2KDSA

Structure of ribosomal protein l14e from sulfolobus solfataricus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
PAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L14e
publication title Structure and Stability of the Archael L14e Ribosomal Protein from Sulfolobus solfataricus
rcsb
source organism Sulfolobus solfataricus
molecule tags Ribosomal protein
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kdsA01
1M90C 1K9MU 2JOYA 1VQ9T 1KD1U 3CC2A 2MWOA 3G71T 2OTLT 3CC7T 4ZN1A 1KQSS 3J80E 3CCST 1RL2A 1YJWT 3CPFA 1S72A 3G6ET 1Q86U 3LGLA 3CCSA 2JNGA 3JAME 1UEBA 2KDSA 3I55A 3G6EA 1KD1C 3I56T 3CC4T 3OW2A 1N8RC 3DB3A 1YI2T 2E70A 3CCUA 1YI2A 1KC8C 1VQPT 3LH0A 1VQ4A 3CMET 3CCMT 1VQ6T 5J3BA 5J26A 1NPRA 4RG2A 3G4ST 3CXCA 1VQPA 3KBGA 1YITT 1Q7YC 1YJNT 1QVFS 3CMEA 1VQOA 3CCEA 2E6ZA 1QVFA 1K8AU 1VQ9A 2OTJT 1M1KC 3G71A 1Q81C 2OTLA 1VQ8T 3CC7A 2L3RA 4ZN3A 5IAYA 3DLLA 2DO3A 3OW2S 1YIJT 5HY6A 1YJWA 4QQDA 1YHQT 1Q82U 1VQLT 3LGFA 1EIFA 3DB4A 1K9MC 3CMAT 4TVRA 2XHCA 2IG0A 1YJ9T 1NZ9A 3CMAA 1YBYA 1VQ7T 3I56A 3CC4A 3CCQT 1NJIU 4CRIA 3CXCS 3CCRT 3CCJT 1Q86C 1XTDA 1K73U 1Q82C 3CCVT 1IZ6A 1JJ2A 2G3RA 3CCMA 1VQ6A 4YTLA 2QEXT 1QVGA 3P8BB 3G4SA 1VQ5T 1YITA 1VQKT 1VQNT 1YJNA 1M90U 3CCLT 2QEXA 3OYYA 3CPWA 3CD6T 1BKBA 2OTJA 1NPPA 1XNIA 1VQ8A 2CKKA 3PIOA 3ER0A 1VQMT 1K73C 5FLXE 2MI6A 1YIJA 1W2BA 1YHQA 5A2QE 2QA4T 1VQLA 1X6OA 1K8AC 1YJ9A 2QA4A 4X34A 1VQ7A 5DM7R 1N8RU 3A5ZB 2KVQG 3PIPA 2JVVA 3CCQA 2EIFA 1JJ2S 1S72T 1QVGS 5DLQE 1SSFA 3CCRA 3CCJA 1KC8U 1KQSA 2JUFA 3I55T 3CPWS 3J81E 3CCVA 2MWPA 1Q7YU 5IT9E 1VQ5A 1VQKA 1VQNA 1NJIC 3HKSA 2LVMA 3CCUT 3CCLA 1M1KU 1W2BS 1VQ4T 1Q81U 3CD6A 2LCLA 1M1GA 5LL6S 3TREA 2LQ8A 1VQMA 3CC2T 3J7AF 1KHIA 1VQOT 3CCET
chains in the Genus database with same CATH superfamily
1K9MU 4PFZA 4PJOG 4PJOB 4M7DC 4M78A 4RCBA 3SB2A 4D8DA 4LDXA 3G6ET 2ECZA 1B7TA 1Q86U 1BI1A 1JRIA 4M7AG 2MF2A 2D6FA 1AHJB 2JTFA 2ED0A 3V7CA 4BI8B 2CYZB 1JB0E 3FRNA 4OMFB 1QQJA 4OMNA 3CMAQ 1T0HA 3NHNA 2FHDA 1NJIR 2OTJT 2NWMA 5CKBA 1OEBA 4PNOA 4J83A 1N6AA 2JXBA 4E47A 1KJWA 3A8MB 1OULA 1V1CA 2XHCA 2IG0A 5GAN4 5GAMh 3SHWA 2PVOB 3JCMJ 4PJOD 1FX7A 2BE7D 2PZ1A 3TCJA 5FU6B 2R5MA 3LW5E 3BFMA 3D7SB 3ZL7C 4M78E 1X2KA 3SWNC 4M7AD 3JCMg 1I1JA 2L3PA 3PGGA 3EH1A 3JSCA 4JRKA 4RTVA 1O75A 4JRPA 3M0UA 2KEAA 1A0NB 4DOWA 3PIPA 2JVVA 1SEMA 1AEYA 3EFRA 2CP6A 4J9IA 1QVGS 2YWWA 3QZ9B 2KXDA 4PLLA 1OI1A 3J81E 2GBQA 1BCMA 4C0ZA 1AWOA 4BI3A 2DTHA 2J05A 2PTKA 1CSKA 2KY9A 2LQ8A 1Z9ZA 2GF7A 5CR2A 2PVGB 3OYIA 3C0CA 1YI2Q 1I4K1 3I5RA 1QP2A 1I0CA 3M53A 2GQVA 1PCXA 3SDZA 2EWNA 2EJFA 4OMQA 1TSFA 5GAOl 2E70A 3GPLA 6AT1B 3C94A 1PM3A 2CDTA 1H641 3VKIA 3CCMT 2YDLA 1LNXA 2NYSA 2LP5A 4D8KA 1OV3A 1Y7XA 2E3HA 2O4XA 4M7AC 2L3RA 1YWPA 1K73R 4J5YA 4J7IA 2CZ0B 3NMZC 5FWBA 3RBBB 5GANj 1M90R 4ESRA 3A98A 1RAIB 3CCQT 2XK0A 1KHCA 3P8DA 5GAMf 1YP5A 1D1AA 3QHSA 2F1LA 3H0IA 1BIBA 1RABB 2HSPA 1VYUA 3HP9A 1FWZA 2CT3A 3LX7A 1NYGA 2HSEB 2OTJA 2E41A 1XNIA 2DFUA 4C8QA 3PIOA 5L23A 2P0QA 2YRCA 3ASKA 3E19A 1E6GA 2EYWA 5GAOr 1YNZA 1BYMA 1X43A 1VQ5Q 3L2ZA 1JU5C 2C0TA 1D09B 1M27C 2BZYA 1IGQA 2V8IA 4NL3A 1TG0A 4WF2A 2BZXA 2WSCE 1R8OB 3NTKA 2DEQA 1NJIC 3EG9A 4FYWB 2H8HA 1ZUUA 3VS4A 1C6VX 1D0ZA 5LL6S 2DLPA 1KHIA 2O31A 4M75B 4OMPA 3JRZA 1N9SA 4FT4A 2A36A 4FIBA 3VYHB 2VASA 4XTWA 5LJ3h 2LT4A 4LXCA 1M2VB 2FPFA 1ABOA 1VQOQ 2J6OA 2K5IA 5FU7C 3DB3A 4RTUA 3QWYA 4C8QE 1CKBA 2A0FB 1VQPT 1UFFA 3M0PA 3O5ZA 3OYGA 4D6WA 2K5FA 5J26A 4F16A 2RK1A 2OX7A 4XAXB 4F14A 4CC4B 4IUUA 4E7KA 4F7UG 4KULA 2B8AA 4KH1B 2E6NA 3HRUA 1B34A 1Q82U 2GFUA 1CKAA 4OF1A 1I8FA 4BACA 4EIKA 2DYIA 3URGA 2AIRB 1N27A 2KBTA 1I5LA 2DL7A 1GBRA 4LD6A 3OYNA 1Q82C 3QUIA 4OMOA 2G3RA 5KYWB 3CCMA 4CC2A 1KD1R 1ABQA 1Y96B 5EG2A 3BW1A 2QA4Q 4M75F 2BKDN 2ZCFB 1WXBA 2QEXA 3CD6T 5CO7A 3RKYA 2RHZA 4GBQA 2CKKA 5KYXA 2QAZA 3QPHA 4A4GA 2X4XA 4ELZC 1M3CA 2AKKA 1VOMA 1X6OA 2FZCB 3PNWC 1MV3A 2VUBA 3OA6A 3H9NA 3A5ZB 3CCQA 2EIFA 4M77G 1YCYA 2BZ8A 1SSFA 3MP1A 2DNUA 2MK5A 1UB4A 1ZA2B 2YUNA 2MWPA 3OYAA 1PWTA 2GQIA 2M9UA 3CBPA 2KI7A 4A4KA 4XTUA 1OU9A 4ME7A 5DLOA 3CC2T 2ABLA 2X35A 1M90C 1KQ2A 1X6BA 2EKHA 2OTLT 4BE2A 4PL6A 5KE3A 3V8KA 3S3MA 3M4YA 4FM4B 4BUGA 2G6FX 2FPDA 1UEBA 1Y07A 3X20B 1Y0MA 3GBQA 5GAN5 3PTAA 2RB6A 3CMEQ 4ZTJA 1NG2A 1PSFA 1RAFB 4R55A 5LJ3f 1UGRB 2WACA 2RNAA 2P84A 1I07A 1VQ6T 2D8JA 3V8JA 1D3BA 5CAIA 4M77D 2V1RA 1IXDA 2B86A 1UHFA 4C0DC 4E7IA 3OYHA 1QVFA 3JCMc 5I2MA 3EG2A 2QGFB 3X25B 1UTIA 3M0TA 4C92A 2QK0A 1OU8A 2KR3A 1PHTA 2RHUA 1XOVA 2YUPA 4IUPA 5LJ3d 1PKTA 1QVGA 1VQKT 3VS2A 2FRYA 2QGGA 4IIOA 4C5GA 4B9XA 1E7OA 4BDYA 2MOXA 1VYVA 4XTVA 5KYNA 1MNDA 4ZGDB 1NEBA 1ZUYA 2Y4XA 3FIFA 4FSXA 1AWWA 5CCAA 2K2MA 2RI3A 2XI9A 1Q81R 2HKQB 4EMKA 1K4US 2KVQG 1JJ2S 4RUGA 2HEQA 5IHKA 1K9MR 4BD3A 2O88A 2GNCA 2FRWA 1MMGA 5A0LA 3GOXA 3CD6A 1WFWA 1Q86R 3RESA 2BE9B 3QSUA 4C92E 3CCSQ 4A4FA 1BI2A 2FZKB 4EDUA 4M77C 2VYTA 1KD1U 2EYXA 1NYFA 3CC4Q 1MHNA 4ZNXA 1OPKA 4M7DG 4M7DB 3L1AA 5LJ3e 3QXEB 2EKOA 1KD1C 3I5SA 3CC7Q 2DD5A 3VUZA 5KYYB 4CC3A 2JT4A 2D8HA 4UC4A 4L59A 1OZ2A 2KGTA 1M3AA 1R77A 2OTLA 4J8OA 5FRMA 1RLQC 2F5TX 4XTXA 3HTRA 1EIFA 3GLXA 2A3LA 2DIQA 3TU4K 1HXDA 2RHXA 4N4HA 1YJ9T 1ZSZA 2PU9B 1OPLA 2O9VA 2J6KA 2RA2A 4FT2A 3CXCS 2DZCA 2IVWA 1GXIE 5CKFA 1VUBA 2QQBA 1T3SA 9ATCB 4DBQA 3AT1B 1VQ6A 4EMHA 4M7DD 3M0QA 4PJOA 2Y90A 1WLPB 5D6YA 4A53A 3E9FA 4MZMA 3SWNB 3CCVQ 1T3LA 1IO6A 1VQNQ 3OBWA 1M30A 1QCOA 4KGZB 1F1BB 