2KDMA

Nmr structures of ga95 and gb95, two designed proteins with 95% sequence identity but different folds and functions
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESIGNED PROTEIN
publication title From the Cover: A minimal sequence code for switching protein structure and function.
pubmed doi rcsb
molecule tags Igg binding protein
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kdmA00
4WH4A 2KACA 1XCQL 2OEDA 2QSDA 2I2YA 5HI1A 1Q10A 2KN4A 1K53A 2N7JA 4IKGA 1PGAA 5BMHA 1GB4A 2EELA 1PGXA 2JWUA 1MVKA 2KDMA 4KGRA 1IBXA 2LGIA 4GLSC 1F2RC 5HFYA 2RMMA 2LHDA 1K50A 4D2KA 3MP9A 1HZ6A 2JSVX 4KGSA 2IGHA 1UWXA 2IGGA 1JMLA 2N9LA 2PW9A 1PGBA 1C9FA 2PLPA 2NMQA 2ONQA 2RPVA 4HKZE 3FILB 1HZ5A 1XCTL 1P7EA 1IGDA 1F2RI 1YNTE 2ZW0A 3UI3A 5HHDG 1D4BA 1YMHE 1K52A 2LHEA 4OZCA 4MACA 2JXTA 1MPEA 3GB1A 2GB1A 4HJGE 1XF5L 1EM7A 1MHXA 1MHHE 2KQ4X 1FCLA 1K51A 3V3XA 1QKZA 2QMTA 4IOIE 5HG2A 2KWDA 4OZBA 2JU6X 3FILA 2J53A 4KGTA 1P7FA 1ZXHA 1FCCC 5BMGA 1KH0A 4OZAA 5BMIA 2LUMA 1HEZE 1IGCA 1MI0A 2I38A 2K0PA 2ZW1A 2IGDA 5JXVA 2PTLA 2ON8A 1GB1A 2GI9A 2JZPA 2J52A 1IBXB 2N9KA 1FD6A
chains in the Genus database with same CATH superfamily
2WWZA 1YN3A 4TQ0A 2ZNVB 5J18A 4IM3A 3MC9A 2D3AA 3N32A 4HWIB 3R8BA 1WJ6A 4IWQA 3VRBB 4BZAA 1WWTA 1WXVA 4WQMA 1C3TA 2GBNA 3VHTC 1Q1OA 2N9XA 2V1YA 3ZYYX 1SE9A 3HHMA 3GZNI 3SR6A 3OWEB 3AE6B 1I4QA 2K6DB 2LHDA 5D6JB 3VQIA 4DHJD 1PDXA 4DHZE 1KLGD 4W9CA 4I6NB 2L3ZA 2ONQA 2DAJA 1XD3B 3OJ3A 5D2MB 3ZUNA 4GOCA 3NHEB 3N30A 4JIOU 1HQRD 1UBIA 2J4XA 3RMKC 1CMXB 2MW5A 3TCAA 2N9EB 4OHJA 4AP4C 5FK9C 3SD5A 4IC7B 3C19A 1FCLA 2ZCCA 4KKJA 3HM6X 1ZE3D 1U4AA 4YXDB 3EUB2 2J53A 1T5XD 2VRRB 3NOBA 2DENB 3H9DA 3UGBB 1D5ZC 1FM0D 4TUUA 4HPLB 1MI0A 1WJNA 4XC2A 4KIKA 1L6VA 3Q2AC 1QLBB 2KC1A 2WLBA 4CHKA 2L52A 2DYOA 1DGJA 2L0FA 2PTLA 2WXJA 4RM9A 1Q0WB 4RMAA 4P7IA 3DOWA 4FADA 3PS6A 1R7SA 1KM7A 1WMHA 3EECA 3P4SB 2DAFA 3EGRA 3MJ5A 4USAA 2KACA 3L17A 1WGHA 1QZEA 1SJHD 2D07B 2H88B 2NPTB 3DBRB 2JWUA 5G5HA 2PE9A 3N3KB 4C4VA 3PGEA 3KUZA 2AYOB 1SIFA 3RPFC 1SB3C 3IVFA 3HVZA 5DPRA 3UIOB 1T0RC 3H1UA 4P1CC 1GPXA 1UGJA 4II3B 2L76A 3PZ7A 1CQVA 2NMQA 2SEBD 1JALA 1J19A 3KUCB 3ZTDA 3EHVA 2A5UA 2PIAA 1P7EA 1IGDA 3VDZA 1WY8A 3DBLI 1WE7A 4LJPB 2Y5PA 4RGOS 2FIFA 2GLSA 4EOYA 2WDVB 3A4SC 3OG5A 2G4SA 4L23A 1EM7A 1SE4A 3A1QB 3IT4B 3RZWC 1DYQA 2DBYA 5E6OA 1V2YA 2LWPA 4XWWA 5HG2A 2J0JA 1QOGA 3VR9B 1UD7A 1AW7A 3J9CA 5TR5A 1T0YA 2BS2B 4GGQA 3DVGY 1HEZE 1SE3A 3BINA 2FBWB 1V1OA 1HE8A 4MM3B 1EO6A 4RCOA 2R2QA 2IZVB 1DOIA 1GC6A 3VUXA 2D10A 2DLBA 4OVZA 3LB8C 4US8A 2ON8A 4R3DA 2QHOA 3FAHA 1TTNA 4HEA1 3AECB 1WGKA 2WHIA 3UIPB 2NBWB 2K22A 2G45B 1QOFA 1V86A 2JF5A 2NBUA 4IDIA 2MCNB 2G9HD 2NTTA 3RN9C 3SFDB 1SBBB 1ZGUB 1VCBA 2PMVA 5IN7A 5BMHA 5GMVA 1I7HA 2RD0A 2V9HA 2EELA 4DQOC 4KGRA 1I35A 4N58A 5MPOA 4P16A 3DWMA 3NVWA 3M95A 1WF9A 3N1ZC 2K9XA 2D5GA 1PFDA 1K8RB 2XBBC 4RNAA 5G2NA 1OEYA 4LCDE 2IYDB 4C7ZA 3ONSA 2LVOA 3BK2A 3EA6A 3TEYA 2MJDA 2NPTA 1OGWA 4XZ4A 2LMCA 2ASQA 2PLPA 4GMVA 1GAQB 1TBEA 2JX5A 4IW0A 4NPNA 2IY1B 2RPQA 1P98A 3Q6BA 2PJHA 1YN5A 4K1RB 1YMHE 4LK0M 3AE2B 3HIZA 2KJHB 1V97A 3HUIA 2KLCA 2CU3A 4H2AA 4M0WB 3SEBA 2MQJA 4J3OD 5D94A 1EU4A 2KO3A 3WAPA 4DK5A 4ITKA 1FPYA 1J7BA 1NDDA 1FFUA 1NI2A 2KWDA 2DZJA 4JL9A 1L6UA 3A33B 2KHWB 1P7FA 1EWYC 4TV3A 3ZQ4A 1RM6C 2WDRB 3QJZA 3BVMA 4M8MA 4BOZB 2CU1A 4W9HA 3ENEA 3L10B 3A1QA 2KWUB 3R2TA 2WU5B 2K0PA 3M62B 2ZW1A 1T0SC 4X57B 4YTNB 1FRRA 2AQ2B 2IO1B 2CJOA 3TL5A 4FHKA 4K3BA 1Y8RC 5AZHA 2PPHA 4YSXB 1VLBA 1RLFA 4RFBA 2Z59B 2MHJA 2RR9A 3R66C 3NRZA 3URYA 4B6WA 2XNAC 3ZLZA 4MM3A 2MJEA 1TY0A 3BZDB 2DNFA 5LNK1 2IO0B 2KFKA 2QJLA 2XN9C 2ZCBA 2WXNA 4BOSC 2JRHA 1RWSA 2LJIA 1TS2A 2IBIB 1H4RA 1WGDA 1F2RC 2INPE 3A4RA 3MC8A 1OQRA 1ZW7A 2RMMA 5AUIA 1L0YB 1TKGA 5DCNA 3Q3FA 2KMCA 5D7GA 3KWVA 1OQQA 3VRAB 2PEAA 3SFEB 3WA0A 2N9LA 4EZLA 4KV2A 4ANUA 3HVDA 3BIID 3RYTA 2CHXA 1HZ5A 4S0RA 2BQQA 1SJED 3WAOA 2NS5A 1BT0A 3VR8B 1XF5L 1EU3A 1L4DB 1LGRA 4LNOA 1F0ZA 3RNBC 3VUWA 4LNKA 2Y5BB 3RNAC 3APDA 4GB9A 3VTVA 2K8HA 3IXSA 4TMAB 4EKUA 3IG3A 2YVCA 5CX3A 3ML8A 2I38A 4M0WA 4DWFA 2TSSA 1L0XB 2IDYA 1WZ3A 1C79A 2M4NA 3ALBA 1VR9A 3KQ4A 2KLGA 2C9WB 1R4MI 3PRZA 3IT6B 2N9KA 4ZYSA 4XYCA 4MH0E 4PYUA 4CQNA 5C3JB 3AU4A 2JPHA 2G4DB 1CJEA 4EE2A 5HI1A 4HDQA 4PK1A 1FNWA 1VD2A 4JLCA 5IKCM 4DXFA 1R4NB 2J0MA 1XQQA 4E3CA 4YTMB 3RNCC 1ZDVA 3H7PB 2B3AA 1YQ4B 5IA7A 2KOXA 4JX1C 2KKCA 5L95C 3JW0X 2GMIC 1C4PA 5HFYA 2VZKD 1Q5WB 1K50A 2A4ZA 3PTFC 2V4LA 2DYBA 2CS4A 1GC7A 2OHFA 1HA5A 2INDC 1C9FA 4MGIE 4KKIA 1I4XA 3PZDA 1ET6A 2RPVA 4UDUC 1S3SG 2ZW0A 3PVLA 4C00A 2N7DA 1V49A 3A9KB 4GN1A 1KJTA 2LRUA 3O65B 1OFFA 5T8IA 1MHXA 4A8XC 4XDDA 5G55A 4EFOA 3V3XA 4P6VF 2KMMA 2LGXA 2EKIA 2KANA 2JU6X 4P1BC 2AL3A 4WIPA 4ZYNA 4II2B 3M63B 1OTRB 3L0WB 3U7DA 4FHJA 3U2SC 4WWNA 4XE0A 4ANXA 1D5XC 2K8CA 1JW9D 3AE4B 4ZRIA 2WGSA 2FCMA 2V4IB 2J42A 3VAWA 1SIJA 1J7AA 4GXBA 3P63A 3RFZB 4BBNF 1IBXB 1M94A 3W1SC 1SXTA 1ENFA 2VH2A 1WMHB 3ECIA 3L4PA 2FNJB 4WURA 2MBOA 4HXDA 1FRDA 1WX8A 3CSFA 3ETRA 3TEXA 2NVUI 1KF6B 2BPSA 3ZRCA 3HRDD 1JWUD 3Q8EA 1TYGB 3IFWB 2DWQA 4WQOB 4AS1A 2KX0A 4MDKE 1MG4A 3AE5B 1FFVA 3QCAA 2LXCA 3CF6E 3RUIB 1VZ8A 3ZXVA 1UGMA 1GG3A 3PRMB 2KDFB 1C4CA 5LXIB 1E7VA 5FR3A 4WWPA 3QQ8B 2PVGC 4JQWC 3ZNID 