2KDLA

Nmr structures of ga95 and gb95, two designed proteins with 95% sequence identity but different folds and functions
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKELVDAGTAEKYIKLIANAKTVEGVWTLKDEIKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords designed protein
publication title A minimal sequence code for switching protein structure and function.
pubmed doi rcsb
molecule tags Human serum albumin binding protein
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2kdlA00
1PRBA 1GJTA 2LHCA 2N35A 2KDLA 2LHGA 1GJSA 2JWSA 2VDBB 1GABA 2FS1A 1TF0B 2J5YA 2MH8A
chains in the Genus database with same CATH superfamily
1QUSA 1GJTA 1C7YA 3IG5A 2DAMA 3KOXE 3MK6A 4QNRA 4W5WA 3J7BA 2UXCM 4B7HA 1QAOA 5DYIA 2CV2A 1SXJE 1J5EM 1IN5A 4NC6A 2JP7A 3E9SA 4AG6A 4FVMA 1K3WA 7CATA 2VF7A 1QQWA 1GKIA 2JY6B 3SAUA 2HWJA 3U60B 3U6QA 1TH2A 2VQEM 3AOEC 3L2AA 3VKGA 1UM8A 3HHWA 4M9SA 1LTMA 4M0DA 2DWMA 2VIIA 4JI2M 2RGOA 1E94E 2ZAMA 3TWKA 1IBLM 4JYAM 1PJSA 3VK7A 2DZLA 1I94M 1PJQA 4GC5A 2HHHM 2DAGA 2QBYA 1NY5A 4OX9M 2HAKA 2D7EA 3GRRA 2K47A 1OKSA 2CV0A 3TE6A 1OFIA 1HQYE 1PGYA 2CV1A 3C9PA 4XK8F 4MH0E 2KEBA 1QAQA 2EUCA 2LVAA 3C58A 4LGMA 4PDGA 3HX3A 4L4UA 2YNMD 2D7GA 3VKHA 3SYLA 3PFIA 2WSEF 3NBIA 3VDUA 4B3SM 1BVSA 3B7NA 1N36M 3THGA 3VFDA 1IXSB 3LMMA 3E46A 1NHGC 3FTCA 3GRUA 2UUCM 2CWBA 3GLGB 3QWLA 1MN3A 1PJJA 4BBAA 1J09A 3GLHE 3KDSE 4AG5A 2V1UA 4GKJM 1T3TA 5KQ8A 3GLIA 3UZUA 2KRUA 3W0LB 4FWGA 3GQ5A 2LWXA 3U6DA 4REZA 2HKJA 3JR5A 2FNAA 1XC8A 4FCTA 1R2YA 2G5GX 1GL6A 2M5ZA 4NOOB 4R71A 4AKGA 3RGPA 3NBXX 1DGBA 4GEWA 3UK6A 4IJEA 5EXPA 1PM5A 2JY8A 3HJQA 4LJAA 4JI0M 4BLCA 3UMMA 3GLFE 2L6OA 1D0KA 2CP8A 2DWZB 2W82A 2QZ4A 3F92A 3GRVA 3KOZE 2V1CA 4ANRA 1Z5CA 3LCVB 2Z3XA 2CHGA 1QZMA 3I04M 2Y20A 4B3RM 3I01M 1DO2A 3TQSA 3IG8A 2DAIA 2XSZD 2XH9A 1P3QQ 2KA6B 3DA1A 2DAKA 3J81S 3I4VA 3FD9A 4TUWA 3KVWA 1PRBA 2HL7A 2K0BX 2R6FA 1T6OA 4JN6A 2QPAA 2KDLA 2JY5A 2QCUA 3UJNA 1K82A 2JA2A 2OO9A 1NV8A 2BWEA 4XBOA 5FTNA 3WHLA 1JB0F 5JI2E 1Q39A 3KOYE 1DV0A 2R46A 3BOSA 1XNRM 4NRVA 5IREB 3PVSA 2GQFA 1WGLA 4LY6A 2DZNB 1NO1A 1HQCA 4DR7M 5EP4A 