1UG1A 2PUKB 2QQAA 3OSVA 4L6V5 5IHNA 3NTHA 4JZ3A 4OMMA 1FMWA 1VQKA 2DBKA 2O2OA 1IREB 2ED1A 4BE0A 2LMJA 3EFOB 2GTJA 3JV3A 4KUDK 4MDXA 2XMFA 1GCQC 3VS7A 2DXUA 3REBB 3OS1A 3QJ6A 4JJNK 3SD4A 4ZN1A 5D6XA 1AZEA 2X4WA 1RL2A 1E6HA 4IUTA 4J9HA 3OYFA 2JNGA 1P92A 3RKWA 2FVUA 2GTOA 3HRTA 4RTXA 2J06A 4PJOE 3G71Q 2XU8A 4HCBA 4HT9A 1AT1B 1C0MA 3M58A 3TSZA 2AZVA 3R6NA 1IHWA 4FW2A 1U06A 1UGVA 2MCNA 1K8AU 4M7AE 2DX1A 1YN8A 1Q81C 1IB8A 4XK8E 1GRIA 1RAGB 1UDLA 2LNHB 3OW2S 2HDAA 4JZ4A 1K9MC 4GY5A 4TVRA 4M7AB 1YITQ 2C0OA 3CMAA 3UDCA 2I2LA 5HK0A 1NEGA 1Q86C 2KXCA 3UATA 4Z88A 4X9DA 2LJ3A 2VVKA 2E12A 1VQ5T 3JB9I 2XDBA 2EQKA 2RI2A 7AT1B 4FW1A 3THKA 2LZ6B 1RI9A 2LJ1A 3CCJQ 3RNJA 4JJDA 1M4ZA 5GAMg 1YJ9A 4GLKA 5IXBA 1KC8U 2K4YA 2KE9A 4J9CA 4JS5A 2FB7A 1GBQA 3QDRB 4PJOF 1IRXA 4JRIA 3I9QA 2K3YA 2LCLA 5CK9A 1NM7A 2EQJA 5LJ5h 5KE2A 1VQOT 4VUBA 3GNFB 3AHUA 4M7AF 2CP7A 3OS0A 4FU6A 3VYGA 2O01E 2AT1B 1VQ4Q 3CQTA 3JCMh 2PUOB 2DEUA 3MP6A 1H3HA 3LGLA 5FROA 3G1JA 1JQQA 2L3SA 2EQIA 4M78G 5GAOq 1RAHB 3X26B 1I81A 4PFOA 2KYMA 3RR6A 2CT4A 1M1FA 2DF6A 1YI2A 1BB9A 1Q82R 4A4EA 3LH0A 5FU7B 3CPWP 2PVDB 5J3BA 2K5LA 2NLUA 2E6ZA 3G7ZA 3I56Q 2RQWA 3VUBA 4E2FB 1SF9A 4HVUA 3TEEA 2XICA 4J6XA 2DPPB 1NZ9A 4ATOA 1X2QA 2YUQA 4Z89A 2AHJB 4M4ZA 2LT1A 3OQ5A 1YHQQ 1JJ2A 4MZTA 2QEXT 3JB9H 2OAUA 5GAN2 4M75A 2YT6A 3OS2A 1W6XA 4M78D 4MMLA 2RQTA 2V1QA 2HD0A 1O9SA 1WHMA 1V76A 4B9WA 1VYTA 3R6OA 2K57A 1M2VA 1TU0B 4P5NA 2K3XA 1N8RU 4C0FA 4GLMA 4ZGEB 2HKNA 4FYVB 1RAEB 2EQUA 2M51A 5C0MA 1JBMA 3MKDA 1MMAA 4MMKA 3I55T 2RM4A 2JS0A 1AVZC 1HJDA 1VQ5A 1PSEA 4DBRA 1QMCA 1BCOA 4WCIA 3A1PA 3J7AF 2ESWA 2ROTA 3G6EQ 2RHIA 3X28B 2JJ9A 2QDLA 4N4IA 4DQ2A 2DE0X 4HKEA 3J80E 2QQ9A 1TUCA 1M5Q1 2BTTA 4LD9K 3EAEA 1JO8A 2DETA 3M5AA 4M75E 5KYWA 3JB9G 1KK7A 1Y96A 2KYBA 3LYIA 3CEYA 4N0AC 4ZGJB 2HBWA 2DERA 4Y91A 4X9CA 5GAN6 2OTJQ 1K9AA 1SSHA 3LLRA 2KK4A 1YJWQ 1QVPA 3CXCA 2RQVA 1UUEA 2F5KA 1VQOA 3RIRA 3MHXA 4M78C 1W4SA 4C0DB 2LRQA 2YHTA 3MPUB 5LJ3g 4QQDA 1OX8A 5C6SA 1SHFA 5LJ5d 4DBFA 1PRLC 5AYFA 2K79A 1M9SA 2RQUA 3VJPA 3U23A 1VQ8Q 1H92A 5DY9A 2M0OA 3RMSA 1TOVA 2EBPA 2QYZA 3JCMd 1AWJA 3HPWA 3MP8A 1YCSB 1HSQA 4ZTFA 2HMAA 4F7UB 1D1BA 2JM9A 2HCKA 4JJBA 3JB9D 4OGCA 2DIGA 2ZGWA 2J7IA 3L2QA 3MCAB 5HKCA 1WJRA 4KGVB 2HQEA 3C95A 1NBEB 2OJ2A 4A63B 2QA4A 2IPOB 3CCLQ 1KG1A 3JCMX 1WGSA 4C8QG 5GMKj 5D7UA 2M16A 2BUDA 4IIMA 1VQMQ 2RQRA 2CS7A 2ZPFB 4QVZA 5GAOn 1Q95G 2V8KA 3PT9A 2X3WD 1M1KU 3EFSA 4WTOB 1S72Q 1M1GA 2DZ9A 4KRTA 2CZ1B 2PQWA 2EYZA 2DILA 5LJ5e 1KSWA 2Y4YA 5L8RE 2DXTA 3CC7T 2DMOA 2P0KA 4M77B 2KT1A 2D0QB 1SPKA 2DXBA 3JCMe 3JAME 2E4HA 2RK2A 4HCKA 4J9EA 3I55A 2NUTB 3OW2A 1VQ9Q 1WYXA 3FJ5A 1BK2A 1J3TA 4F7UF 1C1AA 1SG5A 2MYSA 3VRYA 1H8KA 3WVEB 1WJQA 4C8QD 3CMEA 2E10A 1QCFA 4HVVA 5GMKm 3QIIA 3L2WA 3CCQQ 3QWXX 1TXQA 1Z9QA 4XTYA 1VQLT 3DB4A 4Y92A 3FEOA 1ARKA 1YBYA 3JCMV 1KFZA 3RERA 1WHHA 4CRIA 3C12A 1XTDA 5HK3A 3CCVT 1M2OA 2KQWA 1VQNT 2RMOA 1PD0A 1W2BP 3DLMA 5I2SA 5GAMj 1ZQ1A 2ENMA 2HL5C 1QWFA 4M77F 2D0NA 1OZ3A 2CREA 1UGSB 4LNPA 4M7DA 2H3JA 3E2UA 3VU3C 1MMDA 2NUPB 4AG2C 4XU1A 2DTIA 4X1VA 5KYYA 1SRLA 5AT1B 2L89A 2GFAA 3BDLA 2E5QA 1YWOA 2LVMA 3CCUT 3VS0A 3WVDB 5FRNA 2A08A 2DJZA 1WIEA 2YLCA 4JLIA 4C8QC 4AFUC 2FEIA 2Z0WA 1X69A 2HAXA 3G71T 2E64A 2RPNA 3FC3A 2RD1A 3Q1JA 3HL8A 4DBHA 1KIKA 3CCSA 1VQPQ 2AK5A 3IQLA 4FYYB 1K8AR 3LWHA 1MMNA 1X27A 5IHIA 1B07A 2FO0A 3QYHB 1WX6A 4Q5WA 4KH0B 5GANh 3M54A 3M57A 4M7DE 5FWCA 1YITT 2A7YA 4HXJA 3SWNA 1ZSGA 1ZBJA 3BDUA 1GL5A 4ELYC 2JZ2A 1R0CB 5ECAA 3CC7A 4XU3A 2DYBA 4L5GA 2KSSA 2HNIA 1N5ZA 2HQHA 4JPBW 3CMAT 1QWEA 3G4SQ 2R58A 1QCNA 2XDDA 1AWXA 4R56A 4JS4A 1HD3A 3H0HA 3CCJT 3CD6Q 2EQMA 4LN2A 4C92G 4QVDA 3EFOA 2L3QA 5FW9A 1IZ6A 5CIUA 4IUVA 1RI0A 1VQ7Q 1UHCA 3SEMA 1KC8R 4OB1B 5EC7A 3JCMb 3MEWA 1VQLA 2A37A 1TUDA 3ZBDA 1U1TA 3RDVA 1G2BA 2DK3A 2EGEA 4A4HA 1ZX6A 4RTYA 4HCCA 4NOYA 2QQSA 1PC0A 4J9GA 1TTHB 2F2XA 3BY7A 3CCVA 1Q7YU 3CC2Q 4JJCA 2YUOA 1BIAA 3OYJA 1VQNA 1W70A 1G8XA 3UA6A 1XJWB 1WHKA 1W2BS 1VQ4T 4E7ZA 4O6JA 1QVFP 4Y28E 4BY6C 4M7DF 1UE9A 2J6FA 2RO0A 1HYOA 1K1ZA 2XKOC 4HCZA 4V2SA 2ZPIB 1WHGA 4OP0A 3EHRA 4C92D 3QKJA 2MAMA 2OI3A 3DKMA 4M7AA 3EG3A 3ME9A 2FYKA 2L8DA 1JXOA 4BE1A 2CSQA 2ZPGB 5D6WA 3L2UA 1Y71A 2RH2A 2KDSA 2EJGA 3CCEQ 3N5BB 4CC7A 3I56T 4OMLA 1YI2T 1QVGP 2VXFA 1MGQA 3CCUA 2DKGA 1K0XA 1M8VA 2DM1A 1PG5B 3V7SA 1UGPB 5LJ3j 2SRCA 1WJSA 4FL6A 1SHGA 3FDRA 2V26A 3G71A 5GMKh 1BBZA 1D1CA 3JCMP 1YHQT 4OB3B 1UJYA 3FB9A 2P4TA 1PD1A 2CP2A 4AFZC 1YJNQ 2HBPA 4NL2A 2RF0A 4QKUA 4XU0A 5KYUB 1YIJQ 2F69A 3GIBA 1MUZA 2L0AA 1YITA 1N8RR 3QDFA 4AFQC 2ZPBB 4RKUE 2YSQA 2RHYA 3CCRQ 2X4YA 2EVRA 1G83A 1HK9A 4J6WA 5GANd 3HHTB 2EAYA 3PE0A 4C92C 1K8AC 1KQSP 4AFSC 3INZA 3L2RA 1GFCA 2L5QA 1XQHA 3TQ7P 5DLQE 3CCJA 2CP5A 2LX9A 2IIMA 5IT9E 3RKXA 3EGDB 2ZAEA 1TUGB 2RI5A 2JS2A 4C5EA 3T9NA 1M8MA 2MWOA 3EHQA 1Y57A 2JN0A 3QZ5B 4EMKC 1G3TA 3EGXB 1K0SA 1WDXA 1YJWT 1OQKA 3JCMW 3GNGA 5IXFA 3SFMA 2E1HA 2EYYA 1TWBA 2CP0A 4PK4A 1KC8C 1ZLMA 1VQ4A 1IGUA 2VV5A 4AT1B 2X3XD 3HFNA 3PFSA 5LJ5g 1NPRA 4RG2A 4RTTA 1QVFS 5GANe 3ZFJA 1YJ9Q 1RUWA 4Z8AA 1VQ8T 3L42A 1VIEA 4IKFA 1WHLA 2D9TA 1DJ7B 2CZ7B 4OVAA 4BB7A 4M78B 3I56A 1WI7A 2KAFA 3OBYA 3VS6A 1YFNA 4B6MA 1U8RA 1PRMC 2GGRA 4KT0E 4HA8A 1RADB 2X51A 3F70A 1V29B 1WQWA 2WSEE 2LDMA 3H8ZA 2R57A 2K6DA 1GCPA 4QQGA 2M02A 1OX9A 1WPYA 3CCLT 3L2VA 1NPPA 2CH4A 1X6GA 3OB9A 3VRZA 3OY9A 4JLGA 1VQMT 4NS5A 1VA7A 2MI6A 2JTEA 5CVIA 1YHQA 2QA4T 2H3EB 