3H7PA 3AULA 4HKZE 3DWGC 2WNMA 1STEA 4HJKA 2NTSA 1QF6A 3B2GA 3AEDB 2LGSA 2C5LC 1K52A 2ACZB 3AU5A 4OZCA 1UUPA 3KVFB 4A3OA 3P2BA 3KWLA 1JROA 1KRHA 1MHHE 1ZXIA 4JWUC 5JZEB 5AEKB 2HJ8A 4W9JA 1S1QB 1T6BX 2X38A 3A9KA 4W9DA 1JRPA 1UNSA 2LUMA 1WM3A 4B9KA 1WYGA 3AB5A 1FXTB 2IO2B 1QOAA 4NJ7A 4AJYB 1OQYA 2ZEQA 1WRDB 3AEBB 2L83A 3NZSA 5LLIA 5J2RA 2HJ1A 4MGZE 1HTOA 3WCQA 1WXSA 2J0KA 2QSDA 3E56A 2MBEA 3H6NA 3QK0A 4LNNA 2ZVOA 3N1YC 1K53A 2QEJC 4I6LB 1V1PA 2L7RA 5HKHA 2BVCA 3AM9A 1XO3A 5KHQA 1NBFC 1MVKA 2FCQA 4EZJA 1IBXA 2ZPNA 2G3QB 1E7UA 4N59A 3NS8A 3ZJVA 3UF8A 3VUYA 4M00A 3ML9A 1JQ4A 2JYTA 1QT9A 1FIQA 2KT7A 1KOTA 2CR5A 4LDTB 5GXGB 4ICVA 1WXMA 2KJ6A 1UWMA 2KVZA 2KC2A 1RRBA 2E6XA 2W55A 5CHWA 5I4DA 1RYJA 2CKHB 4JE3B 2QILA 3Q8FA 1FO4A 1V5OA 3CWIA 2MBBB 3B08A 4IM0A 4BKSA 3K9OB 1R4MB 2K6QA 4KDLB 2BS4B 2KWVB 4EEWA 3Q8BA 1JWSD 5JHBA 2LXAA 2QMTA 2K1FA 2RDHA 4ZRJA 5E6PA 2WXOA 4ZDVA 5C1ZA 2GBMA 3X23A 1R4NI 1GOZA 3AEEB 3R2IA 5CHFA 4MJSB 4N9F4 4MSMB 2WQYB 1VZ6A 3AEFB 3OJ4B 2JVCA 2BW2A 1TS4A 2MA9B 2JYEA 5D3DA 2MSED 4A90A 3U30A 2CHWA 1FD6A 2W9NA 4BVUC 1FXAA 3QA8A 3AEAB 3WAMA 4DDID 3QC8B 3L54A 3I3TB 3EFCA 2V3SA 3EC8A 5FR6A 4IUMB 3IAM1 2BF8B 4LJOB 2BYEA 4REZA 2KFKB 4GDKB 2C7HA 2HTME 2KQ7A 5H8YE 2LGIA 4GIVA 2Z0DB 4OVUA 3TSSA 4DHJB 1SF0A 3U52E 2MLBA 1ISNA 1AARA 4B0EA 3W5VB 1SSNA 1WR6E 2MRPA 3VFKA 2V0GA 5CHVC 4IWOA 2L1AA 4OVVA 2D3CA 3SU8X 1XLQA 3TMPB 3O13A 4US9A 4MACA 2GB1A 2C60A 2O6VD 2WXFA 2LEKA 2EKEC 2KZRA 3ZW3A 2Y3AA 3QARA 1E8WA 3BVZA 3SHQA 4FA6A 3V61A 4TQ1A 2BTEA 3AH7A 2N1VA 3MJWA 1IGCA 1IPGA 2LZ6A 1N6ZA 3RNGC 2KQSA 1TIFA 3V60A 3V6CB 4A9AA 1WYWB 3KH0A 4PS7A 3RI7C 5EE9A 2YLMA 1N62A 3DHHC 3CSTA 5BYSA 3PPAA 2OOBB 4FN2A 3T3OA 1JWMD 3FKYA 1TKEA 4NJCA 2LFIA 1RFKA 4KSLC 2WXLA 1J7CA 3N1XC 4MJSA 3AI5A 4KZ0A 2INNE 1WI0A 2D2QA 2XK5B 3BK1A 4RM8A 1F77A 4FBJB 3NJTA 2ZNVC 3TUOA 4C80A 4BAXA 3RZFA 4HRSA 2UYZB 3MTNB 5J17A 2KMAA 1IYFA 4G0NB 2KK8A 2IGGA 1ET9A 1WSPA 3T3NA 3DVNU 2LUEA 4NAWB 2PW9A 4GDKA 1LM8B 2BS3B 4DBGA 2AWTA 1ZKHA 1TKYA 1X1MA 3FILB 1YNTE 1F2RI 5HHDG 1E6EB 1D4BA 4YSZB 1E8YA 3KYCD 2C7MB 1ESFA 3JSVB 1TZOA 4WJQA 2DYMA 4HJGE 4BFRA 2KVRA 1FNUA 3VTWA 1KLVA 2G1EA 2WYQA 1WX7A 2KTRB 3KUDB 3ZRFA 2MWSB 4WAAA 2KXJA 3VVWB 5IO9A 5BO4B 3W9CB 4KVGB 3PLUA 1NYQA 1YX5B 1DOXA 1PYWD 3MHZA 4M01A 3CMMB 3WALA 4E74A 3NG0A 2REXA 1SGHA 4HCPB 1A70A 2NR2A 1I4HA 2J52A 3RNFC 3P4RB 1EWCA 2QIEB 2BYTA 3AE8B 4A55A 2HTHA 1PGAA 2KAJA 3KLSX 3NUHB 2MJ3A 2EMTA 1XXGA 1YN4A 3NVZA 1VJKA 3U8ZA 4ZRQA 2AX5A 2WP9B 2DX5B 5AZFA 5E6JA 4HLEA 5JHAA 4NQKE 1D6EC 2IJ0A 2XK5A 4GDLB 1UWXA 3EFUA 4ZHPA 3RNEC 1C1YB 4FXCA 1L0VB 4ANVA 3TBLD 2R61A 4NAMA 2UU7A 4M02A 4FJZA 3UI3A 2QCZA 4QAYA 4KZCA 4HKQA 4K3CA 2OJRA 1RAXA 2RDBC 1YD8U 2JXTA 3ZVVA 4J6IA 3B2FA 4ICUA 4MT5A 2KQ4X 3QWZB 4NAWA 4HVBA 3U7ZA 4A6QA 4KSKC 1HXYD 4URKA 3DVNV 3FILA 4MELA 2JZZA 1GUAB 1D5MC 1KH0A 2KDIA 2KNBA 3JSVA 4NY0A 2QDFA 3TIXA 2LGYA 2L05A 3K9PB 4WWMA 2Y5CA 4Q2JA 5H92C 3AE9B 1LXDA 2K25A 1AWDA 2KTRA 3AN1A 1QOBA 1ZP0B 5L83A 2JZ3B 2BB5A 3PLVA 3APCA 1LFDA 2BKRB 4F7ZA 4AOFA 3ZNZB 3E9SA 3LYYA 1LQBA 2IPKD 3Q14C 4WH4A 1UF0A 5KHOA 2K5PA 1A5RA 4HPPA 1BUIC 2RGFA 5EDSA 3ZO5B 2SAKA 3APFA 1QQRA 1D3ZA 4G11A 1V1PB 2FUG1 2MP2A 3S2AA 1J8CA 4W9IA 3H7SA 4JGHB 2CHZA 2GBRA 1FEHA 1V80A 2RSUA 2WXRA 4XDCA 1ZUD2 4AQ7A 1GNUA 3V05A 2FAZA 2BKFA 1JMLA 3ZJTA 3W1YA 2LVPA 2XEWA 1Z5SB 3GE8C 1WGRA 3IHPC 3B0AA 3W2DA 1XCTL 4ZRPA 5LXHA 2EMSA 5D3IB 4ARCA 4ZHOA 4ZRKA 4JPSA 1P3QU 2Z0EB 1N5XA 1N63A 4KDIC 4GDLA 4K81A 2OJWA 1OEYJ 1WRIA 2LD9A 2AQ3B 4YWGG 3P1MA 3AE1B 2LVQA 1WGGA 2I1JA 4IOIE 4S17A 2H89B 4PYZA 3UQAA 2LRWA 1FCCC 2JY6A 1Y56A 3Q69A 2M19A 1YJ1A 3PV1A 4AWJA 1IUEA 2BYFA 2KJRA 2WDTB 3AMZA 3A9JB 2GBJA 3Q3MC 5JXVA 2DZMA 4DXGA 3IAS1 3PRPB 3GE3C 1P9DU 2ZJDA 1B1ZA 3MHSD 3TEZA 3DHGC 3MFGA 2BB6A 3DBHB 4K7UA 4A20A 2YEPB 3QX1A 3MC0B 3PHXB 3UINB 3BYYB 1CZPA 2BYVE 1WR1A 1WE6A 5BYQA 4BKTA 3NZUA 2KTFA 2VZKB 2M56B 4NNJB 2FIDA 4HROA 3UQBA 1B9RA 2WXIA 2ZVNA 4YL8A 2KD0A 2FE8A 4PT5A 1UZXB 2AQ1B 2LASA 1IP9A 2WXMA 4MGYE 3OAWA 4KGSA 4K7WA 2KFJA 2WDQB 2M0XA 4FJYA 2Z8LA 2BWFA 1J0GA 3I9V1 1FMAD 1VRAB 3R3MA 2IY0B 3LDZE 5JH5C 1SEBD 2KDEB 3GP7A 1E7PB 2WXKA 1MFWA 4AJWA 1AN8A 1E9MA 2D3GA 3ZKJC 1JRUA 2JT4B 2W82A 3PZ8A 3PHWB 1QILA 4ZOHC 2DZKA 3P4PB 3QHTA 1FNVA 1F52A 3BVGA 1EF1A 2L0TA 5AZGA 3TEWA 4HPMB 1JCKB 1XLPA 2O2VB 3T8MA 1JWAD 4ANWA 1VDVA 4N6EB 1GB1A 3DHIC 2DHZA 2FCSA 3ZDTA 3NY5A 3BWUD 3Q3JA 2UWQA 1L5PA 4MSQB 4RF0A 4BBNC 2K8BA 4ASWC 2JWZA 1XEEA 1AYFA 1UH6A 2M8SA 4GSWA 1XCQL 4IM2A 1I42A 3L13A 2AL6A 1NEKB 5CTRC 2YEPF 3A9JA 3ZNHB 4YTPB 3KYDD 3P42A 2N9PC 1PGXA 2MH7A 1ZDXA 1WIAA 4IG7B 3ABVB 2WXPA 1WM2A 4XWTA 3AXCA 3MP9A 4D2KA 5AUKA 1HTQA 3RULA 3I5JC 4AUQC 4CO7A 1NI3A 4TSSA 2V3NA 1RFAA 1E8ZA 4XX5A 1JWBD 3Q8AA 3M3JA 2M17A 2MBQA 4B0MA 4DDGD 1WXAA 5TSSA 2ICIA 5IOIA 1FXIA 3VH3B 1C78A 1TS3A 3Q8CA 4C7YA 1QKZA 1MJDA 3BYTB 4F8CB 4KX6B 4OZBA 4WAFA 2M1MA 1YJJA 1P0RA 4M8NA 3KW5B 1E5WA 1TGZB 5C2TB 1KLUD 2KN5A 4NJ6A 1BXTA 2HE7A 1ACCA 3JVZX 3AE7B 3VXWA 4G50A 2KDBA 2N1WA 3HM3A 4K7SA 4L1BA 1MG8A 4HCNB 1PUTA 2LGDA 4C56C 3BY4B 3PSEB 4GU2A 2GOWA 4G3XB 3U4EG 2GBKA 2FCNA 2L32A 3GOEA 4W9KA 2HD5B 1YQ3B 5FKAC 2W54A 3NZ3A 4B95A 2O2VA 3D32A 3JYUA 2N4FA 3WIMA 4RGNA 4DHZB 1TZ1A 2KYWA 1V81A 5IP4D 1L4ZB 