2KDMA

Nmr structures of ga95 and gb95, two designed proteins with 95% sequence identity but different folds and functions
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From the Cover: A minimal sequence code for switching protein structure and function.
pubmed doi rcsb
molecule tags Igg binding protein
molecule keywords DESIGNED PROTEIN
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kdmA00
1KH0A 3FILA 1Q10A 1MI0A 1XCQL 2PW9A 1P7EA 2ZW0A 1HZ5A 2NMQA 4KGSA 1ZXHA 1PGBA 1FCCC 1XCTL 2J52A 1IBXA 1IGCA 2JZPA 2KN4A 3GB1A 4KGRA 5BMIA 4OZAA 2PTLA 1GB1A 1QKZA 1MHHE 4WH4A 1PGAA 3FILB 4KGTA 1FCLA 4D2KA 2IGHA 2GI9A 2OEDA 2KACA 1IGDA 4MACA 1XF5L 1YNTE 1K52A 3UI3A 1EM7A 1HZ6A 4HKZE 1MVKA 2ONQA 1F2RC 1MPEA 2RMMA 2GB1A 5BMHA 1YMHE 1UWXA 4GLSC 1D4BA 4OZBA 2ON8A 5BMGA 2JWUA 5JXVA 2N9LA 4HJGE 5HFYA 2KDMA 1IBXB 2I2YA 2K0PA 1F2RI 2RPVA 2ZW1A 2PLPA 2N9KA 1GB4A 3MP9A 2N7JA 5HI1A 1C9FA 4OZCA 2LGIA 2IGDA 1FD6A 2QSDA 2JXTA 3V3XA 2IGGA 2KWDA 1JMLA 1K53A 5HG2A 2JU6X 1K50A 1PGXA 2EELA 2I38A 4IOIE 1P7FA 1HEZE 1K51A 2KQ4X 2QMTA 5HHDG 2LHEA 2LUMA 4IKGA 2LHDA 2J53A 2JSVX 1MHXA
chains in the Genus database with same CATH superfamily
1MG8A 4HWIB 3AEFB 2C7HA 1EO6A 2KTFA 4ZOHC 2NMQA 2V3PA 4W9CA 3MC0B 3SD5A 4ARCA 1WRDB 3V61A 3ZXVA 1V6EA 4P6VF 2A4ZA 5LNK1 1UBQA 2BW2A 3MHSD 2IPKD 1E7UA 4PS3A 4EE2A 2G3QB 1LGRA 4KIKA 1KF6B 4EZLA 2FNJB 2K8HA 4FULA 4AP4C 2ZCCA 1CZPA 2C9WB 1XD3B 3MJWA 4MACA 4FA6A 4EOYA 3BVGA 4WWNA 5T8IA 1BXTA 2JT4B 4HCPB 5EE1A 3QCAA 3LXFA 2WXFA 4HPLB 1SIFA 1L6VA 1GC6A 3L4PA 3HRDD 4F8CB 2KTRB 2KFJA 1QF6A 1JWBD 1ZUD2 2V3NA 3MHZA 2EKIA 3IBEA 2WU2B 3DPDA 3PRZA 4JL9A 1FD6A 3PSEB 1V1OA 3H7PB 2RDHA 3EC8A 3KVFB 3VRAB 1SE3A 1FMAD 3ZGZA 4DHZB 1AWDA 1J7CA 2E3TA 1PGXA 3ML9A 3WANA 4HCNB 2BQQA 1WXAA 1L2NA 2KQ4X 3DWMA 2BGFA 4LNOA 1TY0A 4KZ0A 1SBBB 4B95A 3AECB 2CU1A 4RFBA 3Q3OC 4PYUA 1KOTA 4W9EA 3RN9C 3TIXA 4DHZE 3RNFC 1N5XA 4II3B 3VFKA 3PPAA 2C60A 5JZEB 4FHJA 1IGCA 4FHKA 4RGOS 1R4NI 1V5TA 2KMMA 4GXBA 4XYCA 1L0XB 1E6EB 5FR3A 1FXAA 3Q3JA 2J0KA 2LASA 1SGHA 3RD2A 1ZDVA 2M8SA 1IGDA 2WXGA 1K52A 5JHAA 3M3JA 3AV8A 5D94A 4RGMA 2QEJC 1MPEA 3EFUA 5G2NA 3KLSX 3RUIB 2NR2A 2BPSA 1QOFA 2UU7A 2MBEA 1OTRB 1L5PA 5DPWA 4G0NB 2A5UA 1WR6E 4EKUA 2PE6B 4EEWA 4MEMA 4HJGE 5HFYA 3C8YA 3RNGC 3TEWA 2NCNA 1T3QA 1V1PA 2Y5PA 3KUDB 3MC9A 2KQ7A 2KXJA 3FAHA 2Y5CA 1TZ1A 2INPE 1PFDA 3U30A 3L08A 1GOZA 2BWES 2WXRA 1QLBB 1HXYD 2KWDA 2L32A 1TKEA 1EWYC 2QJLA 4JQWC 2W55A 2KQSA 2KX0A 2N0SB 1T0QC 4KSLC 3FKYA 1J8CA 3X23A 2KFKA 1J19A 3DVNV 2MP2B 1STEA 3UINB 4IKGA 2LHDA 3P4RB 3W1YA 2IYDB 3AE6B 4F7ZA 1PDXA 2BKRB 2WYQA 1TYGB 4TSSA 3L17A 3VQIA 2GBNA 2IJ0A 3AN1A 1OQQA 2MRPA 4BFRA 4C4VB 3KYCD 3JW0X 4RF1A 3RPFC 5CHVC 2Z59B 2DAJA 1BT0A 1E8WA 3A1QB 3NHEB 2G1EA 3V6CB 2AYOB 4GDKA 2ZZPB 2KNBA 3WCQA 4BBNF 2DYOA 3ZW3A 2ASQA 4NJ7A 4US8A 3KW5B 1TT5B 5LLIA 4NPNA 3P4PB 5D7GA 4NJ6A 1WGRA 4LK0M 2D3AA 4NAWB 1HTQA 2CS4A 2XBBC 1D6EC 3IFWB 1TBEA 2FE8A 4DWFA 3UQBA 5JXVA 3VH4B 3RNBC 2PVOD 3JSVA 2D3CA 3DOWA 4PS8A 2ACZB 1N5WA 3HHMA 5I4DA 1WJ4A 4K7SA 4BKTA 2K9XA 4EZKA 1WR1A 1IUEA 5G5HA 3TEXA 3V3XA 2VRRB 2OJRA 3L16A 1CMXB 2C5LC 2H88B 1JRUA 1ZP0B 3EGRA 4JLCA 3W5VB 2V3SA 2INDC 5G5GA 5DPTA 3SEBA 2YLMA 2HJ8A 2ZVNA 4JWUC 1KH0A 1VZ7A 1XT9B 3ZDMC 4OVUA 1FNWA 1JWAD 4RMAA 4BKSA 1VDVA 3BK1A 4XX5A 4WAAA 3AEAB 4ANWA 2MW5A 4HVBA 5L83A 3B0AA 2BF8B 1C79A 4KGRA 2BYTA 4FJVB 2OHFA 3W1SC 2I1KA 5KHOA 4DHJD 4NY0A 1PGAA 4IM0A 3UQAA 4XGAB 1C4AA 2IGHA 1T0SC 2JUOA 2YEPF 3M63B 2ONQA 1V1PB 1B1ZA 1NYQA 1ZKHA 1E0ZA 4NQLB 1V5OA 1R7SA 2R61A 2WXPA 2HE7A 3WAOA 3BIID 4ZRIA 2KDMA 2I2YA 1F77A 3DDCB 3QARA 2X8XX 4OW0A 3P1MA 2J4XA 3PZDA 1YX5B 1C9FA 1NEKB 2LGIA 4ZRKA 4N9F4 1NI3A 4YTPB 3TUOA 3DWGC 1GPXA 2N4FA 3TMPB 3DQVA 1E7VA 4EFOA 4L1BA 2NPTB 4XWWA 4WJNA 3VXWA 2AEHA 2M0AA 2JY6A 3IT4B 3QX1A 1DOYA 4TQ0A 2REXA 1P7FA 3ALBA 1I4XA 3AI5A 4N59A 1I42A 3IAS1 4WAFA 4KKIA 5IKCM 3IAM1 1TS4A 3DHGC 2RDBC 1XEEA 3VTWA 4ZRJA 2LGXA 2J52A 1IBXA 3D32A 3V60A 2LEKA 2KN4A 1V81A 4OVZA 1BMLC 3CIRB 3HM6X 4TMAB 2KC2A 4OZAA 1TS2A 4ICVA 3V6EB 1C77A 2PIAA 3GE8C 2CHZA 4ZDVA 1M4VA 1RFAA 2KO3A 4A90A 5AEKB 2PJHA 2GI9A 2RR9A 4C56C 4B9KA 3GP7A 1WXVA 4ZHOA 1XLPA 3O13A 1YJ1A 1IP9A 1SF0A 2KLGA 2R2OA 3WIMA 2ZEQA 1N62A 4YT0B 3ZRCA 2HTME 1N6ZA 1ZDXA 1YIWA 2FCQA 4G3XB 2O6VA 1N60A 2K0PA 2M56B 1ZE3D 3UIPB 1YN5A 1D5MC 3UIOB 3R7QA 1HQRD 5HI1A 4OZCA 3CF6E 2RGFA 3PHWB 5GMVA 2GBJA 4XC2A 3W9CB 2O2VB 3FC4A 1Q5WB 2QSDA 1WRIA 2PMVA 3A4SC 3T3OA 2WXHA 4H2AA 3HIZA 4JX1C 4DXGA 2DLBA 2D2QA 3ZO5B 2QMTA 2MEKA 2WWZA 3L10B 5H8YE 3W2DA 4DHJB 3ZNID 4LLGM 2LGDA 1UGJA 1G6JA 3PZ7A 2KVRA 4KZCA 4IC7B 4PS7A 4HJKA 3QC8B 2KFKB 2L00B 3AE7B 5IAAC 3PZ8A 1FCCC 3NZUA 2J0JA 1A5RA 4HRSA 4YTNB 2UYZB 1KM7A 3E9SA 3PVLA 2IZVB 3RYTA 1SE2A 2PTLA 3L54A 4DQOC 3KUCB 2MWSB 4MGKE 1FXTB 2N1WA 4D2KA 4I6NB 2CHXA 2L83A 4Q2JA 1N63A 3OJ4B 3S2AA 1AW7A 1WE7A 2WS3B 3DHIC 3RMKC 2XK5A 3VTVA 3IXSA 2MBHA 3DBHI 1UWXA 2WXOA 1DYQA 3CMMB 4RM8A 2MX2A 2PE9A 2JF5A 2VH1A 1E10A 4YL8A 4XDDA 4DDID 4HK2A 2RPQA 2IO1B 4IWPA 4MSQB 2WDTB 3AU4A 3DBLB 3VH3B 2SEBD 4A3PA 1NBFC 4A9AA 4XDCA 4E74A 3AEEB 2NPTA 3HK0A 2JZ3B 1HTOA 2KDEB 1WZ3A 3WAPA 1GJZA 1P0RA 2BBCA 2JX5A 2MCNB 2I38A 4QAYA 1J0GA 4C00A 1HEZE 3P4SB 1WE6A 5HHDG 5CX3A 4KVGB 5IA7A 4ICUA 