1M1KR 1OOTA 1QP3A 4LDYA 1ZSZC 3PVQA 1B3QA 3BE3A 1S72T 2LCCA 4QVCA 2JTMA 1AOJA 1D0XA 3META 2LCSA 4AMCA 4FSSA 2DVEA 4XU2A 2QASA 1WQ7A 3E9GA 3UWNA 5GJWB 4DOVA 1X75C 4PJOC 2ROLA 4DA4A 1UGQB 2JW4A 2QQRA 4J9DA 5J39A 1VQ9T 4M78F 3C4SA 2LQNA 3OYCA 2DVJA 1KQSS 2KMTA 3CBOA 5IN1A 3OSSC 5CKHA 2CUBA 1G5VA 3RMQA 3G6EA 1N8RC 3OYBA 5GMKl 2C06A 2E65A 2F2WA 2DJQA 2R5AA 4F7UA 3CMET 2LQWA 2VGMA 4J7FA 5LJ5f 2XIDA 4BI4A 4OGEA 1U1SA 4IUQA 2DL8A 1EFNA 3UT1A 5A0GA 5IAYA 2RJDA 2F2VA 5GMKe 2DO3A 5HY6A 1YJWA 1FXXA 3JCMf 2CGHA 2RJEA 2K3BA 2LTOA 4F04B 1QKWA 2HZYA 4PJMA 4PJNA 1M3BA 5FU6C 1NJIU 1LCKA 2DRMA 1VIFA 3A8OB 3VS3A 1ZBXA 2W10A 4OB2B 3M0RA 2DTOA 2RN8A 3OYYA 5GAMd 4ANJA 1VQ8A 4KGXB 4M77A 3ER0A 5CKDA 3PMIA 3M55A 5FLXE 5KCHA 1W1FA 3HSBA 1W2BA 3E1SA 4M75G 2O4XB 1ACMB 2QDYB 4O5VA 5DM7R 2NUTA 4PFPA 3ULRB 4F7UE 2HL3A 4PKCC 5GMKi 3CPWS 4FYXB 4DEYA 3HKSA 4LE9A 3OYEA 3CCLA 1GFDA 3EH2A 3OYMA 2V8JA 1SKUB 1U5SA 1IHVA 2CP3A 1LVKA 2YRDA 5CQYA 1VQMA 1BI0A 1FYNA 3JB9F 4C8QB 3PMTA 4IURA 4AG1C 3RUXA 3TSWA 3CCST 5GJVB 1LPLA 1S72A 3CPFA 3OYDA 1PNJA 2C0IA 3QYGB 3MO8A 2X4JA 3M56A 2YXYA 3CC4T 2DBMA 2M1HA 3A8HB 4J9FA 1JJ2P 4LDWA 1NLPC 3GP8A 4JRQA 2FG0A 4Z02A 3KUFA 5GAMe 4M77E 2I0NA 4M75D 3VS5A 3G4ST 3REAB 3EG9B 1EX4A 4K11A 1OYXA 3S3OA 4PJLA 1VQ9A 2FL7A 1M1KC 1KQ1A 2KRMA 5GAOm 2XDPA 3DLLA 4QW2A 1G3YA 1TH7A 2NUPA 3OS5A 3CCMQ 3LGFA 2VKNA 2BIVA 1WXUA 1VQ7T 5A0DA 2QEXQ 1T0JA 4E7SA 8AT1B 2A28A 2QTXA 1X01A 3NGPA 1K73U 2QI2A 4QQ6A 3OYKA 1M90U 4J6YA 3MJXA 1NLOC 1S1NA 3QO3A 1BKBA 1QKXA 4C8QF 3H0FA 1GCQA 2RJFA 1K73C 4EPCA 1Q7YR 5A2QE 5GAN8 3I55Q 2JMCA 4DEXA 2CH4W 1NE8A 1H3ZA 2DXCA 3JB9J 3A8LB 2YLBA 1B34B 4KUIA 1FMVA 1SRMA 3MEAA 4II1A 4JUVA 2LQKA 2KT8A 4XTZA 4E7HA 2HQXA 3CXCP 5I11A 3OMGA 4M75C 3MEUA 4F17A 2MPXC 3S6WA 1BU1A 1AD5A 1RAAB 3CCET 2FPEA 2FZGB 4BY6B 5KYXB 4RCCA 2VB6A 3EGUA 3M59A 1PKSA 3H41A 2AKLA 2ATCB 1AZGB 2YRVA 4LUEA 4RTWA 1WZOA 3X24B 2P4RA 1I5OB 2EGAA 5LJ5j 2E5KA 2DL3A 2ZPHB 3KFVA 4RTZA 2ZPEB 5GAN7 4MDWA 2EGCA 1VQPA 4PLIA 4JDSA 4CI0C 1YJNT 2K7AA 3M0SA 3LWIA 2VGNA 2X9HA 4ZN3A 3M9QA 1G3SA 4C5HA 2XG8D 1YIJT 2E3IA 4MZPA 1LOJA 3FJPA 2VC8A 2CUDA 3CC4A 5KH6A 2K9GA 2JM8A 3CCRT 1FMKA 3HRSA 5GANg 1QW1A 2COYA 4LDVA 3WXMB 1UJ0A 2DAQA 1QLYA 2VWFA 3G4SA 3QJYA 3KXTA 3JCMQ 5CQXA 4E7LA 1D3BB 2KRSA 2AZSA 3M4GA 5IH2A 2XD0A 4E6RA 1VQ7A 4X34A 2W0ZA 2DA9A 3QG1A 3OW2P 4C0GA 4C92B 1N9RA 4N4GA 3NTIA 3MEVA 1KQSA 2EYQA 2DRKA 3CBMA 3TREA 5GAN3 1MNEA 3V7RA 1D0YA 3VV0A 2JOYA 4XQ3A 3CC2A 2COWA 2CZ6B 2KROA 2CSIA 4HT8A 1WNLA 2K2VA 4E7JA 3OYLA 4OB0B 2EFIA 2L2PA 5KYUA 4EMKB 5CKEA 5KCOA 8ATCB 2OTLQ 4J9BA 3FLGA 1WHJA 3ZEHA 4RG8A 2COZA 3GF5A 1MV0B 1Q7YC 3KBGA 1BI3A 1VQLQ 1WXTA 3EG1A 3VS1A 1ZA1B 3CCEA 4QT7A 2M0YA 2LNVA 3LH5A 3V8LA 5I22A 3NFCA 2DD4A 2QG9B 1R0BG 1WA7A 4RMOA 4C92F 4EMGA 1VQ6Q 3A8GB 1RACB 1TS9A 2NUZA 3UF4A 2EJ9A 2LC4A 2DL5A 1U3OA 5HCKA 4A54A 2QTVA 1ZHIA 3UPUA 2LJ0A 2PNIA 3O8VA 3OMCA 4C5IA 2LX7A 2KRNA 3EGDA 3TVTA 1EZZB 1G3WA 4PJJA 1ZUKA 1LJOA 4YTLA 3H6ZA 3P8BB 5GANf 4BDZA 1YJNA 1K76A 3NPFA 2RJCA 2ZZDA 2GCXA 4HVWA 3CPWA 3QBYA 5M9OA 2O9SA 2JMAA 2MMPA 3EGXA 4FCYA 1YIJA 2WSFE 2DL4A 1VQKQ 3HFOA 3UA7A 4LDUA 2P0PA 1JXMA 3CCUQ 3I35A 2VXEA 3S3NA 3CCRA 2MIOA 2EW3A 4R0KA 2JUFA 1ZSZB 1RLPC 5GAOp 4ORZA 4N0AA 4KBMB 2EPDA 5I21A 1JEGA 4LUDA 2KNBB 3PVLA 2OAWA 2QXFA 1Q81U 1UECA 3P8HA 2SEMA 2D1XA 3EG0A
chains in the Genus database with same CATH topology
5J39A 1K9MU 4PJOG 5LJ5e 1VQ9T 1KD1U 4PJOB 2Y4YA 4M78F 3C4SA 4M7DC 4M78A 4RCBA 5L8RE 2DXTA 3SB2A 3OYCA 3CC7T 2P0KA 4M77B 1KQSS 1MHNA 2KMTA 2D0QB 4LDXA 3CBOA 5IN1A 3OSSC 4M7DG 2DXBA 3G6ET 4M7DB 1Q86U 3L1AA 1BI1A 5CKHA 3JCMe 3JAME 2RK2A 5LJ3e 1G5VA 3QXEB 3RMQA 3I55A 1JRIA 3G6EA 2EKOA 4M7AG 2MF2A 3OW2A 1KD1C 1N8RC 3OYBA 2D6FA 1AHJB 2JTFA 5GMKl 2C06A 2E65A 3V7CA 2DD5A 2CYZB 4BI8B 3VUZA 4F7UF 2R5AA 4F7UA 1JB0E 3WVEB 3CMET 1WJQA 4C8QD 3FRNA 4OMFB 4UC4A 4L59A 1OZ2A 2VGMA 4J7FA 3CMEA 5LJ5f 2FHDA 2XIDA 2E10A 4BI4A 5CKBA 2OTJT 2OTLA 4OGEA 1U1SA 4IUQA 4PNOA 3QIIA 4J83A 4J8OA 3UT1A 5GMKm 5A0GA 5IAYA 3L2WA 2RJDA 1N6AA 5FRMA 5GMKe 2DO3A 2F5TX 4E47A 5HY6A 1YJWA 3A8MB 4XTXA 4XTYA 1VQLT 1EIFA 3DB4A 1FXXA 2A3LA 2CGHA 3GLXA 3JCMf 2DIQA 3FEOA 2XHCA 1HXDA 2IG0A 2RHXA 4N4HA 2RJEA 5GAMh 1YBYA 5GAN4 3TU4K 2LTOA 1YJ9T 2PU9B 3JCMV 2RA2A 2PVOB 4FT2A 5FU6C 1NJIU 3RERA 4CRIA 3JCMJ 3CXCS 4PJOD 2DZCA 1FX7A 2IVWA 5CKFA 1VUBA 3C12A 1GXIE 1XTDA 1VIFA 3TCJA 5HK3A 3A8OB 2QQBA 3CCVT 1ZBXA 5FU6B 2KQWA 2R5MA 1VQ6A 3LW5E 4OB2B 4EMHA 3BFMA 1VQNT 4M7DD 2DTOA 4M78E 3DLMA 5I2SA 5GAMj 1ZQ1A 3SWNC 3OYYA 4PJOA 5GAMd 4M7AD 2Y90A 3JCMg 1VQ8A 4M77F 4M77A 5D6YA 3ER0A 4A53A 5CKDA 3E9FA 1OZ3A 3PMIA 1UGSB 3M55A 4MZMA 3SWNB 5FLXE 3PGGA 5KCHA 3HSBA 1W2BA 4M7DA 2H3JA 3JSCA 4JRKA 1O75A 3E1SA 4JRPA 4M75G 2O4XB 2QDYB 4O5VA 5DM7R 3OBWA 4DOWA 3PIPA 2JVVA 3VU3C 3EFRA 4F7UE 1QVGS 4PKCC 2PUKB 3QZ9B 2QQAA 3OSVA 4PLLA 4XU1A 2DTIA 1OI1A 4L6V5 5GMKi 3J81E 3CPWS 3NTHA 1VQKA 2L89A 2GFAA 3BDLA 2E5QA 3HKSA 2LVMA 4C0ZA 1IREB 3CCUT 4BI3A 3OYEA 3CCLA 2DTHA 3OYMA 4BE0A 2V8JA 3WVDB 2KY9A 5FRNA 2DJZA 2YLCA 4KUDK 4MDXA 4JLIA 5CQYA 4C8QC 2LQ8A 1VQMA 2DXUA 1BI0A 3OS1A 2GF7A 3QJ6A 2HAXA 5CR2A 3G71T 2PVGB 4JJNK 3JB9F 2E64A 4C8QB 3SD4A 3OYIA 3PMTA 4ZN1A 3FC3A 4IURA 3RUXA 2RD1A 5D6XA 1I4K1 3CCST 3Q1JA 1QP2A 2X4WA 3HL8A 1RL2A 1S72A 3CPFA 3M53A 3OYDA 3CCSA 4IUTA 3OYFA 2GQVA 2JNGA 3QYGB 3MO8A 3SDZA 1P92A 3RKWA 2EWNA 2EJFA 2FVUA 3HRTA 3LWHA 2X4JA 3M56A 3CC4T 