3ZGZA 4LNFA 3NVVA 4GLSC 1WX9A 5BYRA 3W5UB 3N20C 2K3UA 1TJEA 4W9GA 3ZTCA 4O1NA 2JUOA 2JSVX 3V62A 2KX3A 3VTUA 4EZKA 4TKNA 3AV8A 4LNIA 3I57A 4WWOA 1T0QC 2WXGA 4ACFA 3PO0A 2LI5A 1E90A 1TS5A 1YQBA 1KFYB 2D3BA 5DPTA 1TY2A 1P1AA 2WX1A 1WZ0A 3LJ3A 3GZNB 1SE2A 3DBHI 2J7QB 2PKOA 1C76A 2WU2B 1ZOYB 2N0SB 3PT2B 3ZIMA 4OZAA 3NVYA 2QC8A 3IBEA 4RGMA 1E8XA 4YSYB 3NS1A 1V8CA 3RCZA 5IAAC 1N60A 1NVID 3DDCB 4RF1A 1UELA 1F1HA 1WGYA 4FJVB 4BKGA 4L2YA 2I2YA 1I4PA 1Q10A 3Q3NC 3W1SA 4CYEA 2KN4A 1EUVB 3V6EB 2N7JA 4IKGA 2MX2A 1E0ZA 4OW0A 1GB4A 3C8YA 3HK0A 4WJOA 3C0RB 2JRIB 4FLHA 3DVGX 1V9JA 4MGKE 3OLMD 2JXXA 2MP2B 1F9JA 3B1LX 5DPWA 1XLNA 2ZZPB 1M4VA 4LTUA 1YJIA 3DQVA 3L16A 4E71A 4BKSD 2IGHA 4RGTA 1L7YA 2I1KA 2N7EA 1LO5D 3QAQA 3RD2A 1YX6B 2WS3B 1C4AA 4ARIA 5DPSA 2GRIA 1GJZA 5G5GA 2O6VB 1WH3A 2W3SA 3DBRI 3PREA 4DXAB 1PQSA 4NQLB 1T3QA 2WXHA 3I63C 1MPEA 3GB1A 3GS2A 1NENB 3QIJA 1WJUA 1K51A 3N9YC 1WJ4A 2E3TA 2X8XX 4I6PA 1YIWA 3DCGA 4PS3A 5BMGA 2PVOD 1I4GA 3FC4A 3ZJUA 4F1SA 2RDGA 4MH8A 3R7QA 2Q5WD 3H8HA 1UBQA 2L00B 4PS8A 1CK1A 2LJ5A 1C77A 2NBVB 4FULA 3WANA 3B9JA 3DBLB 2IGDA 2WXQA 4JWSC 4W9EA 2D11A 5EE0A 1L2NA 5C23A 2VH1A 1N5WA 2AEHA 3X0WA 1ZPSA 4NZLB 3CIRB 1WXQA 2NCNA 2OEDA 2FUHB 3ZXRA 4W9LA 2R2OA 3DBSA 4XGAB 3R7RA 4WJPA 2KDMA 1ROEA 1E10A 3TJPA 2MBHA 2BWES 3DPDA 2B76B 4MEMA 1EF5A 4LLGM 2PE6B 1HZ6A 4IWPA 5E6NA 2K39A 3T9LA 2HDEA 1BMLC 3RT3B 2BGFA 1Z2MA 1NYRA 2CJNA 3SDLC 1PGBA 3LXFA 4WJNA 4LDTD 4HDOA 3P4QB 2BT6A 2IO3B 2LHEA 2M0AA 5EE3A 2JQRB 2MEKA 4KIKB 4RH6A 2WX0A 1DOYA 1YOVB 1XT9B 4YT0B 1V5TA 2L8JA 1VZ7A 4KGTA 1ZXHA 2O6VA 2W3RA 2ZPYA 1V6EA 2DZIA 5BMIA 3AE3B 1XLOA 1KTKA 2BBCA 3ZDMC 3L08A 3AEGB 1G6JA 3VH4B 2INCC 5EE1A 1H8CA 4W9FA 2V3PA 1TT5B 2C7NB 4HK2A 2GI9A 3ZNGC 2JZPA 4A3PA 4C4VB 4EUTA 3Q3OC 1N61A 2KWCA 1WFYA 1I4RA
chains in the Genus database with same CATH topology
1RFKA 1XEEA 4TQ0A 1YN3A 4CQNA 1AYFA 2WXLA 5C3JB 1J7CA 1XCQL 1CJEA 4EE2A 5HI1A 3R8BA 1FNWA 2INNE 1NEKB 4DXFA 2YEPF 3BK1A 3VRBB 4YTPB 1F77A 1WWTA 3P42A 4WQMA 1PGXA 4YTMB 2MH7A 1ZDVA 1YQ4B 3TUOA 4C80A 1ZDXA 4JX1C 3ZYYX 3ABVB 2WXPA 1C4PA 3SR6A 3OWEB 5HFYA 2VZKD 3AE6B 1I4QA 2LHDA 1K50A 4XWTA 4HRSA 4D2KA 3MP9A 5AUKA 3VQIA 2IGGA 1ET9A 1WSPA 1PDXA 3T3NA 2OHFA 1KLGD 4NAWB 1HA5A 2PW9A 1NI3A 4TSSA 1C9FA 2BS3B 4KKIA 2V3NA 1I4XA 2ONQA 1JWBD 1ET6A 1TKYA 2RPVA 3Q8AA 4UDUC 3FILB 1YNTE 1F2RI 2ZW0A 5HHDG 4B0MA 1E6EB 1D4BA 4YSZB 1HQRD 2J4XA 1ESFA 1TZOA 1OFFA 2DYMA 5T8IA 4HJGE 5TSSA 2ICIA 1MHXA 4OHJA 5FK9C 1FNUA 1FXIA 1C78A 4XDDA 4A8XC 1FCLA 1TS3A 3Q8CA 3V3XA 4C7YA 4KKJA 1QKZA 4P6VF 2KMMA 2G1EA 1ZE3D 3BYTB 2EKIA 4KX6B 4OZBA 4WAFA 4YXDB 2JU6X 3EUB2 2J53A 1T5XD 4WIPA 1YJJA 5C2TB 1KLUD 1D5ZC 1BXTA 1FM0D 1ACCA 3AE7B 3W9CB 3U2SC 1MI0A 4XE0A 1L6VA 1D5XC 1QLBB 4L1BA 2WLBA 1JW9D 3AE4B 1NYQA 2L52A 2DYOA 1DOXA 1DGJA 1PUTA 1PYWD 3MHZA 2V4IB 2J42A 4C56C 2PTLA 2WXJA 1SIJA 1J7AA 3P63A 3RFZB 1A70A 1I4HA 2J52A 3P4RB 1IBXB 1EWCA 1R7SA 3U4EG 1SXTA 1ENFA 3P4SB 2QIEB 3EGRA 2BYTA 2L32A 3MJ5A 3L4PA 4WURA 4USAA 3AE8B 2KACA 1YQ3B 5FKAC 2W54A 3NZ3A 1FRDA 1SJHD 3ETRA 3TEXA 4A55A 4RGNA 1KF6B 2H88B 1PGAA 2KAJA 3KLSX 3NUHB 1L4ZB 3HRDD 2JWUA 2MJ3A 5G5HA 1JWUD 3ZGZA 3Q8EA 1TYGB 2DWQA 4AS1A 1XXGA 3NVVA 4GLSC 1YN4A 3NVZA 5BYRA 1VJKA 3AE5B 1FFVA 3RPFC 3W5UB 4ZRQA 1SB3C 2AX5A 2WP9B 2K3UA 1TJEA 3HVZA 5E6JA 1VZ8A 4O1NA 1D6EC 2JSVX 2IJ0A 1GPXA 1UGJA 4GDLB 1C4CA 1UWXA 4ZHPA 3PZ7A 5FR3A 1CQVA 2PVGC 4FXCA 1L0VB 3AV8A 2R61A 3I57A 2NMQA 4NAMA 2SEBD 1JALA 4HKZE 3DWGC 2WNMA 2WXGA 1STEA 3PO0A 1TS5A 2PIAA 1P7EA 1IGDA 2NTSA 1QF6A 3UI3A 3B2GA 3AEDB 1KFYB 2Y5PA 4RGOS 1K52A 2ACZB 4HKQA 2WDVB 1TY2A 4OZCA 1UUPA 2JXTA 4L23A 1EM7A 3B2FA 1SE4A 3KWLA 1JROA 1KRHA 1MHHE 3IT4B 4MT5A 1DYQA 2DBYA 1ZXIA 2KQ4X 3U7ZA 4A6QA 1SE2A 4JWUC 1HXYD 2PKOA 1C76A 2WU2B 4XWWA 5HG2A 1QOGA 3FILA 1ZOYB 4NJCA 3VR9B 2N0SB 1D5MC 1KH0A 1AW7A 1T6BX 2X38A 4OZAA 1JRPA 1UNSA 2LUMA 3J9CA 2BS2B 3NVYA 1HEZE 1SE3A 2FBWB 1V1OA 4RGMA 1WYGA 3AB5A 4MM3B 4YSYB 1QOAA 4RCOA 4WWMA 1DOIA 2Y5CA 4Q2JA 3AEBB 5H92C 3AE9B 2DLBA 4OVZA 2L83A 1AWDA 3LB8C 3AN1A 4US8A 2ON8A 4R3DA 1QOBA 3NS1A 1ZP0B 1V8CA 3FAHA 2BB5A 4HEA1 3AECB 1N60A 1NVID 1WGKA 4RF1A 2K22A 3E9SA 1QOFA 4IDIA 3LYYA 3WCQA 2IPKD 4L2YA 4WH4A 2QSDA 3E56A 2I2YA 2K5PA 1BUIC 1I4PA 1Q10A 2G9HD 3W1SA 2KN4A 1K53A 2NTTA 2QEJC 2N7JA 2SAKA 3SFDB 1SBBB 4IKGA 2PMVA 1V1PA 1E0ZA 1QQRA 3AM9A 5BMHA 4OW0A 1V1PB 1XO3A 1GB4A 1I7HA 2FUG1 3C8YA 2EELA 1MVKA 4DQOC 4KGRA 1IBXA 4N58A 5MPOA 4P16A 4N59A 3DWMA 3NVWA 3ZJVA 2K9XA 1FEHA 2D5GA 1PFDA 2WXRA 4XDCA 1JQ4A 1XLNA 4RNAA 1ZUD2 2JYTA 4AQ7A 1M4VA 4LTUA 1QT9A 3V05A 1FIQA 1YJIA 4C7ZA 3BK2A 3EA6A 3TEYA 5GXGB 2IGHA 2MJDA 4RGTA 2LMCA 1JMLA 1UWMA 3ZJTA 1LO5D 2E6XA 2W55A 2PLPA 1GAQB 5I4DA 2WS3B 1C4AA 1RYJA 4JE3B 4ARIA 2QILA 2JX5A 3Q8FA 2GRIA 3W2DA 1FO4A 1XCTL 4ZRPA 5G5GA 5D3IB 4ARCA 3CWIA 1YN5A 4ZHOA 1YMHE 4LK0M 2W3SA 3AE2B 4JPSA 1T3QA 2WXHA 2BS4B 1V97A 3HUIA 1N5XA 2CU3A 1MPEA 1N63A 3GB1A 4H2AA 3SEBA 3GS2A 1NENB 4J3OD 1EU4A 1WRIA 3Q8BA 2AQ3B 4YWGG 3P1MA 4ITKA 1JWSD 3AE1B 1K51A 3N9YC 2E3TA 2QMTA 2RDHA 4IOIE 1J7BA 2KWDA 1FFUA 2WXOA 2H89B 1L6UA 1P7FA 1EWYC 1FCCC 5BMGA 1Y56A 2PVOD 1I4GA 3FC4A 3Q69A 3ZJUA 3ZQ4A 2M19A 2RDGA 1RM6C 1GOZA 2WDRB 4MH8A 3BVMA 3AEEB 3R2IA 2Q5WD 3H8HA 1CK1A 1IUEA 1C77A 3R2TA 3B9JA 