2L4FA 2A5YB 2CEAA 3E21A 3LQQA 1IBKM 2F5SA 1YSYA 2N35A 1PJIA 2EKFA 3HU1A 2F5PA 2KNZA 4DR1M 2Z8YM 3IECA 4DV0M 5ITXA 2EKKA 2ZTCA 4IBKA 3T38A 1W5TA 3ZCBB 2JWSA 1KYIA 1SXJA 4NL4H 3H4MA 1L2BA 3V76A 4FD2A 3AV0A 4FCWA 1NVMA 2ZBKB 5JI3E 2DNAA 3SAWA 1IBMM 4JI6M 1F4IA 2F5OA 2F4VM 1MJGM 2OOAA 1HJPA 3J80S 1QUTA 4HL4A 1IY1A 1XXHB 3JR4A 4CJ6A 3FUWA 2XZUA 4G4QA 2CRUA 4G4NA 1SXJB 2JNHA 1G3IA 1XNQM 1NNUC 4B7GA 4MGHA 1ZMWA 2L09A 1VQ1A 2Y0QA 2YQZA 5L8RF 2RKOA 5A2QS 2JZ1A 3A42A 1CUKA 1Q02A 3Q8GA 4OW0A 2ZM6M 3K1JA 2DVWB 2G3QA 4DV3M 1Q3CA 1EIJA 3SMPA 5C1BA 1NV9A 3I4YA 1A5TA 2LBCA 5ITXE 4KO8A 4F2LA 5DFLA 3A45A 3RE8A 2YR0A 4I8OA 3FRHA 3U6CA 4X66M 3TPZA 3SFZA 4IBFA 4DUYM 4Z8XA 1JR3D 4LF7M 5FSWA 3FTEA 3GPXA 2FH0A 3KW6A 2KRKA 4LFBM 4RF1A 3EIEA 1VDLA 3I51A 4NRWA 3NWLA 5BPVA 1HNZM 4K0KM 3MHVC 3IHPA 5H37D 2BNKA 2R45A 1EFUB 3KSXA 4L15A 4RNAA 3BBZA 1X37A 2OQ4A 2QQ8A 1DGHA 4DV2M 4JI3M 3SHFA 2LVNC 2CFOA 2KZUA 2E5LM 2R0IA 3GLHA 2ERCA 2M60A 3B7ZA 4LF8M 4AW4A 4D81A 1N77A 4WW0A 1ORYB 5KPRA 4WP2A 2FOIC 4YY3M 1TGUA 3ILKA 3EIHA 2DI0A 1WJ7A 1TH3A 1GVNA 2K6BA 2LNHC 3HJSA 4IJFA 4EIWA 4DV7M 4WURA 2JXNA 2J7OA 3SMSA 3KS4A 2QBYB 1QANA 3U6LA 1MU5A 5GKNA 4I5SA 4NXNM 4DR6M 4L78A 2MJ5B 1N75A 3SHGB 3A98B 4G3OA 4OVZA 4X62M 3H4JA 3GLFA 4A3VB 3L26A 4R3DA 4AKHA 3MJ5A 2FFJA 3SASA 2LH0A 1G4AE 2LVQD 2MGWA 4LF4M 4AI6A 3WHKA 3HU2A 5EQTA 2P5TA 4M9XA 1HT1E 1VEGA 3SC3A 1TF0B 4PCZA 2DWLA 3KS8A 1NHWC 2I7PA 4G4OA 4QHTA 2I7NA 2OOBA 4I4LA 1JR3E 1T43A 2EJSA 3B89A 1LV7A 2WSCF 3HJ8A 4LRTA 3J27B 5IZ7D 4IBIA 3VDPA 3D8LA 2EA0A 4LRSA 3GQ3A 4NSRA 1XHBA 2J5YA 4LJ4A 5BR8M 3GLIB 2KNAA 2DZOB 2MROB 3LVWA 4GHLA 2QENA 2MR9A 4P17A 2R18A 4LJ8A 2C5RA 2C96A 1L1TA 1MX0A 3PNVA 2KHHA 3LVVA 1L1ZA 1R2ZA 3HU3A 4PD2A 1G71A 4KLNA 4CHTB 1OFHA 3AOGA 2CHVA 1GO5A 4FWHA 1R7RA 3RGSA 3GLGE 1R4GA 2DKLA 2KW0A 3C3EA 4Z6YA 1V92A 4IBCA 4DV6M 4QOZC 3AOEA 1QDTA 1TDHA 5DYGA 4Y28F 1XB2B 1ZAEA 1I4WA 2C9OA 1FNNA 1OQYA 1WGNA 1S3SA 3DOAA 3U5ZA 1NY6A 1WXQA 3GPUA 2O01F 4YHHM 4IBEA 3AL0C 4S12A 2EO2A 1HR0M 1IN6A 1VEKA 1OAOC 1QAMA 1HT2E 1ZV1A 3B7QA 3SYKA 1SG9A 4LJ9A 1QDRA 1SXJD 2RRUA 2C99A 2K9DA 3DZDA 