  5LBR A;  1TS0 A;  5MC7 A;  4XT2 A;  2BAS A;  2W1R A;  3CAX A;  5KIZ A;  1TS6 A;  2W0N A;  3UB9 A;  1BYW A;  3H9W A;  4LPZ A;  2O9B A;  1VHM A;  4KQD A;  1EW0 A;  4MN7 A;  1V9Y A;  2Y79 A;  4R3A A;  5F69 A;  2YKF A;  2EWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...