2WU5B 2K0PA 3AMZA 2ZW1A 2IGDA 2WQYB 4YTNB 1VZ6A 5JXVA 3AEFB 1FRRA 2AQ2B 2WXQA 4JWSC 2BW2A 1TS4A 2CJOA 4DXGA 3IAS1 5EE0A 2JYEA 5D3DA 1B1ZA 3TEZA 3MFGA 1N5WA 4A90A 4YSXB 2BB6A 1VLBA 1FD6A 1ZPSA 4NZLB 3CIRB 1WXQA 1FXAA 2YEPB 3AEAB 4RFBA 3NRZA 2OEDA 3URYA 2XNAC 3MC0B 2MJEA 1TY0A 3BZDB 5LNK1 3BYYB 1CZPA 3IAM1 2QJLA 2XN9C 5BYQA 4REZA 4GDKB 2KDMA 1ROEA 2WXNA 2HTME 2VZKB 5H8YE 1E10A 2M56B 4HROA 1RWSA 2LJIA 2LGIA 1TS2A 1B9RA 1F2RC 2INPE 2WXIA 3TSSA 1OQRA 2FE8A 4PT5A 2B76B 2RMMA 5AUIA 1L0YB 1TKGA 2AQ1B 4LLGM 5D7GA 3KWVA 1HZ6A 1OQQA 1SF0A 3VRAB 2WXMA 3U52E 4KGSA 2HDEA 2WDQB 1BMLC 3SFEB 4B0EA 2Z8LA 2N9LA 2CJNA 1NYRA 3W5VB 1SSNA 1PGBA 3LXFA 2V0GA 3I9V1 1FMAD 2L1AA 3HVDA 3BIID 3P4QB 1HZ5A 1VRAB 1SEBD 2BT6A 1SJED 1XLQA 3GP7A 2M0AA 1E7PB 2LHEA 2WXKA 5EE3A 3O13A 4US9A 2JQRB 4MACA 3VR8B 2MEKA 1AN8A 2GB1A 1XF5L 2WXFA 4RH6A 1EU3A 2LEKA 1E9MA 1L4DB 1F0ZA 2Y3AA 2W82A 1DOYA 3PZ8A 4YT0B 1QILA 4ZOHC 3BVZA 3P4PB 1VZ7A 4KGTA 1ZXHA 2W3RA 3IXSA 1FNVA 4TMAB 3BVGA 5BMIA 3AE3B 4TQ1A 2BTEA 1XLOA 1KTKA 3TEWA 3AH7A 1JCKB 2BBCA 1IGCA 3AEGB 2I38A 4M0WA 1XLPA 2TSSA 4A9AA 1L0XB 2IDYA 1JWAD 5EE9A 1VDVA 4N6EB 1N62A 5EE1A 1C79A 2V3PA 1VR9A 5BYSA 3KQ4A 1GB1A 2GI9A 3IT6B 2JZPA 3T3OA 1JWMD 3BWUD 2N9KA 4ZYSA 1L5PA 1N61A 1TKEA 4RF0A 1I4RA 2LFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WH4 A;  2KAC A;  1XCQ L;  2OED A;  2QSD A;  2I2Y A;  5HI1 A;  1Q10 A;  2KN4 A;  1K53 A;  2N7J A;  4IKG A;  1PGA A;  5BMH A;  1GB4 A;  2EEL A;  1PGX A;  2JWU A;  1MVK A;  2KDM A;  4KGR A;  1IBX A;  2LGI A;  4GLS C;  1F2R C;  5HFY A;  2RMM A;  2LHD A;  1K50 A;  4D2K A;  3MP9 A;  1HZ6 A;  2JSV X;  4KGS A;  2IGH A;  1UWX A;  2IGG A;  1JML A;  2N9L A;  2PW9 A;  1PGB A;  1C9F A;  2PLP A;  2NMQ A;  2ONQ A;  2RPV A;  4HKZ E;  3FIL B;  1HZ5 A;  1XCT L;  1P7E A;  1IGD A;  1F2R I;  1YNT E;  2ZW0 A;  3UI3 A;  5HHD G;  1D4B A;  1YMH E;  1K52 A;  2LHE A;  4OZC A;  4MAC A;  2JXT A;  1MPE A;  3GB1 A;  2GB1 A;  4HJG E;  1XF5 L;  1EM7 A;  1MHX A;  1MHH E;  2KQ4 X;  1FCL A;  1K51 A;  3V3X A;  1QKZ A;  2QMT A;  4IOI E;  5HG2 A;  2KWD A;  4OZB A;  2JU6 X;  3FIL A;  2J53 A;  4KGT A;  1P7F A;  1ZXH A;  1FCC C;  5BMG A;  1KH0 A;  4OZA A;  5BMI A;  2LUM A;  1HEZ E;  1IGC A;  1MI0 A;  2I38 A;  2K0P A;  2ZW1 A;  2IGD A;  5JXV A;  2PTL A;  2ON8 A;  1GB1 A;  2GI9 A;  2JZP A;  2J52 A;  1IBX B;  2N9K A;  1FD6 A; 
#chains in the Genus database with same CATH topology
 2WWZ A;  1YN3 A;  4TQ0 A;  2ZNV B;  5J18 A;  4IM3 A;  3MC9 A;  2D3A A;  3N32 A;  4HWI B;  3R8B A;  1WJ6 A;  4IWQ A;  3VRB B;  4BZA A;  1WWT A;  1WXV A;  4WQM A;  1C3T A;  2GBN A;  3VHT C;  1Q1O A;  2N9X A;  2V1Y A;  3ZYY X;  1SE9 A;  3HHM A;  3GZN I;  3SR6 A;  3OWE B;  3AE6 B;  1I4Q A;  2K6D B;  2LHD A;  5D6J B;  3VQI A;  4DHJ D;  1PDX A;  4DHZ E;  1KLG D;  4W9C A;  4I6N B;  2L3Z A;  2ONQ A;  2DAJ A;  1XD3 B;  3OJ3 A;  5D2M B;  3ZUN A;  4GOC A;  3NHE B;  3N30 A;  4JIO U;  1HQR D;  1UBI A;  2J4X A;  3RMK C;  1CMX B;  2MW5 A;  3TCA A;  2N9E B;  4OHJ A;  4AP4 C;  5FK9 C;  3SD5 A;  4IC7 B;  3C19 A;  1FCL A;  2ZCC A;  4KKJ A;  3HM6 X;  1ZE3 D;  1U4A A;  4YXD B;  3EUB 2;  2J53 A;  1T5X D;  2VRR B;  3NOB A;  2DEN B;  3H9D A;  3UGB B;  1D5Z C;  1FM0 D;  4TUU A;  4HPL B;  1MI0 A;  1WJN A;  4XC2 A;  4KIK A;  1L6V A;  3Q2A C;  1QLB B;  2KC1 A;  2WLB A;  4CHK A;  2L52 A;  2DYO A;  1DGJ A;  2L0F A;  2PTL A;  2WXJ A;  4RM9 A;  1Q0W B;  4RMA A;  4P7I A;  3DOW A;  4FAD A;  3PS6 A;  1R7S A;  1KM7 A;  1WMH A;  3EEC A;  3P4S B;  2DAF A;  3EGR A;  3MJ5 A;  4USA A;  2KAC A;  3L17 A;  1WGH A;  1QZE A;  1SJH D;  2D07 B;  2H88 B;  2NPT B;  3DBR B;  2JWU A;  5G5H A;  2PE9 A;  3N3K B;  4C4V A;  3PGE A;  3KUZ A;  2AYO B;  1SIF A;  3RPF C;  1SB3 C;  3IVF A;  3HVZ A;  5DPR A;  3UIO B;  1T0R C;  3H1U A;  4P1C C;  1GPX A;  1UGJ A;  4II3 B;  2L76 A;  3PZ7 A;  1CQV A;  2NMQ A;  2SEB D;  1JAL A;  1J19 A;  3KUC B;  3ZTD A;  3EHV A;  2A5U A;  2PIA A;  1P7E A;  1IGD A;  3VDZ A;  1WY8 A;  3DBL I;  1WE7 A;  4LJP B;  2Y5P A;  4RGO S;  2FIF A;  2GLS A;  4EOY A;  2WDV B;  3A4S C;  3OG5 A;  2G4S A;  4L23 A;  1EM7 A;  1SE4 A;  3A1Q B;  3IT4 B;  3RZW C;  1DYQ A;  2DBY A;  5E6O A;  1V2Y A;  2LWP A;  4XWW A;  5HG2 A;  2J0J A;  1QOG A;  3VR9 B;  1UD7 A;  1AW7 A;  3J9C A;  5TR5 A;  1T0Y A;  2BS2 B;  4GGQ A;  3DVG Y;  1HEZ E;  1SE3 A;  3BIN A;  2FBW B;  1V1O A;  1HE8 A;  4MM3 B;  1EO6 A;  4RCO A;  2R2Q A;  2IZV B;  1DOI A;  1GC6 A;  3VUX A;  2D10 A;  2DLB A;  4OVZ A;  3LB8 C;  4US8 A;  2ON8 A;  4R3D A;  2QHO A;  3FAH A;  1TTN A;  4HEA 1;  3AEC B;  1WGK A;  2WHI A;  3UIP B;  2NBW B;  2K22 A;  2G45 B;  1QOF A;  1V86 A;  2JF5 A;  2NBU A;  4IDI A;  2MCN B;  2G9H D;  2NTT A;  3RN9 C;  3SFD B;  1SBB B;  1ZGU B;  1VCB A;  2PMV A;  5IN7 A;  5BMH A;  5GMV A;  1I7H A;  2RD0 A;  2V9H A;  2EEL A;  4DQO C;  4KGR A;  1I35 A;  4N58 A;  5MPO A;  4P16 A;  3DWM A;  3NVW A;  3M95 A;  1WF9 A;  3N1Z C;  2K9X A;  2D5G A;  1PFD A;  1K8R B;  2XBB C;  4RNA A;  5G2N A;  1OEY A;  4LCD E;  2IYD B;  4C7Z A;  3ONS A;  2LVO A;  3BK2 A;  3EA6 A;  3TEY A;  2MJD A;  2NPT A;  1OGW A;  4XZ4 A;  2LMC A;  2ASQ A;  2PLP A;  4GMV A;  1GAQ B;  1TBE A;  2JX5 A;  4IW0 A;  4NPN A;  2IY1 B;  