3A8HB 2M1HA 4PJOE 4LDWA 2XU8A 5GAOl 3GP8A 4JRQA 4Z02A 2E70A 3KUFA 5GAMe 4HCBA 4M77E 3GPLA 4M75D 4HT9A 3C94A 3QYHB 4Q5WA 1H641 3VKIA 3M54A 3M58A 5GANh 3M57A 3CCMT 4M7DE 3G4ST 1LNXA 1YITT 2A7YA 3SWNA 1OYXA 3BDUA 3S3OA 1K8AU 4ELYC 1VQ9A 4M7AE 2FL7A 1M1KC 1Q81C 1Y7XA 1KQ1A 2JZ2A 2O4XA 3CC7A 4M7AC 5GAOm 2L3RA 4XU3A 2XDPA 4XK8E 3DLLA 4L5GA 4J5YA 2KSSA 2HNIA 2CZ0B 4J7IA 4QW2A 3OW2S 1G3YA 1TH7A 3CMAT 3OS5A 3LGFA 1K9MC 4GY5A 4TVRA 5GANj 4M7AB 2R58A 2BIVA 3CMAA 1VQ7T 5A0DA 3UDCA 2XDDA 3CCQT 2I2LA 2XK0A 4R56A 5HK0A 1KHCA 3P8DA 4JS4A 5GAMf 3CCJT 2EQMA 2QTXA 1Q86C 4C92G 1X01A 3QHSA 4QVDA 1K73U 2QI2A 1BIBA 1IZ6A 5CIUA 4X9DA 4QQ6A 3HP9A 2E12A 1RI0A 4IUVA 1VQ5T 1FWZA 3OYKA 3JB9I 2XDBA 2EQKA 2RI2A 1M90U 3LX7A 4J6YA 3QO3A 1BKBA 2OTJA 2E41A 4C8QF 1XNIA 4OB1B 4C8QA 2RJFA 3PIOA 2P0QA 1K73C 4EPCA 3ASKA 3JCMb 3MEWA 3E19A 5A2QE 5GAN8 1VQLA 5GAOr 1M4ZA 1BYMA 3ZBDA 3L2ZA 1U1TA 5GAMg 2DK3A 1YJ9A 4GLKA 4A4HA 1NE8A 1H3ZA 2DXCA 3JB9J 3A8LB 4HCCA 2YLBA 4NOYA 1B34B 2QQSA 4KUIA 2V8IA 4NL3A 4WF2A 1KC8U 3MEAA 4II1A 2K4YA 4JUVA 2LQKA 4JS5A 2FB7A 2WSCE 1R8OB 3BY7A 3CCVA 3NTKA 3QDRB 1Q7YU 4PJOF 4XTZA 1BIAA 2DEQA 3OYJA 4E7HA 1NJIC 2HQXA 1VQNA 1W2BS 3OMGA 4JRIA 4M75C 1VQ4T 2K3YA 2LCLA 4O6JA 5LL6S 3MEUA 4Y28E 5CK9A 2EQJA 4BY6C 2RO0A 2XKOC 5LJ5h 3S6WA 4HCZA 5KE2A 4M7DF 4V2SA 1KHIA 2ZPIB 4OP0A 1VQOT 3CCET 4M75B 4VUBA 4C92D 3GNFB 3QKJA 3JRZA 2MAMA 1N9SA 3DKMA 3AHUA 4FT4A 4M7AA 4M7AF 4BY6B 3OS0A 3ME9A 4FU6A 2O01E 4RCCA 2FYKA 4FIBA 3VYGA 2L8DA 3M59A 4BE1A 3VYHB 2ZPGB 4XTWA 5D6WA 3JCMh 2PUOB 5LJ3h 2YRVA 3MP6A 2LT4A 3L2UA 3LGLA 5FROA 3X24B 1Y71A 2RH2A 2KDSA 5LJ5j 2EJGA 3N5BB 4M78G 2K5IA 5FU7C 5GAOq 3I56T 3DB3A 2ZPHB 1I81A 3X26B 1YI2T 2VXFA 1MGQA 2ZPEB 4C8QE 5GAN7 1M1FA 3CCUA 2DKGA 4MDWA 1YI2A 1M8VA 1VQPT 4A4EA 3LH0A 5FU7B 3OYGA 4D6WA 2PVDB 3V7SA 1UGPB 5J3BA 2K5FA 5J26A 5LJ3j 1VQPA 2K5LA 4PLIA 4JDSA 2RK1A 4CI0C 4XAXB 1YJNT 1WJSA 2NLUA 2E6ZA 3G7ZA 3LWIA 2VGNA 4FL6A 4IUUA 3FDRA 4E7KA 3G71A 5GMKh 3VUBA 4ZN3A 4F7UG 4KULA 2B8AA 3M9QA 1G3SA 4C5HA 2E6NA 3HRUA 3JCMP 2XG8D 1B34A 3TEEA 1YIJT 4MZPA 2GFUA 4OB3B 1YHQT 1LOJA 3FB9A 1Q82U 2XICA 3FJPA 4OF1A 2P4TA 1I8FA 4J6XA 4BACA 2DPPB 1NZ9A 4ATOA 3URGA 2VC8A 3CC4A 5KH6A 1N27A 1I5LA 2AHJB 2HBPA 4LD6A 3CCRT 2LT1A 3HRSA 3OQ5A 3OYNA 4NL2A 1Q82C 3QUIA 4XU0A 5GANg 3GIBA 2F69A 2G3RA 1QW1A 4LDVA 4MZTA 3WXMB 3CCMA 2DAQA 1JJ2A 2QEXT 3JB9H 3G4SA 1Y96B 5EG2A 1YITA 2OAUA 3QJYA 5GAN2 3BW1A 3KXTA 4M75F 2BKDN 2ZCFB 4M75A 3JCMQ 2QEXA 2ZPBB 4RKUE 5CQXA 3OS2A 4E7LA 3CD6T 2RHYA 5CO7A 3RKYA 2RHZA 4M78D 4MMLA 2CKKA 1D3BB 2X4YA 3M4GA 2HD0A 3QPHA 1O9SA 4A4GA 2X4XA 4J6WA 1HK9A 4ELZC 5GANd 3HHTB 2XD0A 2EAYA 1X6OA 4B9WA 4C92C 1K8AC 3PNWC 3R6OA 2VUBA 2K57A 3INZA 4P5NA 3OA6A 2K3XA 4X34A 1VQ7A 1N8RU 4C0FA 3L2RA 2L5QA 1XQHA 3A5ZB 4ZGEB 3CCQA 3QG1A 2EIFA 4M77G 1YCYA 4C0GA 4C92B 1N9RA 5DLQE 1SSFA 4N4GA 2EQUA 3CCJA 5C0MA 1JBMA 3MP1A 3NTIA 1UB4A 3MEVA 4MMKA 3I55T 1KQSA 2LX9A 2RM4A 2EYQA 2MWPA 3OYAA 5IT9E 1VQ5A 2M9UA 1PSEA 3RKXA 3CBPA 4A4KA 3CBMA 4XTUA 2RI5A 3TREA 5GAN3 4ME7A 3V7RA 5DLOA 1VQKT 3CC2T 4C5EA 3J7AF 3T9NA 2X35A 3VV0A 1M90C 2JOYA 4XQ3A 2RHIA 3X28B 1KQ2A 3CC2A 2MWOA 2OTLT 4N4IA 4BE2A 4PL6A 4DQ2A 5KE3A 3QZ5B 2CZ6B 2JN0A 3V8KA 4HKEA 3J80E 2QQ9A 3S3MA 3M4YA 4EMKC 4HT8A 1G3TA 1M5Q1 1YJWT 1WNLA 2K2VA 4FM4B 4BUGA 4E7JA 3OYLA 4OB0B 2EFIA 1UEBA 3JCMW 1Y07A 3X20B 3PTAA 5GAN5 4LD9K 3EAEA 2RB6A 3GNGA 4EMKB 5CKEA 3SFMA 1PSFA 4ZTJA 4R55A 3M5AA 4M75E 1UGRB 5LJ3f 3JB9G 5KCOA 2E1HA 1Y96A 3FLGA 3CEYA 3LYIA 4N0AC 4ZGJB 4Y91A 2WACA 4X9CA 5GAN6 3LLRA 3ZEHA 1KC8C 1VQ4A 2KK4A 4RG8A 2VV5A 3HFNA 1QVPA 3V8JA 3GF5A 1VQ6T 3PFSA 1D3BA 5LJ5g 5CAIA 1NPRA 4M77D 4RG2A 3CXCA 1Q7YC 3KBGA 2F5KA 1BI3A 5GANe 1QVFS 4C0DC 4E7IA 1VQOA 3CCEA 3ZFJA 3OYHA 1QVFA 3RIRA 2LNVA 3V8LA 3JCMc 3MHXA 5I2MA 1VQ8T 4M78C 3L42A 3NFCA 1W4SA 3X25B 2DD4A 4C0DB 1VIEA 4IKFA 2LRQA 2YHTA 4RMOA 4C92F 2D9TA 4EMGA 4C92A 1DJ7B 4QQDA 5LJ3g 2CZ7B 3A8GB 4OVAA 5C6SA 4BB7A 4M78B 5LJ5d 2EJ9A 2LC4A 3I56A 3OBYA 2KAFA 5AYFA 2RHUA 4A54A 1M9SA 3VJPA 1XOVA 1ZHIA 3UPUA 3O8VA 3OMCA 5DY9A 1U8RA 2M0OA 3RMSA 4C5IA 4IUPA 1G3WA 4KT0E 3JCMd 3HPWA 4HA8A 3MP8A 5LJ3d 1LJOA 3F70A 4YTLA 1V29B 1WQWA 2WSEE 3H6ZA 3P8BB 5GANf 4BDZA 1QVGA 2LDMA 3H8ZA 2R57A 4C5GA 4ZTFA 1YJNA 4QQGA 4B9XA 4BDYA 1WPYA 3CCLT 3L2VA 2RJCA 2ZZDA 2GCXA 4XTVA 4F7UB 3CPWA 3QBYA 5M9OA 1NPPA 3JB9D 3OB9A 3OY9A 4OGCA 2DIGA 4JLGA 2ZGWA 4ZGDB 1VQMT 3L2QA 4NS5A 3MCAB 2MMPA 2Y4XA 5HKCA 1WJRA 2MI6A 5CVIA 1YIJA 3FIFA 2WSFE 1YHQA 2QA4T 4FSXA 5CCAA 3HFOA 2HQEA 3C95A 2RI3A 2XI9A 4LDUA 2QA4A 4EMKA 1QP3A 4LDYA 1KG1A 3JCMX 1WGSA 4C8QG 2KVQG 5GMKj 1JJ2S 2M16A 2P0PA 2BUDA 1S72T 2VXEA 3S3NA 2LCCA 3CCRA 4QVCA 2JTMA 2JUFA 2CS7A 4BD3A 2ZPFB 4QVZA 5GAOp 3META 5GAOn 4N0AA 4KBMB 2DVEA 2V8KA 3PT9A 4XU2A 5I21A 1WQ7A 3E9GA 3UWNA 5A0LA 3GOXA 2QXFA 1M1KU 3EFSA 1Q81U 4DOVA 3CD6A 1M1GA 1X75C 3RESA 4PJOC 2DZ9A 3QSUA 2CZ1B 4C92E 4DA4A 1UGQB 4A4FA 1BI2A 3P8HA 4EDUA 2PQWA 2VYTA 4M77C 2QQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 C;  1K9M U;  2JOY A;  1VQ9 T;  1KD1 U;  3CC2 A;  2MWO A;  3G71 T;  2OTL T;  3CC7 T;  4ZN1 A;  1KQS S;  3J80 E;  3CCS T;  1RL2 A;  1YJW T;  3CPF A;  1S72 A;  3G6E T;  1Q86 U;  3LGL A;  3CCS A;  2JNG A;  3JAM E;  1UEB A;  2KDS A;  3I55 A;  3G6E A;  1KD1 C;  3I56 T;  3CC4 T;  3OW2 A;  1N8R C;  3DB3 A;  1YI2 T;  2E70 A;  3CCU A;  1YI2 A;  1KC8 C;  1VQP T;  3LH0 A;  1VQ4 A;  3CME T;  3CCM T;  1VQ6 