3PNYA 2DWNA 1XMQM 1G41A 1OIPA 1W5SA 2O5RA 3KFUG 1IQPA 5ITYA 3HY5A 4NSOB 3FTFA 3CF6E 2L7IA 4M9ZA 4PT5A 1C1KA 1TR8A 3B9PA 3TWLA 3K9PA 3FKEA 4QHSA 3M0EA 4GITA 3FUVA 4UN2B 2UXDM 3VLFB 5KPZA 3U61A 2OPFA 3L28A 1IFYA 5FTLA 2C9CA 3FTDA 3U6SA 2APLA 1VG5A 1R5LA 3AFHA 4JI1M 4CISA 4AKIA 1L2CA 2LHCA 3MMPA 4DV1M 2FE8A 1IY0A 4B08A 4B3TM 3B74A 4HLQA 3HGIA 3QYBA 1ZQ9A 2VF8A 1Q3BA 4KODA 1JQJC 3BXWA 1AUAA 5E26A 4AZFA 3AKZA 2VQFM 5IWAM 8CATA 4G4RA 2UUBM 2JUJA 1R6BX 2RGHA 2H5XA 4JXJA 4LF9M 1D2NA 1KFVA 2MH8A 4P16A 5ITRA 4DBGB 1HNXM 2L4EA 3KXEC 3R9XB 1GABA 2YFQA 3M6AA 3VK8A 5EP3A 4LG2A 1WHCA 2XLJA 4GRIA 1IY2A 3W0FA 1L8QA 4KT0F 5ITQA 3HWSA 2R44A 3ZQJA 3U60A 2WSFF 1XXHE 3J2PB 1NNJA 3DFZA 2QSFX 2G8LA 5FLXS 1VDDA 4DR3M 2QNJA 1J7KA 4LJ7A 1NJFA 3KSJA 4LJ6A 3U6PA 1IN7A 3GQ4A 4LGYA 1OJLA 2KXEA 4B7FA 1UFZA 3T1HM 1QVRA 2VDBB 2B3TA 3W67A 1JR3A 1DGHB 2Z4RA 5IT9S 2X8AA 1N33M 4DUZM 4LJ5A 2NQ8C 1OIZA 3SATA 3T1YM 5LMUM 4Q7JA 3GLHB 5FTKA 1ZMVA 1DGFA 3FRIA 4II7A 4QOSA 1K3XA 2L2DA 4GMQA 2CUZA 3LW5F 5EP1A 1D0MA 1E32A 4B3MM 4LFCM 2XFTA 2DAEA 4IBGA 5KPTA 1G8PA 3U6OA 1DO0A 5EP2A 3Q8XA 1IXZA 1SXJC 4DR5M 2QP9X 4RF0A 3QYEA 2ZAOA 4DR2M 2LVOC 4ITQA 3ZC7B 4XGIA 2O25A 5ITTA 2LTUA 4OVZB 5EXTA 5C18A 3GLFB 1IXSA 1IN4A 1TH4A 2JZ0A 4BB9A 2Y0TA 1Z59A 3M7GA 3W68A 4AQYM 1N34M 2R4EA 4LCBA 1WIVA 3KP0E 4LFAM 1IM2A 4FW9A 3GLGA 5FTJA 4X65M 3CGWA 2D7HA 4IBJA 2CHQA 5KQDA 3ZH9B 4KHPM 2BJVA 3FYDA 3RFWA 3KOWE 3HHYA 2LVPC 2R65A 1AIPC 3LCUA 4MGIE 3R8FA 3K9OA 3UGJA 4DV5M 3FYCA 1Y8GA 4DV4M 2H1RA 4X64M 2DXIA 1NSFA 1V33A 3FUXA 1RU3A 3TWMA 1EE8A 2F5NA 1N78A 3KP1E 3C3DA 3J7AS 1ZMUA 3HHXA 3K2LA 1TDZA 2FS1A 1NJGA 3CF2A 3T15A 2XGNA 3JAMS 3OTOM 3PXGA 3FUTA 1TTEA 4JV5M 2XEPA 4I81A 1E9SA 2X49A 3HHZA 4JI4M 3GRYA 2BJWA 4MB7A 4L16A 4DR4M 2C98A 4GC9A 1N32M 4F1IA 2J7NA 2Z7JA 2HCBA 2AHMA 3CF0A 1IXRC 2X4AA 3L29A 4GH9A 5E6JA 1V34A 2XZFA 1QZEA 4L6V6 4HEOA 3GO8A 4M0WA 4NXMM 1WR1B 4JI8M 3L25A 3HZJA 4IBBA 2V6ZM 3SARA 4ZPXA 3FUUA 5EXSA 1HNWM 1G59A 3D8BA 3FE3A 4LZJA 4QNMA 4FCVA 2LHGA 2XSZA 4MM3B 4GHAA 1YLAA 3K92A 3SBJA 5FTMA 4D80A 4R7GA 2F5QA 2CE7A 5F3WA 3GPPA 1Z6TA 4LF6M 2BWBA 