2BYFA 4ITKA 4YXDB 3U8ZA 3HVDA 4IM2A 5DCNA 1J7BA 3EA6A 1JCKB 2ZW0A 1S1QB 1LM8B 2KN5A 1ZXHA 1XCTL 1EF1A 1UBIA 2ZVOA 5LXHA 5E6PA 5HKHA 1WJUA 4IWQA 5BYSA 3KQ4A 1GAQB 4MGIE 4LJPB 2EMTA 4RH6A 3MJ5A 1HA5A 4K3BA 5CHFA 4IM3A 2JYTA 4WWMA 1VLBA 4J3OD 2RSUA 4GU2A 2TSSA 1WXMA 3PTFC 1K8RB 1HZ6A 3U7ZA 4HKZE 3N1XC 1T0YA 1L6UA 1VZ6A 4MT5A 5KHQA 1ZW7A 4I6PA 1UWMA 2WXJA 2V0GA 3A33B 2CJNA 4WURA 4ZRPA 4IWOA 5EE3A 3AE8B 2BYVE 4NAWA 1UH6A 2Y3AA 1PYWD 4W9KA 3KH0A 3KWLA 2BVCA 2N9KA 2KX3A 1TZOA 1GB4A 1YD8U 3N3KB 1ZOYB 3OLMD 4E3CA 2G9HD 3NUHB 3GE3C 1WGHA 4BKSD 1EU4A 2JXTA 4YWGG 3QK0A 2IGGA 1YQBA 3RULA 1XO3A 3RZFA 4C4VA 4J6IA 1N61A 2KJ6A 3VR8B 1EU3A 2IO0B 5CTRC 4RGNA 3X0WA 2BT6A 4IOIE 3ZTCA 1QILA 3A1QA 2JZZA 3WAMA 2WX0A 2LMCA 3ZYYX 1I35A 2JYEA 2O6VD 3ETRA 1I4HA 1Q10A 1WGGA 1C4PA 1WJ6A 2AL3A 4L2YA 4C7YA 4B6WA 1ET9A 2K39A 2JRIB 4NZLB 3RFZB 1L7YA 3PLUA 1NI2A 3GB1A 2LRWA 4BVUC 2NS5A 2LVQA 2BTEA 2GMIC 4GB9A 2Y5BB 3ZXRA 3UI3A 4AOFA 4A20A 2JPHA 1M94A 2IBIB 4N58A 1MVKA 3MFGA 3NG0A 1WH3A 2RMMA 3AE5B 4W9LA 2KAJA 3L13A 3AXCA 2KJHB 4OZBA 2QDFA 4W9JA 2LRUA 3NRZA 5E6NA 4EUTA 2M19A 1TKGA 1WIAA 5J2RA 2FUG1 1E8ZA 2ZW1A 4K7UA 5AUIA 2ZCBA 4K3CA 1F9JA 2FCSA 3CWIA 3ZDTA 4I6LB 1JW9D 2O6VB 3ZJTA 1UELA 4LJOB 3PS6A 4YTMB 1U4AA 5BYRA 4P16A 4HLEA 2XEWA 1XLNA 4AS1A 4REZA 3RCZA 3BZDB 4M01A 2L05A 4GMVA 3VAWA 1L4ZB 1GG3A 2FIFA 2KK8A 2M4NA 1FEHA 1NENB 4EZJA 4DDGD 3ML8A 2WDRB 1WM2A 1EWCA 1VD2A 2L76A 2LHEA 2Z8LA 3TCAA 1C76A 2GOWA 2ICIA 4WJOA 3GOEA 4LCDE 1FPYA 2PW9A 3H1UA 2FAZA 4S0RA 1UGMA 1YJIA 2HJ1A 3NZ3A 2KT7A 2LD9A 2KDBA 1PGBA 3Q8CA 1EF5A 3Q3NC 2VH2A 4XWTA 1XLQA 1VR9A 1H8CA 2D10A 1YQ3B 1NYRA 2I1JA 1RRBA 5JHBA 4YSXB 4W9GA 3TSSA 1PUTA 3QWZB 1E7PB 2KTRA 4WIPA 3KWVA 2CJOA 4MH0E 2X38A 5BMGA 2JWUA 2MJEA 2CU3A 1IBXB 1WWTA 1X1MA 2PLPA 1VZ8A 2LVPA 2BS3B 3PV1A 1VCBA 4DK5A 1P1AA 2K25A 1Z5SB 1WYGA 4RGTA 3BK2A 4RM9A 3AU5A 3Q3FA 4HROA 5BO4B 3Q3MC 1CQVA 2MJDA 2GRIA 3ZTDA 2NBVB 4M8MA 1D5ZC 4UDUC 1TTNA 1UNSA 2M17A 2EMSA 3ABVB 3I5JC 2G45B 3JVZX 1FM0D 1P3QU 3P4QB 3ZIMA 1MG4A 4FBJB 1ET6A 3EECA 4KV2A 4FLHA 2XN9C 1P9DU 4W9DA 1RM6C 1E9MA 2B76B 1SB3C 2J53A 2MLBA 2LXCA 1FFVA 1B9RA 4NJCA 3Q8AA 3LDZE 1WXSA 1HZ5A 3P42A 5J17A 3OJ3A 4KKJA 2DZKA 1DOXA 3LYYA 5AZFA 1TY2A 2W82A 1KJTA 1FIQA 2J7QB 2QC8A 4CQNA 5BMIA 2WXIA 1RAXA 2D3BA 2WHIA 2XNAC 1GB1A 5MPOA 2Z0EB 4MGZE 2LGYA 3QHTA 1OQYA 3AEBB 4MDKE 4TQ1A 4YSYB 4OHJA 4CYEA 2MJ3A 1V97A 2KD0A 4ZRQA 3OAWA 5C2TB 1YNTE 4PYZA 3RNAC 2N7DA 3ZQ4A 4M0WB 4IG7B 4K1RB 4WWPA 2DAFA 3DBSA 4YSZB 1KRHA 1QOGA 4GLSC 1D4BA 3DBRI 3C19A 1I4GA 3APCA 3C0RB 2CR5A 4MELA 3B9JA 1OFFA 1Z2MA 2L7RA 2W54A 1NDDA 2O2VA 4MM3B 3VUYA 1XXGA 2WNMA 3Q8EA 4IW0A 3TBLD 2B3AA 4K81A 1SE9A 2ZNVC 3M62B 1BUIC 1ENFA 2KKCA 4GOCA 1GC7A 2PKOA 3NS8A 1C1YB 1OGWA 3EHVA 5D2MB 2PPHA 2QILA 5DPRA 4GN1A 3ZUNA 3VUWA 4E71A 2BWFA 3Q8FA 2JXXA 1FXIA 3A9KA 1K53A 2IO3B 2JU6X 3DBRB 3ZNHB 1XQQA 3LB8C 5IP4D 2VZKB 2K3UA 2MBBB 1TS5A 1WF9A 3VRBB 4F1SA 2WDQB 4ANXA 1WZ0A 2D5GA 2L0FA 1KLGD 1WM3A 1P7EA 2M0XA 4US9A 3M95A 4KGSA 2SAKA 2HD5B 2LGSA 3MTNB 2DHZA 1WFYA 1LXDA 3PGEA 4ANVA 4NNJB 2G4SA 1HE8A 3IHPC 3RNEC 1OQRA 2D11A 4RF0A 5FKAC 3SDLC 1AYFA 3VVWB 2XK5B 2KVZA 2MBQA 4DXAB 2DYMA 4KX6B 3SR6A 5FK9C 1JWSD 1YN4A 1L0VB 2INCC 1T5XD 2V9HA 4BZAA 3AH7A 5TSSA 2N9PC 4FJYA 2DNFA 2KDFB 1MFWA 3ENEA 1S3SG 4LNIA 4BOSC 2RD0A 4KSKC 1WI0A 2KWUB 3GZNB 4LDTB 3BWUD 3JYUA 4II2B 5L95C 2WXQA 5J18A 1IPGA 2FCMA 2MBOA 4OVVA 4A6QA 3R2TA 1ESFA 2ZNVB 3I63C 2QCZA 3AMZA 1YN3A 5EE0A 2W9NA 2D07B 2MP2A 2ZPNA 4JIOU 5IO9A 3ZJVA 3CSFA 4ZYSA 3Q69A 1RYJA 2FUHB 1DOIA 1I7HA 2KHWB 4IUMB 3R66C 1K51A 3IG3A 3Q14C 4GDKB 1Q0WB 5E6OA 2Q5WD 3T9LA 1V80A 1MHXA 2N7EA 2WLBA 1XCQL 4BOZB 4FADA 2J42A 3PRMB 3Q6BA 3QJZA 3A9KB 1QQRA 2MA9B 4HEA1 2INNE 3AE2B 2J0MA 1Y56A 1WGYA 2WDVB 2E6XA 4BAXA 3R3MA 1RWSA 1ZXIA 2DZJA 4A3OA 2N9XA 4JE3B 2WQYB 1ZGUB 3GS2A 2NBWB 4WQOB 3LJ3A 3AB5A 1WY8A 1EM7A 1LQBA 2AQ2B 2JWZA 1VJKA 1JRPA 5BMHA 1KLUD 3DVGY 1QOAA 3AEGB 3BVZA 1V86A 3TL5A 1ZPSA 3DHHC 2FIDA 1JALA 2QHOA 2N9LA 1Q1OA 2PEAA 3VHTC 3T3NA 3NOBA 4O1NA 4LNKA 1WX9A 3TJPA 1H4RA 4TUUA 1SEBD 2YVCA 2L1AA 3PRPB 1AARA 1JQ4A 2WXNA 3JSVB 3PT2B 1R4MB 3NJTA 2MHJA 3O65B 3IT6B 2KLCA 1GUAB 1TJEA 1KFYB 2HTHA 3N1ZC 4KIKB 4G11A 4WJPA 3BYYB 3H7SA 4M00A 4ACFA 4AJWA 2DBYA 5CHWA 3H7PA 3NVZA 5AUKA 5G55A 2LI5A 1QZEA 1UUPA 3N9YC 1TS3A 1E5WA 2ZJDA 3BYTB 2FCNA 1UZXB 3N30A 2JVCA 5JH5C 2M1MA 3ZLZA 5IOIA 2L8JA 1SJHD 3ECIA 1E90A 2EKEC 1YX6B 2DX5B 4X57B 4AUQC 2KYWA 3PO0A 1V2YA 4A55A 2LFIA 3L0WB 1C4CA 1A70A 1QKZA 3P63A 3OG5A 3EFCA 2KWCA 3R8BA 3URYA 4KGTA 3DVGX 4HKQA 3CSTA 4RCOA 2BYEA 3DVNU 2L52A 4HPMB 3NY5A 2V4LA 1F2RC 3GZNI 3QQ8B 4M02A 1WJNA 1I4QA 2W3SA 2KOXA 1D3ZA 4ASWC 1WSPA 1OEYJ 2LJ5A 2ON8A 4ZHPA 1I4PA 3H8HA 3NVYA 5C23A 5LXIB 3I9V1 1T6BX 1ISNA 3RZWC 2GBRA 3Q2AC 4HDQA 5IN7A 3U7DA 3H6NA 1RLFA 2MH7A 4DXFA 3MP9A 4JPSA 2G4DB 2N7JA 5AZHA 2JRHA 1LFDA 2KZRA 3PREA 4FXCA 2Z0DB 3UF8A 4HXDA 3MC8A 1E8XA 3SHQA 4P1CC 4ZYNA 1FO4A 4KDIC 3ZNGC 1WX8A 3APFA 3VR9B 4GGQA 5EE9A 2L3ZA 2H89B 1FRRA 2DZIA 2BS2B 1R4NB 2KDIA 2DWQA 5AZGA 1YJJA 2KMAA 4WWOA 1WYWB 3A9JA 2MQJA 1JWMD 2AL6A 1FRDA 1L0YB 3HUIA 4FJZA 2K8CA 3B2FA 3BY4B 1JWUD 3ZRFA 1T0RC 2JZPA 3RT3B 3AE1B 1TKYA 3NVVA 3BINA 2KC1A 1UF0A 1MHHE 3DBHB 2C7MB 3VUXA 3HM3A 1KTKA 3N20C 2W3RA 