2RPQ A;  1P98 A;  3Q6B A;  2PJH A;  1YN5 A;  4K1R B;  1YMH E;  4LK0 M;  3AE2 B;  3HIZ A;  2KJH B;  1V97 A;  3HUI A;  2KLC A;  2CU3 A;  4H2A A;  4M0W B;  3SEB A;  2MQJ A;  4J3O D;  5D94 A;  1EU4 A;  2KO3 A;  3WAP A;  4DK5 A;  4ITK A;  1FPY A;  1J7B A;  1NDD A;  1FFU A;  1NI2 A;  2KWD A;  2DZJ A;  4JL9 A;  1L6U A;  3A33 B;  2KHW B;  1P7F A;  1EWY C;  4TV3 A;  3ZQ4 A;  1RM6 C;  2WDR B;  3QJZ A;  3BVM A;  4M8M A;  4BOZ B;  2CU1 A;  4W9H A;  3ENE A;  3L10 B;  3A1Q A;  2KWU B;  3R2T A;  2WU5 B;  2K0P A;  3M62 B;  2ZW1 A;  1T0S C;  4X57 B;  4YTN B;  1FRR A;  2AQ2 B;  2IO1 B;  2CJO A;  3TL5 A;  4FHK A;  4K3B A;  1Y8R C;  5AZH A;  2PPH A;  4YSX B;  1VLB A;  1RLF A;  4RFB A;  2Z59 B;  2MHJ A;  2RR9 A;  3R66 C;  3NRZ A;  3URY A;  4B6W A;  2XNA C;  3ZLZ A;  4MM3 A;  2MJE A;  1TY0 A;  3BZD B;  2DNF A;  5LNK 1;  2IO0 B;  2KFK A;  2QJL A;  2XN9 C;  2ZCB A;  2WXN A;  4BOS C;  2JRH A;  1RWS A;  2LJI A;  1TS2 A;  2IBI B;  1H4R A;  1WGD A;  1F2R C;  2INP E;  3A4R A;  3MC8 A;  1OQR A;  1ZW7 A;  2RMM A;  5AUI A;  1L0Y B;  1TKG A;  5DCN A;  3Q3F A;  2KMC A;  5D7G A;  3KWV A;  1OQQ A;  3VRA B;  2PEA A;  3SFE B;  3WA0 A;  2N9L A;  4EZL A;  4KV2 A;  4ANU A;  3HVD A;  3BII D;  3RYT A;  2CHX A;  1HZ5 A;  4S0R A;  2BQQ A;  1SJE D;  3WAO A;  2NS5 A;  1BT0 A;  3VR8 B;  1XF5 L;  1EU3 A;  1L4D B;  1LGR A;  4LNO A;  1F0Z A;  3RNB C;  3VUW A;  4LNK A;  2Y5B B;  3RNA C;  3APD A;  4GB9 A;  3VTV A;  2K8H A;  3IXS A;  4TMA B;  4EKU A;  3IG3 A;  2YVC A;  5CX3 A;  3ML8 A;  2I38 A;  4M0W A;  4DWF A;  2TSS A;  1L0X B;  2IDY A;  1WZ3 A;  1C79 A;  2M4N A;  3ALB A;  1VR9 A;  3KQ4 A;  2KLG A;  2C9W B;  1R4M I;  3PRZ A;  3IT6 B;  2N9K A;  4ZYS A;  4XYC A;  4MH0 E;  4PYU A;  4CQN A;  5C3J B;  3AU4 A;  2JPH A;  2G4D B;  1CJE A;  4EE2 A;  5HI1 A;  4HDQ A;  4PK1 A;  1FNW A;  1VD2 A;  4JLC A;  5IKC M;  4DXF A;  1R4N B;  2J0M A;  1XQQ A;  4E3C A;  4YTM B;  3RNC C;  1ZDV A;  3H7P B;  2B3A A;  1YQ4 B;  5IA7 A;  2KOX A;  4JX1 C;  2KKC A;  5L95 C;  3JW0 X;  2GMI C;  1C4P A;  5HFY A;  2VZK D;  1Q5W B;  1K50 A;  2A4Z A;  3PTF C;  2V4L A;  2DYB A;  2CS4 A;  1GC7 A;  2OHF A;  1HA5 A;  2IND C;  1C9F A;  4MGI E;  4KKI A;  1I4X A;  3PZD A;  1ET6 A;  2RPV A;  4UDU C;  1S3S G;  2ZW0 A;  3PVL A;  4C00 A;  2N7D A;  1V49 A;  3A9K B;  4GN1 A;  1KJT A;  2LRU A;  3O65 B;  1OFF A;  5T8I A;  1MHX A;  4A8X C;  4XDD A;  5G55 A;  4EFO A;  3V3X A;  4P6V F;  2KMM A;  2LGX A;  2EKI A;  2KAN A;  2JU6 X;  4P1B C;  2AL3 A;  4WIP A;  4ZYN A;  4II2 B;  3M63 B;  1OTR B;  3L0W B;  3U7D A;  4FHJ A;  3U2S C;  4WWN A;  4XE0 A;  4ANX A;  1D5X C;  2K8C A;  1JW9 D;  3AE4 B;  4ZRI A;  2WGS A;  2FCM A;  2V4I B;  2J42 A;  3VAW A;  1SIJ A;  1J7A A;  4GXB A;  3P63 A;  3RFZ B;  4BBN F;  1IBX B;  1M94 A;  3W1S C;  1SXT A;  1ENF A;  2VH2 A;  1WMH B;  3ECI A;  3L4P A;  2FNJ B;  4WUR A;  2MBO A;  4HXD A;  1FRD A;  1WX8 A;  3CSF A;  3ETR A;  3TEX A;  2NVU I;  1KF6 B;  2BPS A;  3ZRC A;  3HRD D;  1JWU D;  3Q8E A;  1TYG B;  3IFW B;  2DWQ A;  4WQO B;  4AS1 A;  2KX0 A;  4MDK E;  1MG4 A;  3AE5 B;  1FFV A;  3QCA A;  2LXC A;  3CF6 E;  3RUI B;  1VZ8 A;  3ZXV A;  1UGM A;  1GG3 A;  3PRM B;  2KDF B;  1C4C A;  5LXI B;  1E7V A;  5FR3 A;  4WWP A;  3QQ8 B;  2PVG C;  4JQW C;  3ZNI D;  3H7P A;  3AUL A;  4HKZ E;  3DWG C;  2WNM A;  1STE A;  4HJK A;  2NTS A;  1QF6 A;  3B2G A;  3AED B;  2LGS A;  2C5L C;  1K52 A;  2ACZ B;  3AU5 A;  4OZC A;  1UUP A;  3KVF B;  4A3O A;  3P2B A;  3KWL A;  1JRO A;  1KRH A;  1MHH E;  1ZXI A;  4JWU C;  5JZE B;  5AEK B;  2HJ8 A;  4W9J A;  1S1Q B;  1T6B X;  2X38 A;  3A9K A;  4W9D A;  1JRP A;  1UNS A;  2LUM A;  1WM3 A;  4B9K A;  1WYG A;  3AB5 A;  1FXT B;  2IO2 B;  1QOA A;  4NJ7 A;  4AJY B;  1OQY A;  2ZEQ A;  1WRD B;  3AEB B;  2L83 A;  3NZS A;  5LLI A;  5J2R A;  2HJ1 A;  4MGZ E;  1HTO A;  3WCQ A;  1WXS A;  2J0K A;  2QSD A;  3E56 A;  2MBE A;  3H6N A;  3QK0 A;  4LNN A;  2ZVO A;  3N1Y C;  1K53 A;  2QEJ C;  4I6L B;  1V1P A;  2L7R A;  5HKH A;  2BVC A;  3AM9 A;  1XO3 A;  5KHQ A;  1NBF C;  1MVK A;  2FCQ A;  4EZJ A;  1IBX A;  2ZPN A;  2G3Q B;  1E7U A;  4N59 A;  3NS8 A;  3ZJV A;  3UF8 A;  3VUY A;  4M00 A;  3ML9 A;  1JQ4 A;  2JYT A;  1QT9 A;  1FIQ A;  2KT7 A;  1KOT A;  2CR5 A;  4LDT B;  5GXG B;  4ICV A;  1WXM A;  2KJ6 A;  1UWM A;  2KVZ A;  2KC2 A;  1RRB A;  2E6X A;  2W55 A;  5CHW A;  5I4D A;  1RYJ A;  2CKH B;  4JE3 B;  2QIL A;  3Q8F A;  1FO4 A;  1V5O A;  3CWI A;  2MBB B;  3B08 A;  4IM0 A;  4BKS A;  3K9O B;  1R4M B;  2K6Q A;  4KDL B;  2BS4 B;  2KWV B;  4EEW A;  3Q8B A;  1JWS D;  5JHB A;  2LXA A;  2QMT A;  2K1F A;  2RDH A;  4ZRJ A;  5E6P A;  2WXO A;  4ZDV A;  5C1Z A;  2GBM A;  3X23 A;  1R4N I;  1GOZ A;  3AEE B;  3R2I A;  5CHF A;  4MJS B;  4N9F 4;  4MSM B;  2WQY B;  1VZ6 A;  3AEF B;  3OJ4 B;  2JVC A;  2BW2 A;  1TS4 A;  2MA9 B;  2JYE A;  5D3D A;  2MSE D;  4A90 A;  3U30 A;  2CHW A;  1FD6 A;  2W9N A;  4BVU C;  1FXA A;  3QA8 A;  3AEA B;  3WAM A;  4DDI D;  3QC8 B;  3L54 A;  3I3T B;  3EFC A;  2V3S A;  3EC8 A;  5FR6 A;  4IUM B;  3IAM 1;  2BF8 B;  4LJO B;  2BYE A;  4REZ A;  2KFK B;  4GDK B;  2C7H A;  2HTM E;  2KQ7 A;  5H8Y E;  2LGI A;  4GIV A;  2Z0D B;  4OVU A;  3TSS A;  4DHJ B;  1SF0 A;  3U52 E;  2MLB