2L7HA 1KSFX 4OU7A 3GLIE 2R62A 4LF5M 1DGGA 2KZSA 1OTRA 3U5ZB 4IIWA 2LXEA 3GPYA 3A46A 2Q2EB 1H6UA 4GKKM 3TL4X 2UUAM 3L27A 4JI7M 1Z5BA 2GNOA 4LZZA 2DENA 5EJCA 2DHYA 2UU9M 1IN8A 1YE9A 2XF3A 4CGYB 5LMNM 1L2DA 2ZANA 5DNYA 5EXXA 2DHRA 2R4JA 4IBDA 1XXHA 2Y21A 4D82A 1D0LA 2JY7A 4L8RC 2QHOB 5KO3A 4FWDA 4GIPA 3SAVA 1Z5AA 3U61B 4MGZE 4G6ZA 4RKUF 1VEJA 1XMOM 3U6MA 3U6EA 2UXBM 1QYRA 1PJTA 2WZJA 4MGYE 1E9RA 1OAIA 3LQRA 3AJIB 4CIZA 1GLNA 3E4RA 3GP1A 2ZTDA 4MGKE 5ITUA 1GJSA 1XWIA 2KNVA 3HKPA 4PDIA 1YUBA 3CTWB 3K8ZA 2XFSA 1FJGM 3T6PA 1GL7A 4JI5M 3QAUA 2Z4SA
chains in the Genus database with same CATH topology
1PRBA 1GJTA 2LHCA 2N35A 2KDLA 2LHGA 1GJSA 2JWSA 2VDBB 1GABA 2FS1A 1TF0B 2J5YA 2MH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRB A;  1GJT A;  2LHC A;  2N35 A;  2KDL A;  2LHG A;  1GJS A;  2JWS A;  2VDB B;  1GAB A;  2FS1 A;  1TF0 B;  2J5Y A;  2MH8 A; 
#chains in the Genus database with same CATH topology
 1QUS A;  1GJT A;  1C7Y A;  3IG5 A;  2DAM A;  3KOX E;  3MK6 A;  4QNR A;  4W5W A;  3J7B A;  2UXC M;  4B7H A;  1QAO A;  5DYI A;  2CV2 A;  1SXJ E;  1J5E M;  1IN5 A;  4NC6 A;  2JP7 A;  3E9S A;  4AG6 A;  4FVM A;  1K3W A;  7CAT A;  2VF7 A;  1QQW A;  1GKI A;  2JY6 B;  3SAU A;  2HWJ A;  3U60 B;  3U6Q A;  1TH2 A;  2VQE M;  3AOE C;  3L2A A;  3VKG A;  1UM8 A;  3HHW A;  4M9S A;  1LTM A;  4M0D A;  2DWM A;  2VII A;  4JI2 M;  2RGO A;  1E94 E;  2ZAM A;  3TWK A;  1IBL M;  4JYA M;  1PJS A;  3VK7 A;  2DZL A;  1I94 M;  1PJQ A;  4GC5 A;  2HHH M;  2DAG A;  2QBY A;  1NY5 A;  4OX9 M;  2HAK A;  2D7E A;  3GRR A;  2K47 A;  1OKS A;  2CV0 A;  3TE6 A;  1OFI A;  1HQY E;  1PGY A;  2CV1 A;  3C9P A;  4XK8 F;  4MH0 E;  2KEB A;  1QAQ A;  2EUC A;  2LVA A;  3C58 A;  4LGM A;  4PDG A;  3HX3 A;  4L4U A;  2YNM D;  2D7G A;  3VKH A;  3SYL A;  3PFI A;  2WSE F;  3NBI A;  3VDU A;  4B3S M;  1BVS A;  3B7N A;  1N36 M;  3THG A;  3VFD A;  1IXS B;  3LMM A;  3E46 A;  1NHG C;  3FTC A;  3GRU A;  2UUC M;  2CWB A;  3GLG B;  3QWL A;  1MN3 A;  1PJJ A;  4BBA A;  1J09 A;  3GLH E;  3KDS E;  4AG5 A;  2V1U A;  4GKJ M;  1T3T A;  5KQ8 A;  3GLI A;  3UZU A;  2KRU A;  3W0L B;  4FWG A;  3GQ5 A;  2LWX A;  3U6D A;  4REZ A;  2HKJ A;  3JR5 A;  2FNA A;  1XC8 A;  4FCT A;  1R2Y A;  2G5G X;  1GL6 A;  2M5Z A;  4NOO B;  4R71 A;  4AKG A;  3RGP A;  3NBX X;  1DGB A;  4GEW A;  3UK6 A;  4IJE A;  5EXP A;  1PM5 A;  2JY8 A;  3HJQ A;  4LJA A;  4JI0 M;  4BLC A;  3UMM A;  3GLF E;  2L6O A;  1D0K A;  2CP8 A;  2DWZ B;  2W82 A;  2QZ4 A;  3F92 A;  3GRV A;  3KOZ E;  2V1C A;  4ANR A;  1Z5C A;  3LCV B;  2Z3X A;  2CHG A;  1QZM A;  3I04 M;  2Y20 A;  4B3R M;  3I01 M;  1DO2 A;  3TQS A;  3IG8 A;  2DAI A;  2XSZ D;  2XH9 A;  1P3Q Q;  2KA6 B;  3DA1 A;  2DAK A;  3J81 S;  3I4V A;  3FD9 A;  4TUW A;  3KVW A;  1PRB A;  2HL7 A;  2K0B X;  2R6F A;  1T6O A;  4JN6 A;  2QPA A;  2KDL A;  2JY5 A;  2QCU A;  3UJN A;  1K82 A;  2JA2 A;  2OO9 A;  1NV8 A;  2BWE A;  4XBO A;  5FTN A;  3WHL A;  1JB0 F;  5JI2 E;  1Q39 A;  3KOY E;  1DV0 A;  2R46 A;  3BOS A;  1XNR M;  4NRV A;  5IRE B;  3PVS A;  2GQF A;  1WGL A;  4LY6 A;  2DZN B;  1NO1 A;  1HQC A;  4DR7 M;  5EP4 A;  2L4F A;  2A5Y B;  2CEA A;  3E21 A;  3LQQ A;  1IBK M;  2F5S A;  1YSY A;  2N35 A;  1PJI A;  2EKF A;  3HU1 A;  2F5P A;  2KNZ A;  4DR1 M;  2Z8Y M;  3IEC A;  4DV0 M;  5ITX A;  2EKK A;  2ZTC A;  4IBK A;  3T38 A;  1W5T A;  3ZCB B;  2JWS A;  1KYI A;  1SXJ A;  4NL4 H;  3H4M A;  1L2B A;  3V76 A;  4FD2 A;  3AV0 A;  4FCW A;  1NVM A;  2ZBK B;  5JI3 E;  2DNA A;  3SAW A;  1IBM M;  4JI6 M;  1F4I A;  2F5O A;  2F4V M;  1MJG M;  2OOA A;  1HJP A;  3J80 S;  1QUT A;  4HL4 A;  1IY1 A;  1XXH B;  3JR4 A;  4CJ6 A;  3FUW A;  2XZU A;  4G4Q A;  2CRU A;  4G4N A;  1SXJ B;  2JNH A;  1G3I A;  1XNQ M;  1NNU C;  4B7G A;  4MGH A;  1ZMW A;  2L09 A;  1VQ1 A;  2Y0Q A;  2YQZ A;  5L8R F;  2RKO A;  5A2Q S;  2JZ1 A;  3A42 A;  1CUK A;  1Q02 A;  3Q8G A;  4OW0 A;  2ZM6 M;  3K1J A;  2DVW B;  2G3Q A;  4DV3 M;  1Q3C A;  1EIJ A;  3SMP A;  5C1B A;  1NV9 A;  3I4Y A;  1A5T A;  2LBC A;  5ITX E;  4KO8 A;  4F2L A;  5DFL A;  3A45 A;  3RE8 A;  2YR0 A;  4I8O A;  3FRH A;  3U6C A;  4X66 M;  3TPZ A;  3SFZ A;  4IBF A;  4DUY M;  4Z8X A;  1JR3 D;  4LF7 M;  5FSW A;  3FTE A;  3GPX A;  2FH0 A;  3KW6 