1FCLA 3TEYA 4GSWA 1IYFA 4MM3A 1XF5L 3VTUA 1WMHB 2DENB 3AULA 1I4RA 2AQ3B 2LWPA 4P1BC 1P98A 1WGKA 2K6DB 3DBLI 4XE0A 3EUB2 2GBKA 1WXQA 1CK1A 3I57A 3K9PB 2DYBA 2WXMA 3KUZA 3J9CA 1F1HA 2V4IB 3V62A 4TKNA 2RPVA 1R4MI 4MJSA 4JWSC 2KMCA 2WXKA 3PLVA 4CHKA 1DGJA 4G50A 2HDEA 3B08A 3R2IA 2LJIA 2OJWA 3W5UB 4TV3A 1KLVA 4NQKE 2WX1A 4MH8A 4W9FA 2BKFA 2L0TA 2D3GA 2IY1B 3H9DA 5EDSA 4PK1A 2ZPYA 4W9IA 4HPPA 4C80A 1GNUA 4AQ7A 4WJQA 3ZKJC 2LXAA 2WGSA 3U52E 2NBUA 3AE4B 2IY0B 2JQRB 2UWQA 2JSVX 1YQ4B 5TR5A 2BS4B 4B0MA 2OOBB 1Y8RC 1SSNA 4GDLB 4LDTD 3NVWA 1MI0A 2CHWA 5D3IB 4URKA 1D5XC 3I3TB 2AX5A 4USAA 2LUEA 2FBWB 1RFKA 3AEDB 1QT9A 4DBGA 2VZKD 4BBNC 1ROEA 4JGHB 4MGYE 4C7ZA 2K6QA 3VDZA 5GXGB 3A4RA 1WGDA 1EUVB 4AJYB 1V49A 3ZVVA 1V9JA 2RDGA 2KACA 1F0ZA 2AQ1B 3AM9A 3SU8X 2IO2B 4GIVA 2GB1A 3KYDD 3NZSA 3ZJUA 1SIJA 3W1SA 3WA0A 2LZ6A 2WU5B 5DPSA 3PHXB 1F2RI 3U2SC 3K9OB 1E8YA 3QAQA 2BB6A 5D3DA 2DZMA 1FFUA 2KWVB 4M0WA 3AE3B 2IGDA 4W9HA 3RNCC 2LVOA 4M8NA 3V05A 3IVFA 1JMLA 3DCGA 5HG2A 4LTUA 3BVMA 4FN2A 4MSMB 2K22A 4HDOA 1YOVB 2GBMA 4R3DA 1F52A 5BYQA 4L23A 4MJSB 2LUMA 1C78A 2GLSA 3QIJA 4ANUA 4CO7A 4LNNA 3FILA 3AE9B 1QOBA 4A8XC 2KANA 1WX7A 4PT5A 1ACCA 2YEPB 1OEYA 3QA8A 4GDLA 1XLOA 4KDLB 3R7RA 3TEZA 3ONSA 2R2QA 3UGBB 4RNAA 2WXLA 3N32A 3U4EG 4WH4A 1JROA 3FILB 3A9JB 1L4DB 1SJED 4P7IA 1CJEA 4S17A 1SE4A 4BKGA 2IDYA 2OEDA 3B2GA 4NAMA 4LNFA 1FNVA 2QIEB 1YMHE 1MJDA 3APDA 5E6JA 1TGZB 5C3JB 3P2BA 3RI7C 3OWEB 5D6JB 5C1ZA 2C7NB 2K1FA 2PVGC 5FR6A 3WALA 1C3TA 4B0EA 2NVUI 2MSED 2NTTA 2K5PA 3T8MA 2N1VA 3E56A 3NS1A 3SFDB 1UD7A 2AWTA 2N9EB 2NTSA 1J7AA 2BB5A 4N6EB 2CKHB 2V1YA 5H92C 1V8CA 3Q8BA 1WMHA 4IDIA 1LO5D 3ZNZB 1FNUA 1PQSA 2K8BA 1K50A 1AN8A 1VRAB 4AWJA 3SFEB 2EELA 4WQMA 1TIFA 3N1YC 2KJRA 3HVZA 4K7WA 2WP9B 3B1LX 1SXTA 4XZ4A 4ARIA 1NVID
chains in the Genus database with same CATH topology
2ICIA 1UUPA 4KKIA 3AEFB 3N9YC 3IAM1 1TS3A 1TS4A 3BYTB 2PW9A 1YJIA 4ZOHC 2NMQA 2V3PA 1XEEA 3NZ3A 1PGBA 1SJHD 3Q8CA 3MC0B 2J52A 1IBXA 4XWTA 1XLQA 2LEKA 4ARCA 2KN4A 4OVZA 4P6VF 1VR9A 5LNK1 1BMLC 3CIRB 4TMAB 2BW2A 2IPKD 4OZAA 1TS2A 3PO0A 4EE2A 4A55A 2LFIA 1C4CA 1A70A 1C77A 1YQ3B 1QKZA 1NYRA 3P63A 2PIAA 1KF6B 3R8BA 3URYA 1M4VA 4YSXB 4KGTA 3TSSA 4A90A 4HKQA 1PUTA 2GI9A 1CZPA 4RCOA 4MACA 4C56C 1E7PB 3GP7A 4ZHOA 1XLPA 2L52A 3O13A 1F2RC 1SF0A 4WIPA 1N62A 3BVGA 4YT0B 3KWVA 1I4QA 2HTME 2CJOA 2W3SA 5T8IA 1BXTA 1WSPA 2X38A 1ZDXA 2ON8A 4ZHPA 1I4PA 5BMGA 3H8HA 3NVYA 2JWUA 5EE1A 3I9V1 1T6BX 2MJEA 2CU3A 1N60A 3LXFA 1IBXB 1WWTA 2WXFA 2K0PA 2M56B 1ZE3D 2PLPA 1VZ8A 1YN5A 2BS3B 1D5MC 1L6VA 3L4PA 2MH7A 1WYGA 4DXFA 3MP9A 1HQRD 4JPSA 4RGTA 2N7JA 3BK2A 3HRDD 5HI1A 4OZCA 1QF6A 1JWBD 4HROA 1ZUD2 1CQVA 2MJDA 2GRIA 3W9CB 2V3NA 3MHZA 2EKIA 3FC4A 4FXCA 1D5ZC 1UNSA 4UDUC 2WU2B 1FD6A 2QSDA 1WRIA 3ABVB 1V1OA 2PMVA 2RDHA 3T3OA 1FO4A 2WXHA 1FM0D 3VRAB 1SE3A 4H2AA 3P4QB 1FMAD 3VR9B 3ZGZA 4JX1C 1ET6A 1AWDA 4DXGA 2DLBA 1J7CA 2E3TA 1PGXA 2XN9C 5EE9A 1RM6C 1E9MA 2KQ4X 2QMTA 3DWMA 2MEKA 2H89B 1FRRA 5H8YE 2B76B 1SB3C 3W2DA 1TY0A 1SBBB 2J53A 2BS2B 4LLGM 3AECB 1FFVA 2DWQA 4RFBA 1UGJA 1B9RA 1YJJA 3PZ7A 4NJCA 1N5XA 1JWMD 3Q8AA 3AE7B 1HZ5A 1FRDA 3P42A 1L0YB 3HUIA 3B2FA 3PZ8A 1FCCC 1JWUD 4KKJA 1DOXA 1IGCA 3LYYA 2JZPA 4RGOS 1TY2A 4HRSA 4YTNB 2W82A 1FIQA 3E9SA 3AE1B 4CQNA 2KMMA 1TKYA 3NVVA 5BMIA 2WXIA 1L0XB 1E6EB 1SE2A 2PTLA 1FXAA 2XNAC 4DQOC 5FR3A 5MPOA 1GB1A 1MHHE 3AEBB 1KTKA 4TQ1A 4YSYB 2W3RA 4OHJA 1FCLA 1ZDVA 4D2KA 2MJ3A 3TEYA 2L83A 1V97A 1IGDA 4Q2JA 1N63A 1XF5L 4ZRQA 5C2TB 1YNTE 2WXGA 1K52A 1AW7A 3ZQ4A 2WS3B 3AV8A 4RGMA 2QEJC 1MPEA 1I4RA 2AQ3B 3IXSA 3KLSX 4YSZB 1KRHA 1QOGA 1UWXA 4GLSC 1D4BA 1WGKA 1QOFA 2WXOA 1DYQA 1L5PA 3EUB2 4XE0A 1WXQA 1I4GA 1CK1A 1E10A 3I57A 2WXMA 3J9CA 3B9JA 1OFFA 4HJGE 4XDDA 2V4IB 5HFYA 2W54A 2RPVA 3C8YA 4MM3B 4JWSC 1XXGA 2WNMA 3Q8EA 3TEWA 1T3QA 2WXKA 1BUIC 1DGJA 1V1PA 2Y5PA 1ENFA 2SEBD 3FAHA 2HDEA 2Y5CA 2PKOA 3R2IA 2LJIA 2QILA 4A9AA 2INPE 4XDCA 1PFDA 3W5UB 1GOZA 3AEEB 2WXRA 4MH8A 1QLBB 1HXYD 3Q8FA 1FXIA 2KWDA 2L32A 1K53A 1TKEA 2JU6X 1EWYC 4C80A 2QJLA 2BBCA 2W55A 2JX5A 4AQ7A 2N0SB 2I38A 3LB8C 2VZKB 1HEZE 2K3UA 3P4SB 1TS5A 3U52E 5HHDG 3VRBB 3AE4B 1STEA 4IKGA 2JQRB 2LHDA 2WDQB 3P4RB 2JSVX 3AE6B 4ITKA 1YQ4B 1PDXA 2BS4B 2D5GA 4B0MA 1TYGB 4YXDB 1SSNA 3HVDA 4TSSA 3VQIA 4GDLB 1KLGD 2IJ0A 3AN1A 1MI0A 3NVWA 1P7EA 5D3IB 1D5XC 1J7BA 1JCKB 1OQQA 2AX5A 2ZW0A 3EA6A 4USAA 4US9A 2FBWB 4KGSA 2SAKA 1RFKA 3AEDB 1ZXHA 1XCTL 1QT9A 4RF1A 3RPFC 2VZKD 1ROEA 5BYSA 3KQ4A 1OQRA 1GAQB 2G1EA 4C7ZA 4RF0A 4RH6A 3MJ5A 5FKAC 5GXGB 1AYFA 1HA5A 3WCQA 2DYOA 2JYTA 4WWMA 2DYMA 1VLBA 4US8A 4KX6B 4J3OD 3SR6A 5FK9C 2RDGA 2KACA 1JWSD 1YN4A 1L0VB 2TSSA 1F0ZA 1T5XD 2AQ1B 3P4PB 5D7GA 1HZ6A 3AM9A 3U7ZA 4HKZE 3AH7A 4LK0M 1L6UA 2GB1A 1VZ6A 4NAWB 3ZJUA 5TSSA 1SIJA 4MT5A 1D6EC 1UWMA 2WXJA 2V0GA 3W1SA 2CJNA 2FE8A 4WURA 4ZRPA 5EE3A 3AE8B 2WU5B 5JXVA 2Y3AA 1PYWD 2PVOD 1F2RI 3BWUD 3U2SC 3KWLA 2WXQA 2N9KA 1TZOA 4A6QA 3R2TA 2ACZB 2BB6A 1N5WA 5D3DA 1GB4A 1ESFA 1FFUA 1ZOYB 5I4DA 2G9HD 4M0WA 3AE3B 3NUHB 2K9XA 3AMZA 1YN3A 5EE0A 2IGDA 1IUEA 1EU4A 2JXTA 4YWGG 3V05A 5G5HA 3TEXA 3V3XA 2IGGA 3ZJVA 1JMLA 1XO3A 5HG2A 4ZYSA 3Q69A 4LTUA 1RYJA 3BVMA 1N61A 2H88B 3VR8B 1EU3A 1DOIA 4RGNA 2BT6A 1ZP0B 4IOIE 1I7HA 3EGRA 1QILA 3W5VB 2K22A 4R3DA 5G5GA 