T;  5J3B A;  5J26 A;  1NPR A;  4RG2 A;  3G4S T;  3CXC A;  1VQP A;  3KBG A;  1YIT T;  1Q7Y C;  1YJN T;  1QVF S;  3CME A;  1VQO A;  3CCE A;  2E6Z A;  1QVF A;  1K8A U;  1VQ9 A;  2OTJ T;  1M1K C;  3G71 A;  1Q81 C;  2OTL A;  1VQ8 T;  3CC7 A;  2L3R A;  4ZN3 A;  5IAY A;  3DLL A;  2DO3 A;  3OW2 S;  1YIJ T;  5HY6 A;  1YJW A;  4QQD A;  1YHQ T;  1Q82 U;  1VQL T;  3LGF A;  1EIF A;  3DB4 A;  1K9M C;  3CMA T;  4TVR A;  2XHC A;  2IG0 A;  1YJ9 T;  1NZ9 A;  3CMA A;  1YBY A;  1VQ7 T;  3I56 A;  3CC4 A;  3CCQ T;  1NJI U;  4CRI A;  3CXC S;  3CCR T;  3CCJ T;  1Q86 C;  1XTD A;  1K73 U;  1Q82 C;  3CCV T;  1IZ6 A;  1JJ2 A;  2G3R A;  3CCM A;  1VQ6 A;  4YTL A;  2QEX T;  1QVG A;  3P8B B;  3G4S A;  1VQ5 T;  1YIT A;  1VQK T;  1VQN T;  1YJN A;  1M90 U;  3CCL T;  2QEX A;  3OYY A;  3CPW A;  3CD6 T;  1BKB A;  2OTJ A;  1NPP A;  1XNI A;  1VQ8 A;  2CKK A;  3PIO A;  3ER0 A;  1VQM T;  1K73 C;  5FLX E;  2MI6 A;  1YIJ A;  1W2B A;  1YHQ A;  5A2Q E;  2QA4 T;  1VQL A;  1X6O A;  1K8A C;  1YJ9 A;  2QA4 A;  4X34 A;  1VQ7 A;  5DM7 R;  1N8R U;  3A5Z B;  2KVQ G;  3PIP A;  2JVV A;  3CCQ A;  2EIF A;  1JJ2 S;  1S72 T;  1QVG S;  5DLQ E;  1SSF A;  3CCR A;  3CCJ A;  1KC8 U;  1KQS A;  2JUF A;  3I55 T;  3CPW S;  3J81 E;  3CCV A;  2MWP A;  1Q7Y U;  5IT9 E;  1VQ5 A;  1VQK A;  1VQN A;  1NJI C;  3HKS A;  2LVM A;  3CCU T;  3CCL A;  1M1K U;  1W2B S;  1VQ4 T;  1Q81 U;  3CD6 A;  2LCL A;  1M1G A;  5LL6 S;  3TRE A;  2LQ8 A;  1VQM A;  3CC2 T;  3J7A F;  1KHI A;  1VQO T;  3CCE T; 
#chains in the Genus database with same CATH topology
 1K9M U;  4PFZ A;  4PJO G;  4PJO B;  4M7D C;  4M78 A;  4RCB A;  3SB2 A;  4D8D A;  4LDX A;  3G6E T;  2ECZ A;  1B7T A;  1Q86 U;  1BI1 A;  1JRI A;  4M7A G;  2MF2 A;  2D6F A;  1AHJ B;  2JTF A;  2ED0 A;  3V7C A;  4BI8 B;  2CYZ B;  1JB0 E;  3FRN A;  4OMF B;  1QQJ A;  4OMN A;  3CMA Q;  1T0H A;  3NHN A;  2FHD A;  1NJI R;  2OTJ T;  2NWM A;  5CKB A;  1OEB A;  4PNO A;  4J83 A;  1N6A A;  2JXB A;  4E47 A;  1KJW A;  3A8M B;  1OUL A;  1V1C A;  2XHC A;  2IG0 A;  5GAN 4;  5GAM h;  3SHW A;  2PVO B;  3JCM J;  4PJO D;  1FX7 A;  2BE7 D;  2PZ1 A;  3TCJ A;  5FU6 B;  2R5M A;  3LW5 E;  3BFM A;  3D7S B;  3ZL7 C;  4M78 E;  1X2K A;  3SWN C;  4M7A D;  3JCM g;  1I1J A;  2L3P A;  3PGG A;  3EH1 A;  3JSC A;  4JRK A;  4RTV A;  1O75 A;  4JRP A;  3M0U A;  2KEA A;  1A0N B;  4DOW A;  3PIP A;  2JVV A;  1SEM A;  1AEY A;  3EFR A;  2CP6 A;  4J9I A;  1QVG S;  2YWW A;  3QZ9 B;  2KXD A;  4PLL A;  1OI1 A;  3J81 E;  2GBQ A;  1BCM A;  4C0Z A;  1AWO A;  4BI3 A;  2DTH A;  2J05 A;  2PTK A;  1CSK A;  2KY9 A;  2LQ8 A;  1Z9Z A;  2GF7 A;  5CR2 A;  2PVG B;  3OYI A;  3C0C A;  1YI2 Q;  1I4K 1;  3I5R A;  1QP2 A;  1I0C A;  3M53 A;  2GQV A;  1PCX A;  3SDZ A;  2EWN A;  2EJF A;  4OMQ A;  1TSF A;  5GAO l;  2E70 A;  3GPL A;  6AT1 B;  3C94 A;  1PM3 A;  2CDT A;  1H64 1;  3VKI A;  3CCM T;  2YDL A;  1LNX A;  2NYS A;  2LP5 A;  4D8K A;  1OV3 A;  1Y7X A;  2E3H A;  2O4X A;  4M7A C;  2L3R A;  1YWP A;  1K73 R;  4J5Y A;  4J7I A;  2CZ0 B;  3NMZ C;  5FWB A;  3RBB B;  5GAN j;  1M90 R;  4ESR A;  3A98 A;  1RAI B;  3CCQ T;  2XK0 A;  1KHC A;  3P8D A;  5GAM f;  1YP5 A;  1D1A A;  3QHS A;  2F1L A;  3H0I A;  1BIB A;  1RAB B;  2HSP A;  1VYU A;  3HP9 A;  1FWZ A;  2CT3 A;  3LX7 A;  1NYG A;  2HSE B;  2OTJ A;  2E41 A;  1XNI A;  2DFU A;  4C8Q A;  3PIO A;  5L23 A;  2P0Q A;  2YRC A;  3ASK A;  3E19 A;  1E6G A;  2EYW A;  5GAO r;  1YNZ A;  1BYM A;  1X43 A;  1VQ5 Q;  3L2Z A;  1JU5 C;  2C0T A;  1D09 B;  1M27 C;  2BZY A;  1IGQ A;  2V8I A;  4NL3 A;  1TG0 A;  4WF2 A;  2BZX A;  2WSC E;  1R8O B;  3NTK A;  2DEQ A;  1NJI C;  3EG9 A;  4FYW B;  2H8H A;  1ZUU A;  3VS4 A;  1C6V X;  1D0Z A;  5LL6 S;  2DLP A;  1KHI A;  2O31 A;  4M75 B;  4OMP A;  3JRZ A;  1N9S A;  4FT4 A;  2A36 A;  4FIB A;  3VYH B;  2VAS A;  4XTW A;  5LJ3 h;  2LT4 A;  4LXC A;  1M2V B;  2FPF A;  1ABO A;  1VQO Q;  2J6O A;  2K5I A;  5FU7 C;  3DB3 A;  4RTU A;  3QWY A;  4C8Q E;  1CKB A;  2A0F B;  1VQP T;  1UFF A;  3M0P A;  3O5Z A;  3OYG A;  4D6W A;  2K5F A;  5J26 A;  4F16 A;  2RK1 A;  2OX7 A;  4XAX B;  4F14 A;  4CC4 B;  4IUU A;  4E7K A;  4F7U G;  4KUL A;  2B8A A;  4KH1 B;  2E6N A;  3HRU A;  1B34 A;  1Q82 U;  2GFU A;  1CKA A;  4OF1 A;  1I8F A;  4BAC A;  4EIK A;  2DYI A;  3URG A;  2AIR B;  1N27 A;  2KBT A;  1I5L A;  2DL7 A;  1GBR A;  4LD6 A;  3OYN A;  1Q82 C;  3QUI A;  4OMO A;  2G3R A;  5KYW B;  3CCM A;  4CC2 A;  1KD1 R;  1ABQ A;  1Y96 B;  5EG2 A;  3BW1 A;  2QA4 Q;  4M75 F;  2BKD N;  2ZCF B;  1WXB A;  2QEX A;  3CD6 T;  5CO7 A;  3RKY A;  2RHZ A;  4GBQ A;  2CKK A;  5KYX A;  2QAZ A;  3QPH A;  4A4G A;  2X4X A;  4ELZ C;  1M3C A;  2AKK A;  1VOM A;  1X6O A;  2FZC B;  3PNW C;  1MV3 A;  2VUB A;  3OA6 A;  3H9N A;  3A5Z B;  3CCQ A;  2EIF A;  4M77 G;  1YCY A;  2BZ8 A;  1SSF A;  3MP1 A;  2DNU A;  2MK5 A;  1UB4 A;  1ZA2 B;  2YUN A;  2MWP A;  3OYA A;  1PWT A;  2GQI A;  2M9U A;  3CBP A;  2KI7 A;  4A4K A;  4XTU A;  1OU9 A;  4ME7 A;  5DLO A;  3CC2 T;  2ABL A;  2X35 A;  1M90 C;  1KQ2 A;  1X6B A;  2EKH A;  2OTL T;  4BE2 A;  4PL6 A;  5KE3 A;  3V8K A;  3S3M A;  3M4Y A;  4FM4 B;  4BUG A;  2G6F X;  2FPD A;  1UEB A;  1Y07 A;  3X20 B;  1Y0M A;  3GBQ A;  5GAN 5;  3PTA A;  2RB6 A;  3CME Q;  4ZTJ A;  1NG2 A;  1PSF A;  1RAF B;  4R55 A;  5LJ3 f;  1UGR B;  2WAC A;  2RNA A;  2P84 A;  1I07 A;  1VQ6 T;  2D8J A;  3V8J A;  1D3B A;  5CAI A;  4M77 D;  2V1R A;  