A;  2KRK A;  4LFB M;  4RF1 A;  3EIE A;  1VDL A;  3I51 A;  4NRW A;  3NWL A;  5BPV A;  1HNZ M;  4K0K M;  3MHV C;  3IHP A;  5H37 D;  2BNK A;  2R45 A;  1EFU B;  3KSX A;  4L15 A;  4RNA A;  3BBZ A;  1X37 A;  2OQ4 A;  2QQ8 A;  1DGH A;  4DV2 M;  4JI3 M;  3SHF A;  2LVN C;  2CFO A;  2KZU A;  2E5L M;  2R0I A;  3GLH A;  2ERC A;  2M60 A;  3B7Z A;  4LF8 M;  4AW4 A;  4D81 A;  1N77 A;  4WW0 A;  1ORY B;  5KPR A;  4WP2 A;  2FOI C;  4YY3 M;  1TGU A;  3ILK A;  3EIH A;  2DI0 A;  1WJ7 A;  1TH3 A;  1GVN A;  2K6B A;  2LNH C;  3HJS A;  4IJF A;  4EIW A;  4DV7 M;  4WUR A;  2JXN A;  2J7O A;  3SMS A;  3KS4 A;  2QBY B;  1QAN A;  3U6L A;  1MU5 A;  5GKN A;  4I5S A;  4NXN M;  4DR6 M;  4L78 A;  2MJ5 B;  1N75 A;  3SHG B;  3A98 B;  4G3O A;  4OVZ A;  4X62 M;  3H4J A;  3GLF A;  4A3V B;  3L26 A;  4R3D A;  4AKH A;  3MJ5 A;  2FFJ A;  3SAS A;  2LH0 A;  1G4A E;  2LVQ D;  2MGW A;  4LF4 M;  4AI6 A;  3WHK A;  3HU2 A;  5EQT A;  2P5T A;  4M9X A;  1HT1 E;  1VEG A;  3SC3 A;  1TF0 B;  4PCZ A;  2DWL A;  3KS8 A;  1NHW C;  2I7P A;  4G4O A;  4QHT A;  2I7N A;  2OOB A;  4I4L A;  1JR3 E;  1T43 A;  2EJS A;  3B89 A;  1LV7 A;  2WSC F;  3HJ8 A;  4LRT A;  3J27 B;  5IZ7 D;  4IBI A;  3VDP A;  3D8L A;  2EA0 A;  4LRS A;  3GQ3 A;  4NSR A;  1XHB A;  2J5Y A;  4LJ4 A;  5BR8 M;  3GLI B;  2KNA A;  2DZO B;  2MRO B;  3LVW A;  4GHL A;  2QEN A;  2MR9 A;  4P17 A;  2R18 A;  4LJ8 A;  2C5R A;  2C96 A;  1L1T A;  1MX0 A;  3PNV A;  2KHH A;  3LVV A;  1L1Z A;  1R2Z A;  3HU3 A;  4PD2 A;  1G71 A;  4KLN A;  4CHT B;  1OFH A;  3AOG A;  2CHV A;  1GO5 A;  4FWH A;  1R7R A;  3RGS A;  3GLG E;  1R4G A;  2DKL A;  2KW0 A;  3C3E A;  4Z6Y A;  1V92 A;  4IBC A;  4DV6 M;  4QOZ C;  3AOE A;  1QDT A;  1TDH A;  5DYG A;  4Y28 F;  1XB2 B;  1ZAE A;  1I4W A;  2C9O A;  1FNN A;  1OQY A;  1WGN A;  1S3S A;  3DOA A;  3U5Z A;  1NY6 A;  1WXQ A;  3GPU A;  2O01 F;  4YHH M;  4IBE A;  3AL0 C;  4S12 A;  2EO2 A;  1HR0 M;  1IN6 A;  1VEK A;  1OAO C;  1QAM A;  1HT2 E;  1ZV1 A;  3B7Q A;  3SYK A;  1SG9 A;  4LJ9 A;  1QDR A;  1SXJ D;  2RRU A;  2C99 A;  2K9D A;  3DZD A;  3PNY A;  2DWN A;  1XMQ M;  1G41 A;  1OIP