A;  1ISN A;  1AAR A;  4B0E A;  3W5V B;  1SSN A;  1WR6 E;  2MRP A;  3VFK A;  2V0G A;  5CHV C;  4IWO A;  2L1A A;  4OVV A;  2D3C A;  3SU8 X;  1XLQ A;  3TMP B;  3O13 A;  4US9 A;  4MAC A;  2GB1 A;  2C60 A;  2O6V D;  2WXF A;  2LEK A;  2EKE C;  2KZR A;  3ZW3 A;  2Y3A A;  3QAR A;  1E8W A;  3BVZ A;  3SHQ A;  4FA6 A;  3V61 A;  4TQ1 A;  2BTE A;  3AH7 A;  2N1V A;  3MJW A;  1IGC A;  1IPG A;  2LZ6 A;  1N6Z A;  3RNG C;  2KQS A;  1TIF A;  3V60 A;  3V6C B;  4A9A A;  1WYW B;  3KH0 A;  4PS7 A;  3RI7 C;  5EE9 A;  2YLM A;  1N62 A;  3DHH C;  3CST A;  5BYS A;  3PPA A;  2OOB B;  4FN2 A;  3T3O A;  1JWM D;  3FKY A;  1TKE A;  4NJC A;  2LFI A;  1RFK A;  4KSL C;  2WXL A;  1J7C A;  3N1X C;  4MJS A;  3AI5 A;  4KZ0 A;  2INN E;  1WI0 A;  2D2Q A;  2XK5 B;  3BK1 A;  4RM8 A;  1F77 A;  4FBJ B;  3NJT A;  2ZNV C;  3TUO A;  4C80 A;  4BAX A;  3RZF A;  4HRS A;  2UYZ B;  3MTN B;  5J17 A;  2KMA A;  1IYF A;  4G0N B;  2KK8 A;  2IGG A;  1ET9 A;  1WSP A;  3T3N A;  3DVN U;  2LUE A;  4NAW B;  2PW9 A;  4GDK A;  1LM8 B;  2BS3 B;  4DBG A;  2AWT A;  1ZKH A;  1TKY A;  1X1M A;  3FIL B;  1YNT E;  1F2R I;  5HHD G;  1E6E B;  1D4B A;  4YSZ B;  1E8Y A;  3KYC D;  2C7M B;  1ESF A;  3JSV B;  1TZO A;  4WJQ A;  2DYM A;  4HJG E;  4BFR A;  2KVR A;  1FNU A;  3VTW A;  1KLV A;  2G1E A;  2WYQ A;  1WX7 A;  2KTR B;  3KUD B;  3ZRF A;  2MWS B;  4WAA A;  2KXJ A;  3VVW B;  5IO9 A;  5BO4 B;  3W9C B;  4KVG B;  3PLU A;  1NYQ A;  1YX5 B;  1DOX A;  1PYW D;  3MHZ A;  4M01 A;  3CMM B;  3WAL A;  4E74 A;  3NG0 A;  2REX A;  1SGH A;  4HCP B;  1A70 A;  2NR2 A;  1I4H A;  2J52 A;  3RNF C;  3P4R B;  1EWC A;  2QIE B;  2BYT A;  3AE8 B;  4A55 A;  2HTH A;  1PGA A;  2KAJ A;  3KLS X;  3NUH B;  2MJ3 A;  2EMT A;  1XXG A;  1YN4 A;  3NVZ A;  1VJK A;  3U8Z A;  4ZRQ A;  2AX5 A;  2WP9 B;  2DX5 B;  5AZF A;  5E6J A;  4HLE A;  5JHA A;  4NQK E;  1D6E C;  2IJ0 A;  2XK5 A;  4GDL B;  1UWX A;  3EFU A;  4ZHP A;  3RNE C;  1C1Y B;  4FXC A;  1L0V B;  4ANV A;  3TBL D;  2R61 A;  4NAM A;  2UU7 A;  4M02 A;  4FJZ A;  3UI3 A;  2QCZ A;  4QAY A;  4KZC A;  4HKQ A;  4K3C A;  2OJR A;  1RAX A;  2RDB C;  1YD8 U;  2JXT A;  3ZVV A;  4J6I A;  3B2F A;  4ICU A;  4MT5 A;  2KQ4 X;  3QWZ B;  4NAW A;  4HVB A;  3U7Z A;  4A6Q A;  4KSK C;  1HXY D;  4URK A;  3DVN V;  3FIL A;  4MEL A;  2JZZ A;  1GUA B;  1D5M C;  1KH0 A;  2KDI A;  2KNB A;  3JSV A;  4NY0 A;  2QDF A;  3TIX A;  2LGY A;  2L05 A;  3K9P B;  4WWM A;  2Y5C A;  4Q2J A;  5H92 C;  3AE9 B;  1LXD A;  2K25 A;  1AWD A;  2KTR A;  3AN1 A;  1QOB A;  1ZP0 B;  5L83 A;  2JZ3 B;  2BB5 A;  3PLV A;  3APC A;  1LFD A;  2BKR B;  4F7Z A;  4AOF A;  3ZNZ B;  3E9S A;  3LYY A;  1LQB A;  2IPK D;  3Q14 C;  4WH4 A;  1UF0 A;  5KHO A;  2K5P A;  1A5R A;  4HPP A;  1BUI C;  2RGF A;  5EDS A;  3ZO5 B;  2SAK A;  3APF A;  1QQR A;  1D3Z A;  4G11 A;  1V1P B;  2FUG 1;  2MP2 A;  3S2A A;  1J8C A;  4W9I A;  3H7S A;  4JGH B;  2CHZ A;  2GBR A;  1FEH A;  1V80 A;  2RSU A;  2WXR A;  4XDC A;  1ZUD 2;  4AQ7 A;  1GNU A;  3V05 A;  2FAZ A;  2BKF A;  1JML A;  3ZJT A;  3W1Y A;  2LVP A;  2XEW A;  1Z5S B;  3GE8 C;  1WGR A;  3IHP C;  3B0A A;  3W2D A;  1XCT L;  4ZRP A;  5LXH A;  2EMS A;  5D3I B;  4ARC A;  4ZHO A;  4ZRK A;  4JPS A;  1P3Q U;  2Z0E B;  1N5X A;  1N63 A;  4KDI C;  4GDL A;  4K81 A;  2OJW A;  1OEY J;  1WRI A;  2LD9 A;  2AQ3 B;  4YWG G;  3P1M A;  3AE1 B;  2LVQ A;  1WGG A;  2I1J A;  4IOI E;  4S17 A;  2H89 B;  4PYZ A;  3UQA A;  2LRW A;  1FCC C;  2JY6 A;  1Y56 A;  3Q69 A;  2M19 A;  1YJ1 A;  3PV1 A;  4AWJ A;  1IUE A;  2BYF A;  2KJR A;  2WDT B;  3AMZ A;  3A9J B;  2GBJ A;  3Q3M C;  5JXV A;  2DZM A;  4DXG A;  3IAS 1;  3PRP B;  3GE3 C;  1P9D U;  2ZJD A;  1B1Z A;  3MHS D;  3TEZ A;  3DHG C;  3MFG A;  2BB6 A;  3DBH B;  4K7U A;  4A20 A;  2YEP B;  3QX1 A;  3MC0 B;  3PHX B;  3UIN B;  3BYY B;  1CZP A;  2BYV E;  1WR1 A;  1WE6 A;  5BYQ A;  4BKT A;  3NZU A;  2KTF A;  2VZK B;  2M56 B;  4NNJ B;  2FID A;  4HRO A;  3UQB A;  1B9R A;  2WXI A;  2ZVN A;  4YL8 A;  2KD0 A;  2FE8 A;  4PT5 A;  1UZX B;  2AQ1 B;  2LAS A;  1IP9 A;  2WXM A;  4MGY E;  3OAW A;  4KGS A;  4K7W A;  2KFJ A;  2WDQ B;  2M0X A;  4FJY A;  2Z8L A;  2BWF A;  1J0G A;  3I9V 1;  1FMA D;  1VRA B;  3R3M A;  2IY0 B;  3LDZ E;  5JH5 C;  1SEB D;  2KDE B;  3GP7 A;  1E7P B;  2WXK A;  1MFW A;  4AJW A;  1AN8 A;  1E9M A;  2D3G A;  3ZKJ C;  1JRU A;  2JT4 B;  2W82 A;  3PZ8 A;  3PHW B;  1QIL A;  4ZOH C;  2DZK A;  3P4P B;  3QHT A;  1FNV A;  1F52 A;  3BVG A;  1EF1 A;  2L0T A;  5AZG A;  3TEW A;  4HPM B;  1JCK B;  1XLP A;  2O2V B;  3T8M A;  1JWA D;  4ANW A;  1VDV A;  4N6E B;  1GB1 A;  3DHI C;  2DHZ A;  2FCS A;  3ZDT A;  3NY5 A;  3BWU D;  3Q3J A;  2UWQ A;  1L5P A;  4MSQ B;  4RF0 A;  4BBN C;  2K8B A;  4ASW C;  2JWZ A;  1XEE A;  1AYF A;  1UH6 A;  2M8S A;  4GSW A;  1XCQ L;  4IM2 A;  1I42 A;  3L13 A;  2AL6 A;  1NEK B;  5CTR C;  2YEP F;  3A9J A;  3ZNH B;  4YTP B;  3KYD D;  3P42 A;  2N9P C;  1PGX A;  2MH7 A;  1ZDX A;  1WIA A;  4IG7 B;  3ABV B;  2WXP A;  1WM2 A;  4XWT A;  3AXC A;  3MP9 A;  4D2K A;  5AUK A;  1HTQ A;  3RUL A;  3I5J C;  4AUQ C;  4CO7 A;  1NI3 A;  4TSS A;  2V3N A;  1RFA A;  1E8Z A;  4XX5 A;  1JWB D;  3Q8A A;  3M3J A;  2M17 A;  2MBQ A;  4B0M A;  4DDG D;  1WXA A;  5TSS A;  2ICI A;  5IOI A;  