1IXD A;  2B86 A;  1UHF A;  4C0D C;  4E7I A;  3OYH A;  1QVF A;  3JCM c;  5I2M A;  3EG2 A;  2QGF B;  3X25 B;  1UTI A;  3M0T A;  4C92 A;  2QK0 A;  1OU8 A;  2KR3 A;  1PHT A;  2RHU A;  1XOV A;  2YUP A;  4IUP A;  5LJ3 d;  1PKT A;  1QVG A;  1VQK T;  3VS2 A;  2FRY A;  2QGG A;  4IIO A;  4C5G A;  4B9X A;  1E7O A;  4BDY A;  2MOX A;  1VYV A;  4XTV A;  5KYN A;  1MND A;  4ZGD B;  1NEB A;  1ZUY A;  2Y4X A;  3FIF A;  4FSX A;  1AWW A;  5CCA A;  2K2M A;  2RI3 A;  2XI9 A;  1Q81 R;  2HKQ B;  4EMK A;  1K4U S;  2KVQ G;  1JJ2 S;  4RUG A;  2HEQ A;  5IHK A;  1K9M R;  4BD3 A;  2O88 A;  2GNC A;  2FRW A;  1MMG A;  5A0L A;  3GOX A;  3CD6 A;  1WFW A;  1Q86 R;  3RES A;  2BE9 B;  3QSU A;  4C92 E;  3CCS Q;  4A4F A;  1BI2 A;  2FZK B;  4EDU A;  4M77 C;  2VYT A;  1KD1 U;  2EYX A;  1NYF A;  3CC4 Q;  1MHN A;  4ZNX A;  1OPK A;  4M7D G;  4M7D B;  3L1A A;  5LJ3 e;  3QXE B;  2EKO A;  1KD1 C;  3I5S A;  3CC7 Q;  2DD5 A;  3VUZ A;  5KYY B;  4CC3 A;  2JT4 A;  2D8H A;  4UC4 A;  4L59 A;  1OZ2 A;  2KGT A;  1M3A A;  1R77 A;  2OTL A;  4J8O A;  5FRM A;  1RLQ C;  2F5T X;  4XTX A;  3HTR A;  1EIF A;  3GLX A;  2A3L A;  2DIQ A;  3TU4 K;  1HXD A;  2RHX A;  4N4H A;  1YJ9 T;  1ZSZ A;  2PU9 B;  1OPL A;  2O9V A;  2J6K A;  2RA2 A;  4FT2 A;  3CXC S;  2DZC A;  2IVW A;  1GXI E;  5CKF A;  1VUB A;  2QQB A;  1T3S A;  9ATC B;  4DBQ A;  3AT1 B;  1VQ6 A;  4EMH A;  4M7D D;  3M0Q A;  4PJO A;  2Y90 A;  1WLP B;  5D6Y A;  4A53 A;  3E9F A;  4MZM A;  3SWN B;  3CCV Q;  1T3L A;  1IO6 A;  1VQN Q;  3OBW A;  1M30 A;  1QCO A;  4KGZ B;  1F1B B;  1UG1 A;  2PUK B;  2QQA A;  3OSV A;  4L6V 5;  5IHN A;  3NTH A;  4JZ3 A;  4OMM A;  1FMW A;  1VQK A;  2DBK A;  2O2O A;  1IRE B;  2ED1 A;  4BE0 A;  2LMJ A;  3EFO B;  2GTJ A;  3JV3 A;  4KUD K;  4MDX A;  2XMF A;  1GCQ C;  3VS7 A;  2DXU A;  3REB B;  3OS1 A;  3QJ6 A;  4JJN K;  3SD4 A;  4ZN1 A;  5D6X A;  1AZE A;  2X4W A;  1RL2 A;  1E6H A;  4IUT A;  4J9H A;  3OYF A;  2JNG A;  1P92 A;  3RKW A;  2FVU A;  2GTO A;  3HRT A;  4RTX A;  2J06 A;  4PJO E;  3G71 Q;  2XU8 A;  4HCB A;  4HT9 A;  1AT1 B;  1C0M A;  3M58 A;  3TSZ A;  2AZV A;  3R6N A;  1IHW A;  4FW2 A;  1U06 A;  1UGV A;  2MCN A;  1K8A U;  4M7A E;  2DX1 A;  1YN8 A;  1Q81 C;  1IB8 A;  4XK8 E;  1GRI A;  1RAG B;  1UDL A;  2LNH B;  3OW2 S;  2HDA A;  4JZ4 A;  1K9M C;  4GY5 A;  4TVR A;  4M7A B;  1YIT Q;  2C0O A;  3CMA A;  3UDC A;  2I2L A;  5HK0 A;  1NEG A;  1Q86 C;  2KXC A;  3UAT A;  4Z88 A;  4X9D A;  2LJ3 A;  2VVK A;  2E12 A;  1VQ5 T;  3JB9 I;  2XDB A;  2EQK A;  2RI2 A;  7AT1 B;  4FW1 A;  3THK A;  2LZ6 B;  1RI9 A;  2LJ1 A;  3CCJ Q;  3RNJ A;  4JJD A;  1M4Z A;  5GAM g;  1YJ9 A;  4GLK A;  5IXB A;  1KC8 U;  2K4Y A;  2KE9 A;  4J9C A;  4JS5 A;  2FB7 A;  1GBQ A;  3QDR B;  4PJO F;  1IRX A;  4JRI A;  3I9Q A;  2K3Y A;  2LCL A;  5CK9 A;  1NM7 A;  2EQJ A;  5LJ5 h;  5KE2 A;  1VQO T;  4VUB A;  3GNF B;  3AHU A;  4M7A F;  2CP7 A;  3OS0 A;  4FU6 A;  3VYG A;  2O01 E;  2AT1 B;  1VQ4 Q;  3CQT A;  3JCM h;  2PUO B;  2DEU A;  3MP6 A;  1H3H A;  3LGL A;  5FRO A;  3G1J A;  1JQQ A;  2L3S A;  2EQI A;  4M78 G;  5GAO q;  1RAH B;  3X26 B;  1I81 A;  4PFO A;  2KYM A;  3RR6 A;  2CT4 A;  1M1F A;  2DF6 A;  1YI2 A;  1BB9 A;  1Q82 R;  4A4E A;  3LH0 A;  5FU7 B;  3CPW P;  2PVD B;  5J3B A;  2K5L A;  2NLU A;  2E6Z A;  3G7Z A;  3I56 Q;  2RQW A;  3VUB A;  4E2F B;  1SF9 A;  4HVU A;  3TEE A;  2XIC A;  4J6X A;  2DPP B;  1NZ9 A;  4ATO A;  1X2Q A;  2YUQ A;  4Z89 A;  2AHJ B;  4M4Z A;  2LT1 A;  3OQ5 A;  1YHQ Q;  1JJ2 A;  4MZT A;  2QEX T;  3JB9 H;  2OAU A;  5GAN 2;  4M75 A;  2YT6 A;  3OS2 A;  1W6X A;  4M78 D;  4MML A;  2RQT A;  2V1Q A;  2HD0 A;  1O9S A;  1WHM A;  1V76 A;  4B9W A;  1VYT A;  3R6O A;  2K57 A;  1M2V A;  1TU0 B;  4P5N A;  2K3X A;  1N8R U;  4C0F A;  4GLM A;  4ZGE B;  2HKN A;  4FYV B;  1RAE B;  2EQU A;  2M51 A;  5C0M A;  1JBM A;  3MKD A;  1MMA A;  4MMK A;  3I55 T;  2RM4 A;  2JS0 A;  1AVZ C;  1HJD A;  1VQ5 A;  1PSE A;  4DBR A;  1QMC A;  1BCO A;  4WCI A;  3A1P A;  3J7A F;  2ESW A;  2ROT A;  3G6E Q;  2RHI A;  3X28 B;  2JJ9 A;  2QDL A;  4N4I A;  4DQ2 A;  2DE0 X;  4HKE A;  3J80 E;  2QQ9 A;  1TUC A;  1M5Q 1;  2BTT A;  4LD9 K;  3EAE A;  1JO8 A;  2DET A;  3M5A A;  4M75 E;  5KYW A;  3JB9 G;  1KK7 A;  1Y96 A;  2KYB A;  3LYI A;  3CEY A;  4N0A C;  4ZGJ B;  2HBW A;  2DER A;  4Y91 A;  4X9C A;  5GAN 6;  2OTJ Q;  1K9A A;  1SSH A;  3LLR A;  2KK4 A;  1YJW Q;  1QVP A;  3CXC A;  2RQV A;  1UUE A;  2F5K A;  1VQO A;  3RIR A;  3MHX A;  4M78 C;  1W4S A;  4C0D B;  2LRQ A;  2YHT A;  3MPU B;  5LJ3 g;  4QQD A;  1OX8 A;  5C6S A;  1SHF A;  5LJ5 d;  4DBF A;  1PRL C;  5AYF A;  2K79 A;  1M9S A;  2RQU A;  3VJP A;  3U23 A;  1VQ8 Q;  1H92 A;  5DY9 A;  2M0O A;  3RMS A;  1TOV A;  2EBP A;  2QYZ A;  3JCM d;  1AWJ A;  3HPW A;  3MP8 A;  1YCS B;  1HSQ A;  4ZTF A;  2HMA A;  4F7U B;  1D1B A;  2JM9 A;  2HCK A;  4JJB A;  3JB9 D;  4OGC A;  2DIG A;  2ZGW A;  2J7I A;  3L2Q A;  3MCA B;  5HKC A;  1WJR A;  4KGV B;  2HQE A;  3C95 A;  1NBE B;  2OJ2 A;  4A63 B;  2QA4 A;  2IPO B;  3CCL Q;  1KG1 A;  3JCM X;  1WGS A;  4C8Q G;  5GMK j;  5D7U A;  2M16 A;  2BUD A;  4IIM A;  1VQM Q;  2RQR A;  2CS7 A;  2ZPF B;  4QVZ A;  5GAO n;  1Q95 G;  2V8K A;  3PT9 A;  2X3W D;  1M1K U;  3EFS A;  4WTO B;  1S72 Q;  1M1G A;  2DZ9 A;  4KRT A;  2CZ1 B;  2PQW A;  2EYZ A;  2DIL A;  5LJ5 e;  1KSW A;  2Y4Y A;  5L8R E;  2DXT A;  3CC7 T;  2DMO A;  2P0K A;  4M77 B;  2KT1 