A;  1W5S A;  2O5R A;  3KFU G;  1IQP A;  5ITY A;  3HY5 A;  4NSO B;  3FTF A;  3CF6 E;  2L7I A;  4M9Z A;  4PT5 A;  1C1K A;  1TR8 A;  3B9P A;  3TWL A;  3K9P A;  3FKE A;  4QHS A;  3M0E A;  4GIT A;  3FUV A;  4UN2 B;  2UXD M;  3VLF B;  5KPZ A;  3U61 A;  2OPF A;  3L28 A;  1IFY A;  5FTL A;  2C9C A;  3FTD A;  3U6S A;  2APL A;  1VG5 A;  1R5L A;  3AFH A;  4JI1 M;  4CIS A;  4AKI A;  1L2C A;  2LHC A;  3MMP A;  4DV1 M;  2FE8 A;  1IY0 A;  4B08 A;  4B3T M;  3B74 A;  4HLQ A;  3HGI A;  3QYB A;  1ZQ9 A;  2VF8 A;  1Q3B A;  4KOD A;  1JQJ C;  3BXW A;  1AUA A;  5E26 A;  4AZF A;  3AKZ A;  2VQF M;  5IWA M;  8CAT A;  4G4R A;  2UUB M;  2JUJ A;  1R6B X;  2RGH A;  2H5X A;  4JXJ A;  4LF9 M;  1D2N A;  1KFV A;  2MH8 A;  4P16 A;  5ITR A;  4DBG B;  1HNX M;  2L4E A;  3KXE C;  3R9X B;  1GAB A;  2YFQ A;  3M6A A;  3VK8 A;  5EP3 A;  4LG2 A;  1WHC A;  2XLJ A;  4GRI A;  1IY2 A;  3W0F A;  1L8Q A;  4KT0 F;  5ITQ A;  3HWS A;  2R44 A;  3ZQJ A;  3U60 A;  2WSF F;  1XXH E;  3J2P B;  1NNJ A;  3DFZ A;  2QSF X;  2G8L A;  5FLX S;  1VDD A;  4DR3 M;  2QNJ A;  1J7K A;  4LJ7 A;  1NJF A;  3KSJ A;  4LJ6 A;  3U6P A;  1IN7 A;  3GQ4 A;  4LGY A;  1OJL A;  2KXE A;  4B7F A;  1UFZ A;  3T1H M;  1QVR A;  2VDB B;  2B3T A;  3W67 A;  1JR3 A;  1DGH B;  2Z4R A;  5IT9 S;  2X8A A;  1N33 M;  4DUZ M;  4LJ5 A;  2NQ8 C;  1OIZ A;  3SAT A;  3T1Y M;  5LMU M;  4Q7J A;  3GLH B;  5FTK A;  1ZMV A;  1DGF A;  3FRI A;  4II7 A;  4QOS A;  1K3X A;  2L2D A;  4GMQ A;  2CUZ A;  3LW5 F;  5EP1 A;  1D0M A;  1E32 A;  4B3M M;  4LFC M;  2XFT A;  2DAE A;  4IBG A;  5KPT A;  1G8P A;  3U6O A;  1DO0 A;  5EP2 A;  3Q8X A;  1IXZ A;  1SXJ C;  4DR5 M;  2QP9 X;  4RF0 A;  3QYE A;  2ZAO A;  4DR2 M;  2LVO C;  4ITQ A;  3ZC7 B;  4XGI A;  2O25 A;  5ITT A;  2LTU A;  4OVZ B;  5EXT A;  5C18 A;  3GLF B;  1IXS A;  1IN4 A;  1TH4 A;  2JZ0 A;  4BB9 A;  2Y0T A;  1Z59 A;  3M7G A;  3W68 A;  4AQY M;  1N34 M;  2R4E A;  4LCB A;  1WIV A;  3KP0 E;  4LFA M;  1IM2 A;  4FW9 A;  3GLG A;  5FTJ A;  4X65 M;  3CGW A;  2D7H A;  4IBJ A;  2CHQ A;  5KQD A;  3ZH9 B;  4KHP M;  2BJV A;  3FYD A;  3RFW A;  3KOW E;  3HHY A;  2LVP