1FXI A;  3VH3 B;  1C78 A;  1TS3 A;  3Q8C A;  4C7Y A;  1QKZ A;  1MJD A;  3BYT B;  4F8C B;  4KX6 B;  4OZB A;  4WAF A;  2M1M A;  1YJJ A;  1P0R A;  4M8N A;  3KW5 B;  1E5W A;  1TGZ B;  5C2T B;  1KLU D;  2KN5 A;  4NJ6 A;  1BXT A;  2HE7 A;  1ACC A;  3JVZ X;  3AE7 B;  3VXW A;  4G50 A;  2KDB A;  2N1W A;  3HM3 A;  4K7S A;  4L1B A;  1MG8 A;  4HCN B;  1PUT A;  2LGD A;  4C56 C;  3BY4 B;  3PSE B;  4GU2 A;  2GOW A;  4G3X B;  3U4E G;  2GBK A;  2FCN A;  2L32 A;  3GOE A;  4W9K A;  2HD5 B;  1YQ3 B;  5FKA C;  2W54 A;  3NZ3 A;  4B95 A;  2O2V A;  3D32 A;  3JYU A;  2N4F A;  3WIM A;  4RGN A;  4DHZ B;  1TZ1 A;  2KYW A;  1V81 A;  5IP4 D;  1L4Z B;  3ZGZ A;  4LNF A;  3NVV A;  4GLS C;  1WX9 A;  5BYR A;  3W5U B;  3N20 C;  2K3U A;  1TJE A;  4W9G A;  3ZTC A;  4O1N A;  2JUO A;  2JSV X;  3V62 A;  2KX3 A;  3VTU A;  4EZK A;  4TKN A;  3AV8 A;  4LNI A;  3I57 A;  4WWO A;  1T0Q C;  2WXG A;  4ACF A;  3PO0 A;  2LI5 A;  1E90 A;  1TS5 A;  1YQB A;  1KFY B;  2D3B A;  5DPT A;  1TY2 A;  1P1A A;  2WX1 A;  1WZ0 A;  3LJ3 A;  3GZN B;  1SE2 A;  3DBH I;  2J7Q B;  2PKO A;  1C76 A;  2WU2 B;  1ZOY B;  2N0S B;  3PT2 B;  3ZIM A;  4OZA A;  3NVY A;  2QC8 A;  3IBE A;  4RGM A;  1E8X A;  4YSY B;  3NS1 A;  1V8C A;  3RCZ A;  5IAA C;  1N60 A;  1NVI D;  3DDC B;  4RF1 A;  1UEL A;  1F1H A;  1WGY A;  4FJV B;  4BKG A;  4L2Y A;  2I2Y A;  1I4P A;  1Q10 A;  3Q3N C;  3W1S A;  4CYE A;  2KN4 A;  1EUV B;  3V6E B;  2N7J A;  4IKG A;  2MX2 A;  1E0Z A;  4OW0 A;  1GB4 A;  3C8Y A;  3HK0 A;  4WJO A;  3C0R B;  2JRI B;  4FLH A;  3DVG X;  1V9J A;  4MGK E;  3OLM D;  2JXX A;  2MP2 B;  1F9J A;  3B1L X;  5DPW A;  1XLN A;  2ZZP B;  1M4V A;  4LTU A;  1YJI A;  3DQV A;  3L16 A;  4E71 A;  4BKS D;  2IGH A;  4RGT A;  1L7Y A;  2I1K A;  2N7E A;  1LO5 D;  3QAQ A;  3RD2 A;  1YX6 B;  2WS3 B;  1C4A A;  4ARI A;  5DPS A;  2GRI A;  1GJZ A;  5G5G A;  2O6V B;  1WH3 A;  2W3S A;  3DBR I;  3PRE A;  4DXA B;  1PQS A;  4NQL B;  1T3Q A;  2WXH A;  3I63 C;  1MPE A;  3GB1 A;  3GS2 A;  1NEN B;  3QIJ A;  1WJU A;  1K51 A;  3N9Y C;  1WJ4 A;  2E3T A;  2X8X X;  4I6P A;  1YIW A;  3DCG A;  4PS3 A;  5BMG A;  2PVO D;  1I4G A;  3FC4 A;  3ZJU A;  4F1S A;  2RDG A;  4MH8 A;  3R7Q A;  2Q5W D;  3H8H A;  1UBQ A;  2L00 B;  4PS8 A;  1CK1 A;  2LJ5 A;  1C77 A;  2NBV B;  4FUL A;  3WAN A;  3B9J A;  3DBL B;  2IGD A;  2WXQ A;  4JWS C;  4W9E A;  2D11 A;  5EE0 A;  1L2N A;  5C23 A;  2VH1 A;  1N5W A;  2AEH A;  3X0W A;  1ZPS A;  4NZL B;  3CIR B;  1WXQ A;  2NCN A;  2OED A;  2FUH B;  3ZXR A;  4W9L A;  2R2O A;  3DBS A;  4XGA B;  3R7R A;  4WJP A;  2KDM A;  1ROE A;  1E10 A;  3TJP A;  2MBH A;  2BWE S;  3DPD A;  2B76 B;  4MEM A;  1EF5 A;  4LLG M;  2PE6 B;  1HZ6 A;  4IWP A;  5E6N A;  2K39 A;  3T9L A;  2HDE A;  1BML C;  3RT3 B;  2BGF A;  1Z2M A;  1NYR A;  2CJN A;  3SDL C;  1PGB A;  3LXF A;  4WJN A;  4LDT D;  4HDO A;  3P4Q B;  2BT6 A;  2IO3 B;  2LHE A;  2M0A A;  5EE3 A;  2JQR B;  2MEK A;  4KIK B;  4RH6 A;  2WX0 A;  1DOY A;  1YOV B;  1XT9 B;  4YT0 B;  1V5T A;  2L8J A;  1VZ7 A;  4KGT A;  1ZXH A;  2O6V A;  2W3R A;  2ZPY A;  1V6E A;  2DZI A;  5BMI A;  3AE3 B;  1XLO A;  1KTK A;  2BBC A;  3ZDM C;  3L08 A;  3AEG B;  1G6J A;  3VH4 B;  2INC C;  5EE1 A;  1H8C A;  4W9F A;  2V3P A;  1TT5 B;  2C7N B;  4HK2 A;  2GI9 A;  3ZNG C;  2JZP A;  4A3P A;  4C4V B;  4EUT A;  3Q3O C;  1N61 A;  2KWC A;  1WFY A;  1I4R A; 
#chains in the Genus database with same CATH homology
 1RFK A;  1XEE A;  4TQ0 A;  1YN3 A;  4CQN A;  1AYF A;  2WXL A;  5C3J B;  1J7C A;  1XCQ L;  1CJE A;  4EE2 A;  5HI1 A;  3R8B A;  1FNW A;  2INN E;  1NEK B;  4DXF A;  2YEP F;  3BK1 A;  3VRB B;  4YTP B;  1F77 A;  1WWT A;  3P42 A;  4WQM A;  1PGX A;  4YTM B;  2MH7 A;  1ZDV A;  1YQ4 B;  3TUO A;  4C80 A;  1ZDX A;  4JX1 C;  3ZYY X;  3ABV B;  2WXP A;  1C4P A;  3SR6 A;  3OWE B;  5HFY A;  2VZK D;  3AE6 B;  1I4Q A;  2LHD A;  1K50 A;  4XWT A;  4HRS A;  4D2K A;  3MP9 A;  5AUK A;  3VQI A;  2IGG A;  1ET9 A;  1WSP A;  1PDX A;  3T3N A;  2OHF A;  1KLG D;  4NAW B;  1HA5 A;  2PW9 A;  1NI3 A;  4TSS A;  1C9F A;  2BS3 B;  4KKI A;  2V3N A;  1I4X A;  2ONQ A;  1JWB D;  1ET6 A;  1TKY A;  2RPV A;  3Q8A A;  4UDU C;  3FIL B;  1YNT E;  1F2R I;  2ZW0 A;  5HHD G;  4B0M A;  1E6E B;  1D4B A;  4YSZ B;  1HQR D;  2J4X A;  1ESF A;  1TZO A;  1OFF A;  2DYM A;  5T8I A;  4HJG E;  5TSS A;  2ICI A;  1MHX A;  4OHJ A;  5FK9 C;  1FNU A;  1FXI A;  1C78 A;  4XDD A;  4A8X C;  1FCL A;  1TS3 A;  3Q8C A;  3V3X A;  4C7Y A;  4KKJ A;  1QKZ A;  4P6V F;  2KMM A;  2G1E A;  1ZE3 D;  3BYT B;  2EKI A;  4KX6 B;  4OZB A;  4WAF A;  4YXD B;  2JU6 X;  3EUB 2;  2J53 A;  1T5X D;  4WIP A;  1YJJ A;  5C2T B;  1KLU D;  1D5Z C;  1BXT A;  1FM0 D;  1ACC A;  3AE7 B;  3W9C B;  3U2S C;  1MI0 A;  4XE0 A;  1L6V A;  1D5X C;  1QLB B;  4L1B A;  2WLB A;  1JW9 D;  3AE4 B;  1NYQ A;  2L52 A;  2DYO A;  1DOX A;  1DGJ A;  1PUT A;  1PYW D;  3MHZ A;  2V4I B;  2J42 A;  4C56 C;  2PTL A;  2WXJ A;  1SIJ A;  1J7A A;  3P63 A;  3RFZ B;  1A70 A;  1I4H A;  2J52 A;  3P4R B;  1IBX B;  1EWC A;  1R7S A;  3U4E G;  1SXT A;  1ENF A;  3P4S B;  2QIE B;  3EGR A;  2BYT A;  2L32 A;  3MJ5 A;  3L4P A;  4WUR A;  4USA A;  3AE8 B;  2KAC A;  1YQ3 B;  5FKA C;  2W54 A;  3NZ3 A;  1FRD A;  1SJH D;  3ETR A;  3TEX A;  