3SEBA 1K51A 5BYQA 4GDKB 2LMCA 4L23A 3ZYYX 2LUMA 2Q5WD 1MHXA 1C78A 4JWUC 1KH0A 2JYEA 1VZ7A 2WLBA 3ETRA 1I4HA 3FILA 1FNWA 1Q10A 1XCQL 1JWAD 3AE9B 1QOBA 1VDVA 3BK1A 4A8XC 1C4PA 2J42A 4PT5A 3AEAB 4L2YA 1ACCA 2YEPB 4C7YA 1ET9A 1QQRA 1C79A 4HEA1 1XLOA 4NZLB 3RFZB 2INNE 3GB1A 3AE2B 3TEZA 4KGRA 1Y56A 2BYTA 4RNAA 2OHFA 2WXLA 3U4EG 2WDVB 2E6XA 4WH4A 1RWSA 1ZXIA 1JROA 1PGAA 3FILB 1L4DB 1SJED 1CJEA 4JE3B 1SE4A 1C4AA 2IGHA 2WQYB 2BTEA 2IDYA 2OEDA 2YEPF 3GS2A 3B2GA 3AB5A 4NAMA 3UI3A 1EM7A 4N58A 1MVKA 2AQ2B 2ONQA 3MFGA 1VJKA 2RMMA 3AE5B 1V1PB 1FNVA 1B1ZA 1JRPA 2KAJA 2QIEB 5BMHA 1NYQA 1YMHE 1E0ZA 1KLUD 1QOAA 3AEGB 5E6JA 4OZBA 1R7SA 5C3JB 3BVZA 3NRZA 1ZPSA 2R61A 2WXPA 3OWEB 2M19A 1TKGA 1JALA 2N9LA 3BIID 2PVGC 2KDMA 2I2YA 1F77A 2FUG1 2ZW1A 3T3NA 4OW0A 4B0EA 3P1MA 5AUIA 2J4XA 4O1NA 3CWIA 1JW9D 2NTTA 2K5PA 1C9FA 3ZJTA 1NEKB 2LGIA 1SEBD 2L1AA 3E56A 3NS1A 1NI3A 3SFDB 4YTPB 1JQ4A 4YTMB 2WXNA 3TUOA 2NTSA 3DWGC 1GPXA 1J7AA 5BYRA 4P16A 2BB5A 4N6EB 1XLNA 4AS1A 4L1BA 4REZA 3IT6B 5H92C 1V8CA 4XWWA 3Q8BA 1TJEA 3BZDB 1KFYB 4IDIA 1LO5D 1L4ZB 1FNUA 1K50A 2M0AA 1AN8A 1VRAB 3BYYB 1FEHA 1NENB 2DBYA 3IT4B 2WDRB 3SFEB 2EELA 1DOYA 4TQ0A 1EWCA 4WQMA 1P7FA 3HVZA 1I4XA 4N59A 2WP9B 2LHEA 2Z8LA 3NVZA 5AUKA 1SXTA 3IAS1 1C76A 4ARIA 1NVID 4WAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KH0 A;  3FIL A;  1Q10 A;  1MI0 A;  1XCQ L;  2PW9 A;  1P7E A;  2ZW0 A;  1HZ5 A;  2NMQ A;  4KGS A;  1ZXH A;  1PGB A;  1FCC C;  1XCT L;  2J52 A;  1IBX A;  1IGC A;  2JZP A;  2KN4 A;  3GB1 A;  4KGR A;  5BMI A;  4OZA A;  2PTL A;  1GB1 A;  1QKZ A;  1MHH E;  4WH4 A;  1PGA A;  3FIL B;  4KGT A;  1FCL A;  4D2K A;  2IGH A;  2GI9 A;  2OED A;  2KAC A;  1IGD A;  4MAC A;  1XF5 L;  1YNT E;  1K52 A;  3UI3 A;  1EM7 A;  1HZ6 A;  4HKZ E;  1MVK A;  2ONQ A;  1F2R C;  1MPE A;  2RMM A;  2GB1 A;  5BMH A;  1YMH E;  1UWX A;  4GLS C;  1D4B A;  4OZB A;  2ON8 A;  5BMG A;  2JWU A;  5JXV A;  2N9L A;  4HJG E;  5HFY A;  2KDM A;  1IBX B;  2I2Y A;  2K0P A;  1F2R I;  2RPV A;  2ZW1 A;  2PLP A;  2N9K A;  1GB4 A;  3MP9 A;  2N7J A;  5HI1 A;  1C9F A;  4OZC A;  2LGI A;  2IGD A;  1FD6 A;  2QSD A;  2JXT A;  3V3X A;  2IGG A;  2KWD A;  1JML A;  1K53 A;  5HG2 A;  2JU6 X;  1K50 A;  1PGX A;  2EEL A;  2I38 A;  4IOI E;  1P7F A;  1HEZ E;  1K51 A;  2KQ4 X;  2QMT A;  5HHD G;  2LHE A;  2LUM A;  4IKG A;  2LHD A;  2J53 A;  2JSV X;  1MHX A; 
#chains in the Genus database with same CATH topology
 1MG8 A;  4HWI B;  3AEF B;  2C7H A;  1EO6 A;  2KTF A;  4ZOH C;  2NMQ A;  2V3P A;  4W9C A;  3MC0 B;  3SD5 A;  4ARC A;  1WRD B;  3V61 A;  3ZXV A;  1V6E A;  4P6V F;  2A4Z A;  5LNK 1;  1UBQ A;  2BW2 A;  3MHS D;  2IPK D;  1E7U A;  4PS3 A;  4EE2 A;  2G3Q B;  1LGR A;  4KIK A;  1KF6 B;  4EZL A;  2FNJ B;  2K8H A;  4FUL A;  4AP4 C;  2ZCC A;  1CZP A;  2C9W B;  1XD3 B;  3MJW A;  4MAC A;  4FA6 A;  4EOY A;  3BVG A;  4WWN A;  5T8I A;  1BXT A;  2JT4 B;  4HCP B;  5EE1 A;  3QCA A;  3LXF A;  2WXF A;  4HPL B;  1SIF A;  1L6V A;  1GC6 A;  3L4P A;  3HRD D;  4F8C B;  2KTR B;  2KFJ A;  1QF6 A;  1JWB D;  1ZUD 2;  2V3N A;  3MHZ A;  2EKI A;  3IBE A;  2WU2 B;  3DPD A;  3PRZ A;  4JL9 A;  1FD6 A;  3PSE B;  1V1O A;  3H7P B;  2RDH A;  3EC8 A;  3KVF B;  3VRA B;  1SE3 A;  1FMA D;  3ZGZ A;  4DHZ B;  1AWD A;  1J7C A;  2E3T A;  1PGX A;  3ML9 A;  3WAN A;  4HCN B;  2BQQ A;  1WXA A;  1L2N A;  2KQ4 X;  3DWM A;  2BGF A;  4LNO A;  1TY0 A;  4KZ0 A;  1SBB B;  4B95 A;  3AEC B;  2CU1 A;  4RFB A;  3Q3O C;  4PYU A;  1KOT A;  4W9E A;  3RN9 C;  3TIX A;  4DHZ E;  3RNF C;  1N5X A;  4II3 B;  3VFK A;  3PPA A;  2C60 A;  5JZE B;  4FHJ A;  1IGC A;  4FHK A;  4RGO S;  1R4N I;  1V5T A;  2KMM A;  4GXB A;  4XYC A;  1L0X B;  1E6E B;  5FR3 A;  1FXA A;  3Q3J A;  2J0K A;  2LAS A;  1SGH A;  3RD2 A;  1ZDV A;  2M8S A;  1IGD A;  2WXG A;  1K52 A;  5JHA A;  3M3J A;  3AV8 A;  5D94 A;  4RGM A;  2QEJ C;  1MPE A;  3EFU A;  5G2N A;  3KLS X;  3RUI B;  2NR2 A;  2BPS A;  1QOF A;  2UU7 A;  2MBE A;  1OTR B;  1L5P A;  5DPW A;  4G0N B;  2A5U A;  1WR6 E;  4EKU A;  2PE6 B;  4EEW A;  4MEM A;  4HJG E;  5HFY A;  3C8Y A;  3RNG C;  3TEW A;  2NCN A;  1T3Q A;  1V1P A;  2Y5P A;  3KUD B;  3MC9 A;  2KQ7 A;  2KXJ A;  3FAH A;  2Y5C A;  1TZ1 A;  2INP E;  1PFD A;  3U30 A;  3L08 A;  1GOZ A;  2BWE S;  2WXR A;  1QLB B;  1HXY D;  2KWD A;  2L32 A;  1TKE A;  1EWY C;  2QJL A;  4JQW C;  2W55 A;  2KQS A;  2KX0 A;  2N0S B;  1T0Q C;  4KSL C;  3FKY A;  1J8C A;  3X23 A;  2KFK A;  1J19 A;  3DVN V;  2MP2 B;  1STE A;  3UIN B;  4IKG A;  2LHD A;  3P4R B;  3W1Y A;  2IYD B;  3AE6 B;  4F7Z A;  1PDX A;  2BKR B;  2WYQ A;  1TYG B;  4TSS A;  3L17 A;  3VQI A;  2GBN A;  2IJ0 A;  3AN1 A;  1OQQ A;  2MRP A;  4BFR A;  4C4V B;  3KYC D;  3JW0 X;  4RF1 A;  3RPF C;  5CHV C;  2Z59 B;  2DAJ A;  1BT0 A;  1E8W A;  3A1Q B;  3NHE B;  2G1E A;  3V6C B;  2AYO B;  4GDK A;  2ZZP B;  2KNB A;  3WCQ A;  4BBN F;  2DYO A;  3ZW3 A;  2ASQ A;  4NJ7 A;  4US8 A;  3KW5 B;  1TT5 B;  5LLI A;  4NPN A;  3P4P B;  5D7G A;  4NJ6 A;  1WGR A;  4LK0 M;  2D3A A;  4NAW B;  1HTQ A;  2CS4 A;  2XBB C;  1D6E C;  3IFW B;  1TBE A;  2FE8 A;  4DWF A;  3UQB A;  5JXV A;  3VH4 B;  3RNB C;  2PVO D;  3JSV A;  2D3C A;  3DOW A;  4PS8 A;  2ACZ B;  1N5W A;  3HHM A;  5I4D A;  1WJ4 A;  