C;  2R65 A;  1AIP C;  3LCU A;  4MGI E;  3R8F A;  3K9O A;  3UGJ A;  4DV5 M;  3FYC A;  1Y8G A;  4DV4 M;  2H1R A;  4X64 M;  2DXI A;  1NSF A;  1V33 A;  3FUX A;  1RU3 A;  3TWM A;  1EE8 A;  2F5N A;  1N78 A;  3KP1 E;  3C3D A;  3J7A S;  1ZMU A;  3HHX A;  3K2L A;  1TDZ A;  2FS1 A;  1NJG A;  3CF2 A;  3T15 A;  2XGN A;  3JAM S;  3OTO M;  3PXG A;  3FUT A;  1TTE A;  4JV5 M;  2XEP A;  4I81 A;  1E9S A;  2X49 A;  3HHZ A;  4JI4 M;  3GRY A;  2BJW A;  4MB7 A;  4L16 A;  4DR4 M;  2C98 A;  4GC9 A;  1N32 M;  4F1I A;  2J7N A;  2Z7J A;  2HCB A;  2AHM A;  3CF0 A;  1IXR C;  2X4A A;  3L29 A;  4GH9 A;  5E6J A;  1V34 A;  2XZF A;  1QZE A;  4L6V 6;  4HEO A;  3GO8 A;  4M0W A;  4NXM M;  1WR1 B;  4JI8 M;  3L25 A;  3HZJ A;  4IBB A;  2V6Z M;  3SAR A;  4ZPX A;  3FUU A;  5EXS A;  1HNW M;  1G59 A;  3D8B A;  3FE3 A;  4LZJ A;  4QNM A;  4FCV A;  2LHG A;  2XSZ A;  4MM3 B;  4GHA A;  1YLA A;  3K92 A;  3SBJ A;  5FTM A;  4D80 A;  4R7G A;  2F5Q A;  2CE7 A;  5F3W A;  3GPP A;  1Z6T A;  4LF6 M;  2BWB A;  2L7H A;  1KSF X;  4OU7 A;  3GLI E;  2R62 A;  4LF5 M;  1DGG A;  2KZS A;  1OTR A;  3U5Z B;  4IIW A;  2LXE A;  3GPY A;  3A46 A;  2Q2E B;  1H6U A;  4GKK M;  3TL4 X;  2UUA M;  3L27 A;  4JI7 M;  1Z5B A;  2GNO A;  4LZZ A;  2DEN A;  5EJC A;  2DHY A;  2UU9 M;  1IN8 A;  1YE9 A;  2XF3 A;  4CGY B;  5LMN M;  1L2D A;  2ZAN A;  5DNY A;  5EXX A;  2DHR A;  2R4J A;  4IBD A;  1XXH A;  2Y21 A;  4D82 A;  1D0L A;  2JY7 A;  4L8R C;  2QHO B;  5KO3 A;  4FWD A;  4GIP A;  3SAV A;  1Z5A A;  3U61 B;  4MGZ E;  4G6Z A;  4RKU F;  1VEJ A;  1XMO M;  3U6M A;  3U6E A;  2UXB M;  1QYR A;  1PJT A;  2WZJ A;  4MGY E;  1E9R A;  1OAI A;  3LQR A;  3AJI B;  4CIZ A;  1GLN A;  3E4R A;  3GP1 A;  2ZTD A;  4MGK E;  5ITU A;  1GJS A;  1XWI A;  2KNV A;  3HKP A;  4PDI A;  1YUB A;  3CTW B;  3K8Z A;  2XFS A;  1FJG M;  3T6P A;  1GL7 A;  4JI5 M;  3QAU A;  2Z4S A; 
#chains in the Genus database with same CATH homology
 1PRB A;  1GJT A;  2LHC A;  2N35 A;  2KDL A;  2LHG A;  1GJS A;  2JWS A;  2VDB B;  1GAB A;  2FS1 A;  1TF0 B;  2J5Y A;  2MH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...