4A55 A;  4RGN A;  1KF6 B;  2H88 B;  1PGA A;  2KAJ A;  3KLS X;  3NUH B;  1L4Z B;  3HRD D;  2JWU A;  2MJ3 A;  5G5H A;  1JWU D;  3ZGZ A;  3Q8E A;  1TYG B;  2DWQ A;  4AS1 A;  1XXG A;  3NVV A;  4GLS C;  1YN4 A;  3NVZ A;  5BYR A;  1VJK A;  3AE5 B;  1FFV A;  3RPF C;  3W5U B;  4ZRQ A;  1SB3 C;  2AX5 A;  2WP9 B;  2K3U A;  1TJE A;  3HVZ A;  5E6J A;  1VZ8 A;  4O1N A;  1D6E C;  2JSV X;  2IJ0 A;  1GPX A;  1UGJ A;  4GDL B;  1C4C A;  1UWX A;  4ZHP A;  3PZ7 A;  5FR3 A;  1CQV A;  2PVG C;  4FXC A;  1L0V B;  3AV8 A;  2R61 A;  3I57 A;  2NMQ A;  4NAM A;  2SEB D;  1JAL A;  4HKZ E;  3DWG C;  2WNM A;  2WXG A;  1STE A;  3PO0 A;  1TS5 A;  2PIA A;  1P7E A;  1IGD A;  2NTS A;  1QF6 A;  3UI3 A;  3B2G A;  3AED B;  1KFY B;  2Y5P A;  4RGO S;  1K52 A;  2ACZ B;  4HKQ A;  2WDV B;  1TY2 A;  4OZC A;  1UUP A;  2JXT A;  4L23 A;  1EM7 A;  3B2F A;  1SE4 A;  3KWL A;  1JRO A;  1KRH A;  1MHH E;  3IT4 B;  4MT5 A;  1DYQ A;  2DBY A;  1ZXI A;  2KQ4 X;  3U7Z A;  4A6Q A;  1SE2 A;  4JWU C;  1HXY D;  2PKO A;  1C76 A;  2WU2 B;  4XWW A;  5HG2 A;  1QOG A;  3FIL A;  1ZOY B;  4NJC A;  3VR9 B;  2N0S B;  1D5M C;  1KH0 A;  1AW7 A;  1T6B X;  2X38 A;  4OZA A;  1JRP A;  1UNS A;  2LUM A;  3J9C A;  2BS2 B;  3NVY A;  1HEZ E;  1SE3 A;  2FBW B;  1V1O A;  4RGM A;  1WYG A;  3AB5 A;  4MM3 B;  4YSY B;  1QOA A;  4RCO A;  4WWM A;  1DOI A;  2Y5C A;  4Q2J A;  3AEB B;  5H92 C;  3AE9 B;  2DLB A;  4OVZ A;  2L83 A;  1AWD A;  3LB8 C;  3AN1 A;  4US8 A;  2ON8 A;  4R3D A;  1QOB A;  3NS1 A;  1ZP0 B;  1V8C A;  3FAH A;  2BB5 A;  4HEA 1;  3AEC B;  1N60 A;  1NVI D;  1WGK A;  4RF1 A;  2K22 A;  3E9S A;  1QOF A;  4IDI A;  3LYY A;  3WCQ A;  2IPK D;  4L2Y A;  4WH4 A;  2QSD A;  3E56 A;  2I2Y A;  2K5P A;  1BUI C;  1I4P A;  1Q10 A;  2G9H D;  3W1S A;  2KN4 A;  1K53 A;  2NTT A;  2QEJ C;  2N7J A;  2SAK A;  3SFD B;  1SBB B;  4IKG A;  2PMV A;  1V1P A;  1E0Z A;  1QQR A;  3AM9 A;  5BMH A;  4OW0 A;  1V1P B;  1XO3 A;  1GB4 A;  1I7H A;  2FUG 1;  3C8Y A;  2EEL A;  1MVK A;  4DQO C;  4KGR A;  1IBX A;  4N58 A;  5MPO A;  4P16 A;  4N59 A;  3DWM A;  3NVW A;  3ZJV A;  2K9X A;  1FEH A;  2D5G A;  1PFD A;  2WXR A;  4XDC A;  1JQ4 A;  1XLN A;  4RNA A;  1ZUD 2;  2JYT A;  4AQ7 A;  1M4V A;  4LTU A;  1QT9 A;  3V05 A;  1FIQ A;  1YJI A;  4C7Z A;  3BK2 A;  3EA6 A;  3TEY A;  5GXG B;  2IGH A;  2MJD A;  4RGT A;  2LMC A;  1JML A;  1UWM A;  3ZJT A;  1LO5 D;  2E6X A;  2W55 A;  2PLP A;  1GAQ B;  5I4D A;  2WS3 B;  1C4A A;  1RYJ A;  4JE3 B;  4ARI A;  2QIL A;  2JX5 A;  3Q8F A;  2GRI A;  3W2D A;  1FO4 A;  1XCT L;  4ZRP A;  5G5G A;  5D3I B;  4ARC A;  3CWI A;  1YN5 A;  4ZHO A;  1YMH E;  4LK0 M;  2W3S A;  3AE2 B;  4JPS A;  1T3Q A;  2WXH A;  2BS4 B;  1V97 A;  3HUI A;  1N5X A;  2CU3 A;  1MPE A;  1N63 A;  3GB1 A;  4H2A A;  3SEB A;  3GS2 A;  1NEN B;  4J3O D;  1EU4 A;  1WRI A;  3Q8B A;  2AQ3 B;  4YWG G;  3P1M A;  4ITK A;  1JWS D;  3AE1 B;  1K51 A;  3N9Y C;  2E3T A;  2QMT A;  2RDH A;  4IOI E;  1J7B A;  2KWD A;  1FFU A;  2WXO A;  2H89 B;  1L6U A;  1P7F A;  1EWY C;  1FCC C;  5BMG A;  1Y56 A;  2PVO D;  1I4G A;  3FC4 A;  3Q69 A;  3ZJU A;  3ZQ4 A;  2M19 A;  2RDG A;  1RM6 C;  1GOZ A;  2WDR B;  4MH8 A;  3BVM A;  3AEE B;  3R2I A;  2Q5W D;  3H8H A;  1CK1 A;  1IUE A;  1C77 A;  3R2T A;  3B9J A;  2WU5 B;  2K0P A;  3AMZ A;  2ZW1 A;  2IGD A;  2WQY B;  4YTN B;  1VZ6 A;  5JXV A;  3AEF B;  1FRR A;  2AQ2 B;  2WXQ A;  4JWS C;  2BW2 A;  1TS4 A;  2CJO A;  4DXG A;  3IAS 1;  5EE0 A;  2JYE A;  5D3D A;  1B1Z A;  3TEZ A;  3MFG A;  1N5W A;  4A90 A;  4YSX B;  2BB6 A;  1VLB A;  1FD6 A;  1ZPS A;  4NZL B;  3CIR B;  1WXQ A;  1FXA A;  2YEP B;  3AEA B;  4RFB A;  3NRZ A;  2OED A;  3URY A;  2XNA C;  3MC0 B;  2MJE A;  1TY0 A;  3BZD B;  5LNK 1;  3BYY B;  1CZP A;  3IAM 1;  2QJL A;  2XN9 C;  5BYQ A;  4REZ A;  4GDK B;  2KDM A;  1ROE A;  2WXN A;  2HTM E;  2VZK B;  5H8Y E;  1E10 A;  2M56 B;  4HRO A;  1RWS A;  2LJI A;  2LGI A;  1TS2 A;  1B9R A;  1F2R C;  2INP E;  2WXI A;  3TSS A;  1OQR A;  2FE8 A;  4PT5 A;  2B76 B;  2RMM A;  5AUI A;  1L0Y B;  1TKG A;  2AQ1 B;  4LLG M;  5D7G A;  3KWV A;  1HZ6 A;  1OQQ A;  1SF0 A;  3VRA B;  2WXM A;  3U52 E;  4KGS A;  2HDE A;  2WDQ B;  1BML C;  3SFE B;  4B0E A;  2Z8L A;  2N9L A;  2CJN A;  1NYR A;  3W5V B;  1SSN A;  1PGB A;  3LXF A;  2V0G A;  3I9V 1;  1FMA D;  2L1A A;  3HVD A;  3BII D;  3P4Q B;  1HZ5 A;  1VRA B;  1SEB D;  2BT6 A;  1SJE D;  1XLQ A;  3GP7 A;  2M0A A;  1E7P B;  2LHE A;  2WXK A;  5EE3 A;  3O13 A;  4US9 A;  2JQR B;  4MAC A;  3VR8 B;  2MEK A;  1AN8 A;  2GB1 A;  1XF5 L;  2WXF A;  4RH6 A;  1EU3 A;  2LEK A;  1E9M A;  1L4D B;  1F0Z A;  2Y3A A;  2W82 A;  1DOY A;  3PZ8 A;  4YT0 B;  1QIL A;  4ZOH C;  3BVZ A;  3P4P B;  1VZ7 A;  4KGT A;  1ZXH A;  2W3R A;  3IXS A;  1FNV A;  4TMA B;  3BVG A;  5BMI A;  3AE3 B;  4TQ1 A;  2BTE A;  1XLO A;  1KTK A;  3TEW A;  3AH7 A;  1JCK B;  2BBC A;  1IGC A;  3AEG B;  2I38 A;  4M0W A;  1XLP A;  2TSS A;  4A9A A;  1L0X B;  2IDY A;  1JWA D;  5EE9 A;  1VDV A;  4N6E B;  1N62 A;  5EE1 A;  1C79 A;  2V3P A;  1VR9 A;  5BYS A;  3KQ4 A;  1GB1 A;  2GI9 A;  3IT6 B;  2JZP A;  3T3O A;  1JWM D;  3BWU D;  2N9K A;  4ZYS A;  1L5P A;  1N61 A;  1TKE A;  4RF0 A;  1I4R A;  2LFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...