A;  2D0Q B;  1SPK A;  2DXB A;  3JCM e;  3JAM E;  2E4H A;  2RK2 A;  4HCK A;  4J9E A;  3I55 A;  2NUT B;  3OW2 A;  1VQ9 Q;  1WYX A;  3FJ5 A;  1BK2 A;  1J3T A;  4F7U F;  1C1A A;  1SG5 A;  2MYS A;  3VRY A;  1H8K A;  3WVE B;  1WJQ A;  4C8Q D;  3CME A;  2E10 A;  1QCF A;  4HVV A;  5GMK m;  3QII A;  3L2W A;  3CCQ Q;  3QWX X;  1TXQ A;  1Z9Q A;  4XTY A;  1VQL T;  3DB4 A;  4Y92 A;  3FEO A;  1ARK A;  1YBY A;  3JCM V;  1KFZ A;  3RER A;  1WHH A;  4CRI A;  3C12 A;  1XTD A;  5HK3 A;  3CCV T;  1M2O A;  2KQW A;  1VQN T;  2RMO A;  1PD0 A;  1W2B P;  3DLM A;  5I2S A;  5GAM j;  1ZQ1 A;  2ENM A;  2HL5 C;  1QWF A;  4M77 F;  2D0N A;  1OZ3 A;  2CRE A;  1UGS B;  4LNP A;  4M7D A;  2H3J A;  3E2U A;  3VU3 C;  1MMD A;  2NUP B;  4AG2 C;  4XU1 A;  2DTI A;  4X1V A;  5KYY A;  1SRL A;  5AT1 B;  2L89 A;  2GFA A;  3BDL A;  2E5Q A;  1YWO A;  2LVM A;  3CCU T;  3VS0 A;  3WVD B;  5FRN A;  2A08 A;  2DJZ A;  1WIE A;  2YLC A;  4JLI A;  4C8Q C;  4AFU C;  2FEI A;  2Z0W A;  1X69 A;  2HAX A;  3G71 T;  2E64 A;  2RPN A;  3FC3 A;  2RD1 A;  3Q1J A;  3HL8 A;  4DBH A;  1KIK A;  3CCS A;  1VQP Q;  2AK5 A;  3IQL A;  4FYY B;  1K8A R;  3LWH A;  1MMN A;  1X27 A;  5IHI A;  1B07 A;  2FO0 A;  3QYH B;  1WX6 A;  4Q5W A;  4KH0 B;  5GAN h;  3M54 A;  3M57 A;  4M7D E;  5FWC A;  1YIT T;  2A7Y A;  4HXJ A;  3SWN A;  1ZSG A;  1ZBJ A;  3BDU A;  1GL5 A;  4ELY C;  2JZ2 A;  1R0C B;  5ECA A;  3CC7 A;  4XU3 A;  2DYB A;  4L5G A;  2KSS A;  2HNI A;  1N5Z A;  2HQH A;  4JPB W;  3CMA T;  1QWE A;  3G4S Q;  2R58 A;  1QCN A;  2XDD A;  1AWX A;  4R56 A;  4JS4 A;  1HD3 A;  3H0H A;  3CCJ T;  3CD6 Q;  2EQM A;  4LN2 A;  4C92 G;  4QVD A;  3EFO A;  2L3Q A;  5FW9 A;  1IZ6 A;  5CIU A;  4IUV A;  1RI0 A;  1VQ7 Q;  1UHC A;  3SEM A;  1KC8 R;  4OB1 B;  5EC7 A;  3JCM b;  3MEW A;  1VQL A;  2A37 A;  1TUD A;  3ZBD A;  1U1T A;  3RDV A;  1G2B A;  2DK3 A;  2EGE A;  4A4H A;  1ZX6 A;  4RTY A;  4HCC A;  4NOY A;  2QQS A;  1PC0 A;  4J9G A;  1TTH B;  2F2X A;  3BY7 A;  3CCV A;  1Q7Y U;  3CC2 Q;  4JJC A;  2YUO A;  1BIA A;  3OYJ A;  1VQN A;  1W70 A;  1G8X A;  3UA6 A;  1XJW B;  1WHK A;  1W2B S;  1VQ4 T;  4E7Z A;  4O6J A;  1QVF P;  4Y28 E;  4BY6 C;  4M7D F;  1UE9 A;  2J6F A;  2RO0 A;  1HYO A;  1K1Z A;  2XKO C;  4HCZ A;  4V2S A;  2ZPI B;  1WHG A;  4OP0 A;  3EHR A;  4C92 D;  3QKJ A;  2MAM A;  2OI3 A;  3DKM A;  4M7A A;  3EG3 A;  3ME9 A;  2FYK A;  2L8D A;  1JXO A;  4BE1 A;  2CSQ A;  2ZPG B;  5D6W A;  3L2U A;  1Y71 A;  2RH2 A;  2KDS A;  2EJG A;  3CCE Q;  3N5B B;  4CC7 A;  3I56 T;  4OML A;  1YI2 T;  1QVG P;  2VXF A;  1MGQ A;  3CCU A;  2DKG A;  1K0X A;  1M8V A;  2DM1 A;  1PG5 B;  3V7S A;  1UGP B;  5LJ3 j;  2SRC A;  1WJS A;  4FL6 A;  1SHG A;  3FDR A;  2V26 A;  3G71 A;  5GMK h;  1BBZ A;  1D1C A;  3JCM P;  1YHQ T;  4OB3 B;  1UJY A;  3FB9 A;  2P4T A;  1PD1 A;  2CP2 A;  4AFZ C;  1YJN Q;  2HBP A;  4NL2 A;  2RF0 A;  4QKU A;  4XU0 A;  5KYU B;  1YIJ Q;  2F69 A;  3GIB A;  1MUZ A;  2L0A A;  1YIT A;  1N8R R;  3QDF A;  4AFQ C;  2ZPB B;  4RKU E;  2YSQ A;  2RHY A;  3CCR Q;  2X4Y A;  2EVR A;  1G83 A;  1HK9 A;  4J6W A;  5GAN d;  3HHT B;  2EAY A;  3PE0 A;  4C92 C;  1K8A C;  1KQS P;  4AFS C;  3INZ A;  3L2R A;  1GFC A;  2L5Q A;  1XQH A;  3TQ7 P;  5DLQ E;  3CCJ A;  2CP5 A;  2LX9 A;  2IIM A;  5IT9 E;  3RKX A;  3EGD B;  2ZAE A;  1TUG B;  2RI5 A;  2JS2 A;  4C5E A;  3T9N A;  1M8M A;  2MWO A;  3EHQ A;  1Y57 A;  2JN0 A;  3QZ5 B;  4EMK C;  1G3T A;  3EGX B;  1K0S A;  1WDX A;  1YJW T;  1OQK A;  3JCM W;  3GNG A;  5IXF A;  3SFM A;  2E1H A;  2EYY A;  1TWB A;  2CP0 A;  4PK4 A;  1KC8 C;  1ZLM A;  1VQ4 A;  1IGU A;  2VV5 A;  4AT1 B;  2X3X D;  3HFN A;  3PFS A;  5LJ5 g;  1NPR A;  4RG2 A;  4RTT A;  1QVF S;  5GAN e;  3ZFJ A;  1YJ9 Q;  1RUW A;  4Z8A A;  1VQ8 T;  3L42 A;  1VIE A;  4IKF A;  1WHL A;  2D9T A;  1DJ7 B;  2CZ7 B;  4OVA A;  4BB7 A;  4M78 B;  3I56 A;  1WI7 A;  2KAF A;  3OBY A;  3VS6 A;  1YFN A;  4B6M A;  1U8R A;  1PRM C;  2GGR A;  4KT0 E;  4HA8 A;  1RAD B;  2X51 A;  3F70 A;  1V29 B;  1WQW A;  2WSE E;  2LDM A;  3H8Z A;  2R57 A;  2K6D A;  1GCP A;  4QQG A;  2M02 A;  1OX9 A;  1WPY A;  3CCL T;  3L2V A;  1NPP A;  2CH4 A;  1X6G A;  3OB9 A;  3VRZ A;  3OY9 A;  4JLG A;  1VQM T;  4NS5 A;  1VA7 A;  2MI6 A;  2JTE A;  5CVI A;  1YHQ A;  2QA4 T;  2H3E B;  1M1K R;  1OOT A;  1QP3 A;  4LDY A;  1ZSZ C;  3PVQ A;  1B3Q A;  3BE3 A;  1S72 T;  2LCC A;  4QVC A;  2JTM A;  1AOJ A;  1D0X A;  3MET A;  2LCS A;  4AMC A;  4FSS A;  2DVE A;  4XU2 A;  2QAS A;  1WQ7 A;  3E9G A;  3UWN A;  5GJW B;  4DOV A;  1X75 C;  4PJO C;  2ROL A;  4DA4 A;  1UGQ B;  2JW4 A;  2QQR A;  4J9D A;  5J39 A;  1VQ9 T;  4M78 F;  3C4S A;  2LQN A;  3OYC A;  2DVJ A;  1KQS S;  2KMT A;  3CBO A;  5IN1 A;  3OSS C;  5CKH A;  2CUB A;  1G5V A;  3RMQ A;  3G6E A;  1N8R C;  3OYB A;  5GMK l;  2C06 A;  2E65 A;  2F2W A;  2DJQ A;  2R5A A;  4F7U A;  3CME T;  2LQW A;  2VGM A;  4J7F A;  5LJ5 f;  2XID A;  4BI4 A;  4OGE A;  1U1S A;  4IUQ A;  2DL8 A;  1EFN A;  3UT1 A;  5A0G A;  5IAY A;  2RJD A;  2F2V A;  5GMK e;  2DO3 A;  5HY6 A;  1YJW A;  1FXX A;  3JCM f;  2CGH A;  2RJE A;  2K3B A;  2LTO A;  4F04 B;  1QKW A;  2HZY A;  4PJM A;  4PJN A;  1M3B A;  5FU6 C;  1NJI U;  1LCK A;  2DRM A;  1VIF A;  3A8O B;  3VS3 A;  1ZBX A;  2W10 A;  4OB2 B;  3M0R A;  2DTO A;  2RN8 A;  3OYY A;  5GAM d;  4ANJ A;  1VQ8 A;  4KGX B;  4M77 A;  3ER0 A;  5CKD A;  3PMI A;  3M55 A;  5FLX E;  5KCH A;  1W1F A;  3HSB