4K7S A;  4BKT A;  2K9X A;  4EZK A;  1WR1 A;  1IUE A;  5G5H A;  3TEX A;  3V3X A;  2VRR B;  2OJR A;  3L16 A;  1CMX B;  2C5L C;  2H88 B;  1JRU A;  1ZP0 B;  3EGR A;  4JLC A;  3W5V B;  2V3S A;  2IND C;  5G5G A;  5DPT A;  3SEB A;  2YLM A;  2HJ8 A;  2ZVN A;  4JWU C;  1KH0 A;  1VZ7 A;  1XT9 B;  3ZDM C;  4OVU A;  1FNW A;  1JWA D;  4RMA A;  4BKS A;  1VDV A;  3BK1 A;  4XX5 A;  4WAA A;  3AEA B;  4ANW A;  2MW5 A;  4HVB A;  5L83 A;  3B0A A;  2BF8 B;  1C79 A;  4KGR A;  2BYT A;  4FJV B;  2OHF A;  3W1S C;  2I1K A;  5KHO A;  4DHJ D;  4NY0 A;  1PGA A;  4IM0 A;  3UQA A;  4XGA B;  1C4A A;  2IGH A;  1T0S C;  2JUO A;  2YEP F;  3M63 B;  2ONQ A;  1V1P B;  1B1Z A;  1NYQ A;  1ZKH A;  1E0Z A;  4NQL B;  1V5O A;  1R7S A;  2R61 A;  2WXP A;  2HE7 A;  3WAO A;  3BII D;  4ZRI A;  2KDM A;  2I2Y A;  1F77 A;  3DDC B;  3QAR A;  2X8X X;  4OW0 A;  3P1M A;  2J4X A;  3PZD A;  1YX5 B;  1C9F A;  1NEK B;  2LGI A;  4ZRK A;  4N9F 4;  1NI3 A;  4YTP B;  3TUO A;  3DWG C;  1GPX A;  2N4F A;  3TMP B;  3DQV A;  1E7V A;  4EFO A;  4L1B A;  2NPT B;  4XWW A;  4WJN A;  3VXW A;  2AEH A;  2M0A A;  2JY6 A;  3IT4 B;  3QX1 A;  1DOY A;  4TQ0 A;  2REX A;  1P7F A;  3ALB A;  1I4X A;  3AI5 A;  4N59 A;  1I42 A;  3IAS 1;  4WAF A;  4KKI A;  5IKC M;  3IAM 1;  1TS4 A;  3DHG C;  2RDB C;  1XEE A;  3VTW A;  4ZRJ A;  2LGX A;  2J52 A;  1IBX A;  3D32 A;  3V60 A;  2LEK A;  2KN4 A;  1V81 A;  4OVZ A;  1BML C;  3CIR B;  3HM6 X;  4TMA B;  2KC2 A;  4OZA A;  1TS2 A;  4ICV A;  3V6E B;  1C77 A;  2PIA A;  3GE8 C;  2CHZ A;  4ZDV A;  1M4V A;  1RFA A;  2KO3 A;  4A90 A;  5AEK B;  2PJH A;  2GI9 A;  2RR9 A;  4C56 C;  4B9K A;  3GP7 A;  1WXV A;  4ZHO A;  1XLP A;  3O13 A;  1YJ1 A;  1IP9 A;  1SF0 A;  2KLG A;  2R2O A;  3WIM A;  2ZEQ A;  1N62 A;  4YT0 B;  3ZRC A;  2HTM E;  1N6Z A;  1ZDX A;  1YIW A;  2FCQ A;  4G3X B;  2O6V A;  1N60 A;  2K0P A;  2M56 B;  1ZE3 D;  3UIP B;  1YN5 A;  1D5M C;  3UIO B;  3R7Q A;  1HQR D;  5HI1 A;  4OZC A;  3CF6 E;  2RGF A;  3PHW B;  5GMV A;  2GBJ A;  4XC2 A;  3W9C B;  2O2V B;  3FC4 A;  1Q5W B;  2QSD A;  1WRI A;  2PMV A;  3A4S C;  3T3O A;  2WXH A;  4H2A A;  3HIZ A;  4JX1 C;  4DXG A;  2DLB A;  2D2Q A;  3ZO5 B;  2QMT A;  2MEK A;  2WWZ A;  3L10 B;  5H8Y E;  3W2D A;  4DHJ B;  3ZNI D;  4LLG M;  2LGD A;  1UGJ A;  1G6J A;  3PZ7 A;  2KVR A;  4KZC A;  4IC7 B;  4PS7 A;  4HJK A;  3QC8 B;  2KFK B;  2L00 B;  3AE7 B;  5IAA C;  3PZ8 A;  1FCC C;  3NZU A;  2J0J A;  1A5R A;  4HRS A;  4YTN B;  2UYZ B;  1KM7 A;  3E9S A;  3PVL A;  2IZV B;  3RYT A;  1SE2 A;  2PTL A;  3L54 A;  4DQO C;  3KUC B;  2MWS B;  4MGK E;  1FXT B;  2N1W A;  4D2K A;  4I6N B;  2CHX A;  2L83 A;  4Q2J A;  1N63 A;  3OJ4 B;  3S2A A;  1AW7 A;  1WE7 A;  2WS3 B;  3DHI C;  3RMK C;  2XK5 A;  3VTV A;  3IXS A;  2MBH A;  3DBH I;  1UWX A;  2WXO A;  1DYQ A;  3CMM B;  4RM8 A;  2MX2 A;  2PE9 A;  2JF5 A;  2VH1 A;  1E10 A;  4YL8 A;  4XDD A;  4DDI D;  4HK2 A;  2RPQ A;  2IO1 B;  4IWP A;  4MSQ B;  2WDT B;  3AU4 A;  3DBL B;  3VH3 B;  2SEB D;  4A3P A;  1NBF C;  4A9A A;  4XDC A;  4E74 A;  3AEE B;  2NPT A;  3HK0 A;  2JZ3 B;  1HTO A;  2KDE B;  1WZ3 A;  3WAP A;  1GJZ A;  1P0R A;  2BBC A;  2JX5 A;  2MCN B;  2I38 A;  4QAY A;  1J0G A;  4C00 A;  1HEZ E;  3P4S B;  1WE6 A;  5HHD G;  5CX3 A;  4KVG B;  5IA7 A;  4ICU A;  2BYF A;  4ITK A;  4YXD B;  3U8Z A;  3HVD A;  4IM2 A;  5DCN A;  1J7B A;  3EA6 A;  1JCK B;  2ZW0 A;  1S1Q B;  1LM8 B;  2KN5 A;  1ZXH A;  1XCT L;  1EF1 A;  1UBI A;  2ZVO A;  5LXH A;  5E6P A;  5HKH A;  1WJU A;  4IWQ A;  5BYS A;  3KQ4 A;  1GAQ B;  4MGI E;  4LJP B;  2EMT A;  4RH6 A;  3MJ5 A;  1HA5 A;  4K3B A;  5CHF A;  4IM3 A;  2JYT A;  4WWM A;  1VLB A;  4J3O D;  2RSU A;  4GU2 A;  2TSS A;  1WXM A;  3PTF C;  1K8R B;  1HZ6 A;  3U7Z A;  4HKZ E;  3N1X C;  1T0Y A;  1L6U A;  1VZ6 A;  4MT5 A;  5KHQ A;  1ZW7 A;  4I6P A;  1UWM A;  2WXJ A;  2V0G A;  3A33 B;  2CJN A;  4WUR A;  4ZRP A;  4IWO A;  5EE3 A;  3AE8 B;  2BYV E;  4NAW A;  1UH6 A;  2Y3A A;  1PYW D;  4W9K A;  3KH0 A;  3KWL A;  2BVC A;  2N9K A;  2KX3 A;  1TZO A;  1GB4 A;  1YD8 U;  3N3K B;  1ZOY B;  3OLM D;  4E3C A;  2G9H D;  3NUH B;  3GE3 C;  1WGH A;  4BKS D;  1EU4 A;  2JXT A;  4YWG G;  3QK0 A;  2IGG A;  1YQB A;  3RUL A;  1XO3 A;  3RZF A;  4C4V A;  4J6I A;  1N61 A;  2KJ6 A;  3VR8 B;  1EU3 A;  2IO0 B;  5CTR C;  4RGN A;  3X0W A;  2BT6 A;  4IOI E;  3ZTC A;  1QIL A;  3A1Q A;  2JZZ A;  3WAM A;  2WX0 A;  2LMC A;  3ZYY X;  1I35 A;  2JYE A;  2O6V D;  3ETR A;  1I4H A;  1Q10 A;  1WGG A;  1C4P A;  1WJ6 A;  2AL3 A;  4L2Y A;  4C7Y A;  4B6W A;  1ET9 A;  2K39 A;  2JRI B;  4NZL B;  3RFZ B;  1L7Y A;  3PLU A;  1NI2 A;  3GB1 A;  2LRW A;  4BVU C;  2NS5 A;  2LVQ A;  2BTE A;  2GMI C;  4GB9 A;  2Y5B B;  3ZXR A;  3UI3 A;  4AOF A;  4A20 A;  2JPH A;  1M94 A;  2IBI B;  4N58 A;  1MVK A;  3MFG A;  3NG0 A;  1WH3 A;  2RMM A;  3AE5 B;  4W9L A;  2KAJ A;  3L13 A;  3AXC A;  2KJH B;  4OZB A;  2QDF A;  4W9J A;  2LRU A;  3NRZ A;  5E6N A;  4EUT A;  2M19 A;  1TKG A;  1WIA A;  5J2R A;  2FUG 1;  1E8Z A;  2ZW1 A;  4K7U A;  5AUI A;  2ZCB A;  4K3C A;  1F9J A;  2FCS A;  3CWI A;  3ZDT A;  4I6L B;  1JW9 D;  2O6V B;  3ZJT A;  1UEL A;  4LJO B;  3PS6 A;  4YTM B;  1U4A A;  5BYR A;  4P16 A;  4HLE A;  2XEW A;  1XLN A;  4AS1 A;  4REZ A;  3RCZ A;  3BZD B;  4M01 A;  2L05 A;  4GMV A;  3VAW A;  1L4Z B;  1GG3 A;  2FIF A;  2KK8 A;  2M4N A;  1FEH A;  1NEN B;  4EZJ A;  4DDG D;  3ML8 A;  2WDR B;  1WM2 A;  1EWC A;  1VD2 A;  2L76 A;  2LHE A;  2Z8L A;  3TCA A;  1C76 A;  2GOW A;  2ICI A;  4WJO A;  3GOE A;  4LCD E;  1FPY A;  2PW9 A;  3H1U A;  2FAZ A;  4S0R A;  1UGM A;  1YJI A;  2HJ1 A;  3NZ3 A;  2KT7 A;  2LD9 A;  2KDB A;  1PGB A;  3Q8C A;  1EF5 A;  3Q3N C;  2VH2 A;  4XWT A;  1XLQ A;  1VR9 A;  1H8C A;  2D10 A;  1YQ3 B;  1NYR A;  2I1J A;  1RRB A;  5JHB A;  4YSX B;  4W9G A;  3TSS A;  1PUT A;  3QWZ B;  1E7P B;  2KTR A;  4WIP A;  3KWV A;  2CJO A;  4MH0 E;  2X38 A;  5BMG A;  2JWU A;  2MJE A;  2CU3 A;  1IBX B;  1WWT A;  1X1M A;  2PLP A;  1VZ8 A;  2LVP A;  2BS3 B;  3PV1 A;  1VCB A;  4DK5 A;  1P1A A;  2K25 A;  1Z5S B;  1WYG A;  4RGT A;  3BK2 A;  4RM9 A;  3AU5 A;  3Q3F A;  4HRO A;  5BO4 B;  3Q3M C;  1CQV A;  2MJD A;  2GRI A;  3ZTD A;  2NBV B;  4M8M A;  1D5Z C;  4UDU C;  1TTN A;  1UNS A;  2M17 A;  2EMS A;  3ABV B;  3I5J C;  2G45 B;  3JVZ X;  1FM0 D;  1P3Q U;  3P4Q B;  3ZIM A;  1MG4 A;  4FBJ B;  1ET6 A;  3EEC A;  4KV2 A;  4FLH A;  2XN9 C;  1P9D U;  4W9D A;  1RM6 C;  1E9M A;  2B76 B;  1SB3 C;  2J53 A;  2MLB A;  2LXC A;  1FFV A;  1B9R A;  4NJC A;  3Q8A A;  3LDZ E;  1WXS A;  1HZ5 A;  3P42 A;  5J17 A;  3OJ3 A;  4KKJ A;  2DZK A;  1DOX A;  3LYY A;  5AZF A;  1TY2 A;  2W82 A;  1KJT A;  1FIQ A;  2J7Q B;  2QC8 A;  4CQN A;  5BMI A;  2WXI A;  1RAX A;  2D3B A;  2WHI A;  2XNA C;  1GB1 A;  5MPO A;  2Z0E B;  4MGZ E;  2LGY A;  3QHT A;  1OQY A;  3AEB B;  4MDK E;  4TQ1 A;  4YSY B;  4OHJ A;  4CYE A;  2MJ3 A;  1V97 A;  2KD0 A;  4ZRQ A;  3OAW A;  5C2T B;  1YNT E;  4PYZ A;  3RNA C;  2N7D A;  3ZQ4 A;  4M0W B;  4IG7 B;  4K1R B;  4WWP A;  2DAF A;  3DBS A;  4YSZ B;  1KRH A;  1QOG A;  4GLS C;  1D4B A;  3DBR I;  3C19 A;  1I4G A;  3APC A;  3C0R B;  2CR5 A;  4MEL A;  3B9J A;  1OFF A;  1Z2M A;  2L7R A;  2W54 A;  1NDD A;  2O2V A;  4MM3 B;  3VUY A;  1XXG A;  2WNM A;  3Q8E A;  4IW0 A;  3TBL D;  2B3A A;  4K81 A;  1SE9 A;  2ZNV C;  3M62 B;  1BUI C;  1ENF A;  2KKC A;  4GOC A;  1GC7 A;  2PKO A;  3NS8 A;  1C1Y B;  1OGW A;  3EHV A;  5D2M B;  2PPH A;  2QIL A;  5DPR A;  4GN1 A;  3ZUN A;  3VUW A;  4E71 A;  2BWF A;  3Q8F A;  2JXX A;  1FXI A;  3A9K A;  1K53 A;  2IO3 B;  2JU6 X;  3DBR B;  3ZNH B;  1XQQ A;  3LB8 C;  5IP4 D;  2VZK B;  2K3U A;  2MBB B;  1TS5 A;  1WF9 A;  3VRB B;  4F1S A;  2WDQ B;  4ANX A;  1WZ0 A;  2D5G A;  2L0F A;  1KLG D;  1WM3 A;  1P7E A;  2M0X A;  4US9 A;  3M95 A;  4KGS A;  2SAK A;  2HD5 B;  2LGS A;  3MTN B;  2DHZ A;  1WFY A;  1LXD A;  3PGE A;  4ANV A;  4NNJ B;  2G4S A;  1HE8 A;  3IHP C;  3RNE C;  1OQR A;  2D11 A;  4RF0 A;  5FKA C;  3SDL C;  1AYF A;  3VVW B;  2XK5 B;  2KVZ A;  2MBQ A;  4DXA B;  2DYM A;  4KX6 B;  3SR6 A;  5FK9 C;  1JWS D;  1YN4 A;  1L0V B;  2INC C;  1T5X D;  2V9H A;  4BZA A;  3AH7 A;  5TSS A;  2N9P C;  4FJY A;  2DNF A;  2KDF B;  1MFW A;  3ENE A;  1S3S G;  4LNI A;  4BOS C;  2RD0 A;  4KSK C;  1WI0 A;  2KWU B;  3GZN B;  4LDT B;  3BWU D;  3JYU A;  4II2 B;  5L95 C;  2WXQ A;  5J18 A;  1IPG A;  2FCM A;  2MBO A;  4OVV A;  4A6Q A;  3R2T A;  1ESF A;  2ZNV B;  3I63 C;  2QCZ A;  3AMZ A;  1YN3 A;  5EE0 A;  2W9N A;  2D07 B;  2MP2 A;  2ZPN A;  4JIO U;  5IO9 A;  3ZJV A;  3CSF A;  4ZYS A;  3Q69 A;  1RYJ A;  2FUH B;  1DOI A;  1I7H A;  2KHW B;  4IUM B;  3R66 C;  1K51 A;  3IG3 A;  3Q14 C;  4GDK B;  1Q0W B;  5E6O A;  2Q5W D;  3T9L A;  1V80 A;  1MHX A;  2N7E A;  2WLB A;  1XCQ L;  4BOZ B;  4FAD A;  2J42 A;  3PRM B;  3Q6B A;  3QJZ A;  3A9K B;  1QQR A;  2MA9 B;  4HEA 1;  2INN E;  3AE2 B;  2J0M A;  1Y56 A;  1WGY A;  2WDV B;  2E6X A;  4BAX A;  3R3M A;  1RWS A;  1ZXI A;  2DZJ A;  4A3O A;  2N9X A;  4JE3 B;  2WQY B;  1ZGU B;  3GS2 A;  2NBW B;  4WQO B;  3LJ3 A;  3AB5 A;  1WY8 A;  1EM7 A;  1LQB A;  2AQ2 B;  2JWZ A;  1VJK A;  1JRP A;  5BMH A;  1KLU D;  3DVG Y;  1QOA A;  3AEG B;  3BVZ A;  1V86 A;  3TL5 A;  1ZPS A;  3DHH C;  2FID A;  1JAL A;  2QHO A;  2N9L A;  1Q1O A;  2PEA A;  3VHT C;  3T3N A;  3NOB A;  4O1N A;  4LNK A;  1WX9 A;  3TJP A;  1H4R A;  4TUU A;  1SEB D;  2YVC A;  2L1A A;  3PRP B;  1AAR A;  1JQ4 A;  2WXN A;  3JSV B;  3PT2 B;  1R4M B;  3NJT A;  2MHJ A;  3O65 B;  3IT6 B;  2KLC A;  1GUA B;  1TJE A;  1KFY B;  2HTH A;  3N1Z C;  4KIK B;  4G11 A;  4WJP A;  3BYY B;  3H7S A;  4M00 A;  4ACF A;  4AJW A;  2DBY A;  5CHW A;  3H7P A;  3NVZ A;  5AUK A;  5G55 A;  2LI5 A;  1QZE A;  1UUP A;  3N9Y C;  1TS3 A;  1E5W A;  2ZJD A;  3BYT B;  2FCN A;  1UZX B;  3N30 A;  2JVC A;  5JH5 C;  2M1M A;  3ZLZ A;  5IOI A;  2L8J A;  1SJH D;  3ECI A;  1E90 A;  2EKE C;  1YX6 B;  2DX5 B;  4X57 B;  4AUQ C;  2KYW A;  3PO0 A;  1V2Y A;  4A55 A;  2LFI A;  3L0W B;  1C4C A;  1A70 A;  1QKZ A;  3P63 A;  3OG5 A;  3EFC A;  2KWC A;  3R8B A;  3URY A;  4KGT A;  3DVG X;  4HKQ A;  3CST A;  4RCO A;  2BYE A;  3DVN U;  2L52 A;  4HPM B;  3NY5 A;  2V4L A;  1F2R C;  3GZN I;  3QQ8 B;  4M02 A;  1WJN A;  1I4Q A;  2W3S A;  2KOX A;  1D3Z A;  4ASW C;  1WSP A;  1OEY J;  2LJ5 A;  2ON8 A;  4ZHP A;  1I4P A;  3H8H A;  3NVY A;  5C23 A;  5LXI B;  3I9V 1;  1T6B X;  1ISN A;  3RZW C;  2GBR A;  3Q2A C;  4HDQ A;  5IN7 A;  3U7D A;  3H6N A;  1RLF A;  2MH7 A;  4DXF A;  3MP9 A;  4JPS A;  2G4D B;  2N7J A;  5AZH A;  2JRH A;  1LFD A;  2KZR A;  3PRE A;  4FXC A;  2Z0D B;  3UF8 A;  4HXD A;  3MC8 A;  1E8X A;  3SHQ A;  4P1C C;  4ZYN A;  1FO4 A;  4KDI C;  3ZNG C;  1WX8 A;  3APF A;  3VR9 B;  4GGQ A;  5EE9 A;  2L3Z A;  2H89 B;  1FRR A;  2DZI A;  2BS2 B;  1R4N B;  2KDI A;  2DWQ A;  5AZG A;  1YJJ A;  2KMA A;  4WWO A;  1WYW B;  3A9J A;  2MQJ A;  1JWM D;  2AL6 A;  1FRD A;  1L0Y B;  3HUI A;  4FJZ A;  2K8C A;  3B2F A;  3BY4 B;  1JWU D;  3ZRF A;  1T0R C;  2JZP A;  3RT3 B;  3AE1 B;  1TKY A;  3NVV A;  3BIN A;  2KC1 A;  1UF0 A;  1MHH E;  3DBH B;  2C7M B;  3VUX A;  3HM3 A;  1KTK A;  3N20 C;  2W3R A;  1FCL A;  3TEY A;  4GSW A;  1IYF A;  4MM3 A;  1XF5 L;  3VTU A;  1WMH B;  2DEN B;  3AUL A;  1I4R A;  2AQ3 B;  2LWP A;  4P1B C;  1P98 A;  1WGK A;  2K6D B;  3DBL I;  4XE0 A;  3EUB 2;  2GBK A;  1WXQ A;  1CK1 A;  3I57 A;  3K9P B;  2DYB A;  2WXM A;  3KUZ A;  3J9C A;  1F1H A;  2V4I B;  3V62 A;  4TKN A;  2RPV A;  1R4M I;  4MJS A;  4JWS C;  2KMC A;  2WXK A;  3PLV A;  4CHK A;  1DGJ A;  4G50 A;  2HDE A;  3B08 A;  3R2I A;  2LJI A;  2OJW A;  3W5U B;  4TV3 A;  1KLV A;  4NQK E;  2WX1 A;  4MH8 A;  4W9F A;  2BKF A;  2L0T A;  2D3G A;  2IY1 B;  3H9D A;  5EDS A;  4PK1 A;  2ZPY A;  4W9I A;  4HPP A;  4C80 A;  1GNU A;  4AQ7 A;  4WJQ A;  3ZKJ C;  2LXA A;  2WGS A;  3U52 E;  2NBU A;  3AE4 B;  2IY0 B;  2JQR B;  2UWQ A;  2JSV X;  1YQ4 B;  5TR5 A;  2BS4 B;  4B0M A;  2OOB B;  1Y8R C;  1SSN A;  4GDL B;  4LDT D;  3NVW A;  1MI0 A;  2CHW A;  5D3I B;  4URK A;  1D5X C;  3I3T B;  2AX5 A;  4USA A;  2LUE A;  2FBW B;  1RFK A;  3AED B;  1QT9 A;  4DBG A;  2VZK D;  4BBN C;  1ROE A;  4JGH B;  4MGY E;  4C7Z A;  2K6Q A;  3VDZ A;  5GXG B;  3A4R A;  1WGD A;  1EUV B;  4AJY B;  1V49 A;  3ZVV A;  1V9J A;  2RDG A;  2KAC A;  1F0Z A;  2AQ1 B;  3AM9 A;  3SU8 X;  2IO2 B;  4GIV A;  2GB1 A;  3KYD D;  3NZS A;  3ZJU A;  1SIJ A;  3W1S A;  3WA0 A;  2LZ6 A;  2WU5 B;  5DPS A;  3PHX B;  1F2R I;  3U2S C;  3K9O B;  1E8Y A;  3QAQ A;  2BB6 A;  5D3D A;  2DZM A;  1FFU A;  2KWV B;  4M0W A;  3AE3 B;  2IGD A;  4W9H A;  3RNC C;  2LVO A;  4M8N A;  3V05 A;  3IVF A;  1JML A;  3DCG A;  5HG2 A;  4LTU A;  3BVM A;  4FN2 A;  4MSM B;  2K22 A;  4HDO A;  1YOV B;  2GBM A;  4R3D A;  1F52 A;  5BYQ A;  4L23 A;  4MJS B;  2LUM A;  1C78 A;  2GLS A;  3QIJ A;  4ANU A;  4CO7 A;  4LNN A;  3FIL A;  3AE9 B;  1QOB A;  4A8X C;  2KAN A;  1WX7 A;  4PT5 A;  1ACC A;  2YEP B;  1OEY A;  3QA8 A;  4GDL A;  1XLO A;  4KDL B;  3R7R A;  3TEZ A;  3ONS A;  2R2Q A;  3UGB B;  4RNA A;  2WXL A;  3N32 A;  3U4E G;  4WH4 A;  1JRO A;  3FIL B;  3A9J B;  1L4D B;  1SJE D;  4P7I A;  1CJE A;  4S17 A;  1SE4 A;  4BKG A;  2IDY A;  2OED A;  3B2G A;  4NAM A;  4LNF A;  1FNV A;  2QIE B;  1YMH E;  1MJD A;  3APD A;  5E6J A;  1TGZ B;  5C3J B;  3P2B A;  3RI7 C;  3OWE B;  5D6J B;  5C1Z A;  2C7N B;  2K1F A;  2PVG C;  5FR6 A;  3WAL A;  1C3T A;  4B0E A;  2NVU I;  2MSE D;  2NTT A;  2K5P A;  3T8M A;  2N1V A;  3E56 A;  3NS1 A;  3SFD B;  1UD7 A;  2AWT A;  2N9E B;  2NTS A;  1J7A A;  2BB5 A;  4N6E B;  2CKH B;  2V1Y A;  5H92 C;  1V8C A;  3Q8B A;  1WMH A;  4IDI A;  1LO5 D;  3ZNZ B;  1FNU A;  1PQS A;  2K8B A;  1K50 A;  1AN8 A;  1VRA B;  4AWJ A;  3SFE B;  2EEL A;  4WQM A;  1TIF A;  3N1Y C;  2KJR A;  3HVZ A;  4K7W A;  2WP9 B;  3B1L X;  1SXT A;  4XZ4 A;  4ARI A;  1NVI D; 
#chains in the Genus database with same CATH homology
 2ICI A;  1UUP A;  4KKI A;  3AEF B;  3N9Y C;  3IAM 1;  1TS3 A;  1TS4 A;  3BYT B;  2PW9 A;  1YJI A;  4ZOH C;  2NMQ A;  2V3P A;  1XEE A;  3NZ3 A;  1PGB A;  1SJH D;  3Q8C A;  3MC0 B;  2J52 A;  1IBX A;  4XWT A;  1XLQ A;  2LEK A;  4ARC A;  2KN4 A;  4OVZ A;  4P6V F;  1VR9 A;  5LNK 1;  1BML C;  3CIR B;  4TMA B;  2BW2 A;  2IPK D;  4OZA A;  1TS2 A;  3PO0 A;  4EE2 A;  4A55 A;  2LFI A;  1C4C A;  1A70 A;  1C77 A;  1YQ3 B;  1QKZ A;  1NYR A;  3P63 A;  2PIA A;  1KF6 B;  3R8B A;  3URY A;  1M4V A;  4YSX B;  4KGT A;  3TSS A;  4A90 A;  4HKQ A;  1PUT A;  2GI9 A;  1CZP A;  4RCO A;  4MAC A;  4C56 C;  1E7P B;  3GP7 A;  4ZHO A;  1XLP A;  2L52 A;  3O13 A;  1F2R C;  1SF0 A;  4WIP A;  1N62 A;  3BVG A;  4YT0 B;  3KWV A;  1I4Q A;  2HTM E;  2CJO A;  2W3S A;  5T8I A;  1BXT A;  1WSP A;  2X38 A;  1ZDX A;  2ON8 A;  4ZHP A;  1I4P A;  5BMG A;  3H8H A;  3NVY A;  2JWU A;  5EE1 A;  3I9V 1;  1T6B X;  2MJE A;  2CU3 A;  1N60 A;  3LXF A;  1IBX B;  1WWT A;  2WXF A;  2K0P A;  2M56 B;  1ZE3 D;  2PLP A;  1VZ8 A;  1YN5 A;  2BS3 B;  1D5M C;  1L6V A;  3L4P A;  2MH7 A;  1WYG A;  4DXF A;  3MP9 A;  1HQR D;  4JPS A;  4RGT A;  2N7J A;  3BK2 A;  3HRD D;  5HI1 A;  4OZC A;  1QF6 A;  1JWB D;  4HRO A;  1ZUD 2;  1CQV A;  2MJD A;  2GRI A;  3W9C B;  2V3N A;  3MHZ A;  2EKI A;  3FC4 A;  4FXC A;  1D5Z C;  1UNS A;  4UDU C;  2WU2 B;  1FD6 A;  2QSD A;  1WRI A;  3ABV B;  1V1O A;  2PMV A;  2RDH A;  3T3O A;  1FO4 A;  2WXH A;  1FM0 D;  3VRA B;  1SE3 A;  4H2A A;  3P4Q B;  1FMA D;  3VR9 B;  3ZGZ A;  4JX1 C;  1ET6 A;  1AWD A;  4DXG A;  2DLB A;  1J7C A;  2E3T A;  1PGX A;  2XN9 C;  5EE9 A;  1RM6 C;  1E9M A;  2KQ4 X;  2QMT A;  3DWM A;  2MEK A;  2H89 B;  1FRR A;  5H8Y E;  2B76 B;  1SB3 C;  3W2D A;  1TY0 A;  1SBB B;  2J53 A;  2BS2 B;  4LLG M;  3AEC B;  1FFV A;  2DWQ A;  4RFB A;  1UGJ A;  1B9R A;  1YJJ A;  3PZ7 A;  4NJC A;  1N5X A;  1JWM D;  3Q8A A;  3AE7 B;  1HZ5 A;  1FRD A;  3P42 A;  1L0Y B;  3HUI A;  3B2F A;  3PZ8 A;  1FCC C;  1JWU D;  4KKJ A;  1DOX A;  1IGC A;  3LYY A;  2JZP A;  4RGO S;  1TY2 A;  4HRS A;  4YTN B;  2W82 A;  1FIQ A;  3E9S A;  3AE1 B;  4CQN A;  2KMM A;  1TKY A;  3NVV A;  5BMI A;  2WXI A;  1L0X B;  1E6E B;  1SE2 A;  2PTL A;  1FXA A;  2XNA C;  4DQO C;  5FR3 A;  5MPO A;  1GB1 A;  1MHH E;  3AEB B;  1KTK A;  4TQ1 A;  4YSY B;  2W3R A;  4OHJ A;  1FCL A;  1ZDV A;  4D2K A;  2MJ3 A;  3TEY A;  2L83 A;  1V97 A;  1IGD A;  4Q2J A;  1N63 A;  1XF5 L;  4ZRQ A;  5C2T B;  1YNT E;  2WXG A;  1K52 A;  1AW7 A;  3ZQ4 A;  2WS3 B;  3AV8 A;  4RGM A;  2QEJ C;  1MPE A;  1I4R A;  2AQ3 B;  3IXS A;  3KLS X;  4YSZ B;  1KRH A;  1QOG A;  1UWX A;  4GLS C;  1D4B A;  1WGK A;  1QOF A;  2WXO A;  1DYQ A;  1L5P A;  3EUB 2;  4XE0 A;  1WXQ A;  1I4G A;  1CK1 A;  1E10 A;  3I57 A;  2WXM A;  3J9C A;  3B9J A;  1OFF A;  4HJG E;  4XDD A;  2V4I B;  5HFY A;  2W54 A;  2RPV A;  3C8Y A;  4MM3 B;  4JWS C;  1XXG A;  2WNM A;  3Q8E A;  3TEW A;  1T3Q A;  2WXK A;  1BUI C;  1DGJ A;  1V1P A;  2Y5P A;  1ENF A;  2SEB D;  3FAH A;  2HDE A;  2Y5C A;  2PKO A;  3R2I A;  2LJI A;  2QIL A;  4A9A A;  2INP E;  4XDC A;  1PFD A;  3W5U B;  1GOZ A;  3AEE B;  2WXR A;  4MH8 A;  1QLB B;  1HXY D;  3Q8F A;  1FXI A;  2KWD A;  2L32 A;  1K53 A;  1TKE A;  2JU6 X;  1EWY C;  4C80 A;  2QJL A;  2BBC A;  2W55 A;  2JX5 A;  4AQ7 A;  2N0S B;  2I38 A;  3LB8 C;  2VZK B;  1HEZ E;  2K3U A;  3P4S B;  1TS5 A;  3U52 E;  5HHD G;  3VRB B;  3AE4 B;  1STE A;  4IKG A;  2JQR B;  2LHD A;  2WDQ B;  3P4R B;  2JSV X;  3AE6 B;  4ITK A;  1YQ4 B;  1PDX A;  2BS4 B;  2D5G A;  4B0M A;  1TYG B;  4YXD B;  1SSN A;  3HVD A;  4TSS A;  3VQI A;  4GDL B;  1KLG D;  2IJ0 A;  3AN1 A;  1MI0 A;  3NVW A;  1P7E A;  5D3I B;  1D5X C;  1J7B A;  1JCK B;  1OQQ A;  2AX5 A;  2ZW0 A;  3EA6 A;  4USA A;  4US9 A;  2FBW B;  4KGS A;  2SAK A;  1RFK A;  3AED B;  1ZXH A;  1XCT L;  1QT9 A;  4RF1 A;  3RPF C;  2VZK D;  1ROE A;  5BYS A;  3KQ4 A;  1OQR A;  1GAQ B;  2G1E A;  4C7Z A;  4RF0 A;  4RH6 A;  3MJ5 A;  5FKA C;  5GXG B;  1AYF A;  1HA5 A;  3WCQ A;  2DYO A;  2JYT A;  4WWM A;  2DYM A;  1VLB A;  4US8 A;  4KX6 B;  4J3O D;  3SR6 A;  5FK9 C;  2RDG A;  2KAC A;  1JWS D;  1YN4 A;  1L0V B;  2TSS A;  1F0Z A;  1T5X D;  2AQ1 B;  3P4P B;  5D7G A;  1HZ6 A;  3AM9 A;  3U7Z A;  4HKZ E;  3AH7 A;  4LK0 M;  1L6U A;  2GB1 A;  1VZ6 A;  4NAW B;  3ZJU A;  5TSS A;  1SIJ A;  4MT5 A;  1D6E C;  1UWM A;  2WXJ A;  2V0G A;  3W1S A;  2CJN A;  2FE8 A;  4WUR A;  4ZRP A;  5EE3 A;  3AE8 B;  2WU5 B;  5JXV A;  2Y3A A;  1PYW D;  2PVO D;  1F2R I;  3BWU D;  3U2S C;  3KWL A;  2WXQ A;  2N9K A;  1TZO A;  4A6Q A;  3R2T A;  2ACZ B;  2BB6 A;  1N5W A;  5D3D A;  1GB4 A;  1ESF A;  1FFU A;  1ZOY B;  5I4D A;  2G9H D;  4M0W A;  3AE3 B;  3NUH B;  2K9X A;  3AMZ A;  1YN3 A;  5EE0 A;  2IGD A;  1IUE A;  1EU4 A;  2JXT A;  4YWG G;  3V05 A;  5G5H A;  3TEX A;  3V3X A;  2IGG A;  3ZJV A;  1JML A;  1XO3 A;  5HG2 A;  4ZYS A;  3Q69 A;  4LTU A;  1RYJ A;  3BVM A;  1N61 A;  2H88 B;  3VR8 B;  1EU3 A;  1DOI A;  4RGN A;  2BT6 A;  1ZP0 B;  4IOI E;  1I7H A;  3EGR A;  1QIL A;  3W5V B;  2K22 A;  4R3D A;  5G5G A;  3SEB A;  1K51 A;  5BYQ A;  4GDK B;  2LMC A;  4L23 A;  3ZYY X;  2LUM A;  2Q5W D;  1MHX A;  1C78 A;  4JWU C;  1KH0 A;  2JYE A;  1VZ7 A;  2WLB A;  3ETR A;  1I4H A;  3FIL A;  1FNW A;  1Q10 A;  1XCQ L;  1JWA D;  3AE9 B;  1QOB A;  1VDV A;  3BK1 A;  4A8X C;  1C4P A;  2J42 A;  4PT5 A;  3AEA B;  4L2Y A;  1ACC A;  2YEP B;  4C7Y A;  1ET9 A;  1QQR A;  1C79 A;  4HEA 1;  1XLO A;  4NZL B;  3RFZ B;  2INN E;  3GB1 A;  3AE2 B;  3TEZ A;  4KGR A;  1Y56 A;  2BYT A;  4RNA A;  2OHF A;  2WXL A;  3U4E G;  2WDV B;  2E6X A;  4WH4 A;  1RWS A;  1ZXI A;  1JRO A;  1PGA A;  3FIL B;  1L4D B;  1SJE D;  1CJE A;  4JE3 B;  1SE4 A;  1C4A A;  2IGH A;  2WQY B;  2BTE A;  2IDY A;  2OED A;  2YEP F;  3GS2 A;  3B2G A;  3AB5 A;  4NAM A;  3UI3 A;  1EM7 A;  4N58 A;  1MVK A;  2AQ2 B;  2ONQ A;  3MFG A;  1VJK A;  2RMM A;  3AE5 B;  1V1P B;  1FNV A;  1B1Z A;  1JRP A;  2KAJ A;  2QIE B;  5BMH A;  1NYQ A;  1YMH E;  1E0Z A;  1KLU D;  1QOA A;  3AEG B;  5E6J A;  4OZB A;  1R7S A;  5C3J B;  3BVZ A;  3NRZ A;  1ZPS A;  2R61 A;  2WXP A;  3OWE B;  2M19 A;  1TKG A;  1JAL A;  2N9L A;  3BII D;  2PVG C;  2KDM A;  2I2Y A;  1F77 A;  2FUG 1;  2ZW1 A;  3T3N A;  4OW0 A;  4B0E A;  3P1M A;  5AUI A;  2J4X A;  4O1N A;  3CWI A;  1JW9 D;  2NTT A;  2K5P A;  1C9F A;  3ZJT A;  1NEK B;  2LGI A;  1SEB D;  2L1A A;  3E56 A;  3NS1 A;  1NI3 A;  3SFD B;  4YTP B;  1JQ4 A;  4YTM B;  2WXN A;  3TUO A;  2NTS A;  3DWG C;  1GPX A;  1J7A A;  5BYR A;  4P16 A;  2BB5 A;  4N6E B;  1XLN A;  4AS1 A;  4L1B A;  4REZ A;  3IT6 B;  5H92 C;  1V8C A;  4XWW A;  3Q8B A;  1TJE A;  3BZD B;  1KFY B;  4IDI A;  1LO5 D;  1L4Z B;  1FNU A;  1K50 A;  2M0A A;  1AN8 A;  1VRA B;  3BYY B;  1FEH A;  1NEN B;  2DBY A;  3IT4 B;  2WDR B;  3SFE B;  2EEL A;  1DOY A;  4TQ0 A;  1EWC A;  4WQM A;  1P7F A;  3HVZ A;  1I4X A;  4N59 A;  2WP9 B;  2LHE A;  2Z8L A;  3NVZ A;  5AUK A;  1SXT A;  3IAS 1;  1C76 A;  4ARI A;  1NVI D;  4WAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...