A;  1W2B A;  3E1S A;  4M75 G;  2O4X B;  1ACM B;  2QDY B;  4O5V A;  5DM7 R;  2NUT A;  4PFP A;  3ULR B;  4F7U E;  2HL3 A;  4PKC C;  5GMK i;  3CPW S;  4FYX B;  4DEY A;  3HKS A;  4LE9 A;  3OYE A;  3CCL A;  1GFD A;  3EH2 A;  3OYM A;  2V8J A;  1SKU B;  1U5S A;  1IHV A;  2CP3 A;  1LVK A;  2YRD A;  5CQY A;  1VQM A;  1BI0 A;  1FYN A;  3JB9 F;  4C8Q B;  3PMT A;  4IUR A;  4AG1 C;  3RUX A;  3TSW A;  3CCS T;  5GJV B;  1LPL A;  1S72 A;  3CPF A;  3OYD A;  1PNJ A;  2C0I A;  3QYG B;  3MO8 A;  2X4J A;  3M56 A;  2YXY A;  3CC4 T;  2DBM A;  2M1H A;  3A8H B;  4J9F A;  1JJ2 P;  4LDW A;  1NLP C;  3GP8 A;  4JRQ A;  2FG0 A;  4Z02 A;  3KUF A;  5GAM e;  4M77 E;  2I0N A;  4M75 D;  3VS5 A;  3G4S T;  3REA B;  3EG9 B;  1EX4 A;  4K11 A;  1OYX A;  3S3O A;  4PJL A;  1VQ9 A;  2FL7 A;  1M1K C;  1KQ1 A;  2KRM A;  5GAO m;  2XDP A;  3DLL A;  4QW2 A;  1G3Y A;  1TH7 A;  2NUP A;  3OS5 A;  3CCM Q;  3LGF A;  2VKN A;  2BIV A;  1WXU A;  1VQ7 T;  5A0D A;  2QEX Q;  1T0J A;  4E7S A;  8AT1 B;  2A28 A;  2QTX A;  1X01 A;  3NGP A;  1K73 U;  2QI2 A;  4QQ6 A;  3OYK A;  1M90 U;  4J6Y A;  3MJX A;  1NLO C;  1S1N A;  3QO3 A;  1BKB A;  1QKX A;  4C8Q F;  3H0F A;  1GCQ A;  2RJF A;  1K73 C;  4EPC A;  1Q7Y R;  5A2Q E;  5GAN 8;  3I55 Q;  2JMC A;  4DEX A;  2CH4 W;  1NE8 A;  1H3Z A;  2DXC A;  3JB9 J;  3A8L B;  2YLB A;  1B34 B;  4KUI A;  1FMV A;  1SRM A;  3MEA A;  4II1 A;  4JUV A;  2LQK A;  2KT8 A;  4XTZ A;  4E7H A;  2HQX A;  3CXC P;  5I11 A;  3OMG A;  4M75 C;  3MEU A;  4F17 A;  2MPX C;  3S6W A;  1BU1 A;  1AD5 A;  1RAA B;  3CCE T;  2FPE A;  2FZG B;  4BY6 B;  5KYX B;  4RCC A;  2VB6 A;  3EGU A;  3M59 A;  1PKS A;  3H41 A;  2AKL A;  2ATC B;  1AZG B;  2YRV A;  4LUE A;  4RTW A;  1WZO A;  3X24 B;  2P4R A;  1I5O B;  2EGA A;  5LJ5 j;  2E5K A;  2DL3 A;  2ZPH B;  3KFV A;  4RTZ A;  2ZPE B;  5GAN 7;  4MDW A;  2EGC A;  1VQP A;  4PLI A;  4JDS A;  4CI0 C;  1YJN T;  2K7A A;  3M0S A;  3LWI A;  2VGN A;  2X9H A;  4ZN3 A;  3M9Q A;  1G3S A;  4C5H A;  2XG8 D;  1YIJ T;  2E3I A;  4MZP A;  1LOJ A;  3FJP A;  2VC8 A;  2CUD A;  3CC4 A;  5KH6 A;  2K9G A;  2JM8 A;  3CCR T;  1FMK A;  3HRS A;  5GAN g;  1QW1 A;  2COY A;  4LDV A;  3WXM B;  1UJ0 A;  2DAQ A;  1QLY A;  2VWF A;  3G4S A;  3QJY A;  3KXT A;  3JCM Q;  5CQX A;  4E7L A;  1D3B B;  2KRS A;  2AZS A;  3M4G A;  5IH2 A;  2XD0 A;  4E6R A;  1VQ7 A;  4X34 A;  2W0Z A;  2DA9 A;  3QG1 A;  3OW2 P;  4C0G A;  4C92 B;  1N9R A;  4N4G A;  3NTI A;  3MEV A;  1KQS A;  2EYQ A;  2DRK A;  3CBM A;  3TRE A;  5GAN 3;  1MNE A;  3V7R A;  1D0Y A;  3VV0 A;  2JOY A;  4XQ3 A;  3CC2 A;  2COW A;  2CZ6 B;  2KRO A;  2CSI A;  4HT8 A;  1WNL A;  2K2V A;  4E7J A;  3OYL A;  4OB0 B;  2EFI A;  2L2P A;  5KYU A;  4EMK B;  5CKE A;  5KCO A;  8ATC B;  2OTL Q;  4J9B A;  3FLG A;  1WHJ A;  3ZEH A;  4RG8 A;  2COZ A;  3GF5 A;  1MV0 B;  1Q7Y C;  3KBG A;  1BI3 A;  1VQL Q;  1WXT A;  3EG1 A;  3VS1 A;  1ZA1 B;  3CCE A;  4QT7 A;  2M0Y A;  2LNV A;  3LH5 A;  3V8L A;  5I22 A;  3NFC A;  2DD4 A;  2QG9 B;  1R0B G;  1WA7 A;  4RMO A;  4C92 F;  4EMG A;  1VQ6 Q;  3A8G B;  1RAC B;  1TS9 A;  2NUZ A;  3UF4 A;  2EJ9 A;  2LC4 A;  2DL5 A;  1U3O A;  5HCK A;  4A54 A;  2QTV A;  1ZHI A;  3UPU A;  2LJ0 A;  2PNI A;  3O8V A;  3OMC A;  4C5I A;  2LX7 A;  2KRN A;  3EGD A;  3TVT A;  1EZZ B;  1G3W A;  4PJJ A;  1ZUK A;  1LJO A;  4YTL A;  3H6Z A;  3P8B B;  5GAN f;  4BDZ A;  1YJN A;  1K76 A;  3NPF A;  2RJC A;  2ZZD A;  2GCX A;  4HVW A;  3CPW A;  3QBY A;  5M9O A;  2O9S A;  2JMA A;  2MMP A;  3EGX A;  4FCY A;  1YIJ A;  2WSF E;  2DL4 A;  1VQK Q;  3HFO A;  3UA7 A;  4LDU A;  2P0P A;  1JXM A;  3CCU Q;  3I35 A;  2VXE A;  3S3N A;  3CCR A;  2MIO A;  2EW3 A;  4R0K A;  2JUF A;  1ZSZ B;  1RLP C;  5GAO p;  4ORZ A;  4N0A A;  4KBM B;  2EPD A;  5I21 A;  1JEG A;  4LUD A;  2KNB B;  3PVL A;  2OAW A;  2QXF A;  1Q81 U;  1UEC A;  3P8H A;  2SEM A;  2D1X A;  3EG0 A; 
#chains in the Genus database with same CATH homology
 5J39 A;  1K9M U;  4PJO G;  5LJ5 e;  1VQ9 T;  1KD1 U;  4PJO B;  2Y4Y A;  4M78 F;  3C4S A;  4M7D C;  4M78 A;  4RCB A;  5L8R E;  2DXT A;  3SB2 A;  3OYC A;  3CC7 T;  2P0K A;  4M77 B;  1KQS S;  1MHN A;  2KMT A;  2D0Q B;  4LDX A;  3CBO A;  5IN1 A;  3OSS C;  4M7D G;  2DXB A;  3G6E T;  4M7D B;  1Q86 U;  3L1A A;  1BI1 A;  5CKH A;  3JCM e;  3JAM E;  2RK2 A;  5LJ3 e;  1G5V A;  3QXE B;  3RMQ A;  3I55 A;  1JRI A;  3G6E A;  2EKO A;  4M7A G;  2MF2 A;  3OW2 A;  1KD1 C;  1N8R C;  3OYB A;  2D6F A;  1AHJ B;  2JTF A;  5GMK l;  2C06 A;  2E65 A;  3V7C A;  2DD5 A;  2CYZ B;  4BI8 B;  3VUZ A;  4F7U F;  2R5A A;  4F7U A;  1JB0 E;  3WVE B;  3CME T;  1WJQ A;  4C8Q D;  3FRN A;  4OMF B;  4UC4 A;  4L59 A;  1OZ2 A;  2VGM A;  4J7F A;  3CME A;  5LJ5 f;  2FHD A;  2XID A;  2E10 A;  4BI4 A;  5CKB A;  2OTJ T;  2OTL A;  4OGE A;  1U1S A;  4IUQ A;  4PNO A;  3QII A;  4J83 A;  4J8O A;  3UT1 A;  5GMK m;  5A0G A;  5IAY A;  3L2W A;  2RJD A;  1N6A A;  5FRM A;  5GMK e;  2DO3 A;  2F5T X;  4E47 A;  5HY6 A;  1YJW A;  3A8M B;  4XTX A;  4XTY A;  1VQL T;  1EIF A;  3DB4 A;  1FXX A;  2A3L A;  2CGH A;  3GLX A;  3JCM f;  2DIQ A;  3FEO A;  2XHC A;  1HXD A;  2IG0 A;  2RHX A;  4N4H A;  2RJE A;  5GAM h;  1YBY A;  5GAN 4;  3TU4 K;  2LTO A;  1YJ9 T;  2PU9 B;  3JCM V;  2RA2 A;  2PVO B;  4FT2 A;  5FU6 C;  1NJI U;  3RER A;  4CRI A;  3JCM J;  3CXC S;  4PJO D;  2DZC A;  1FX7 A;  2IVW A;  5CKF A;  1VUB A;  3C12 A;  1GXI E;  1XTD A;  1VIF A;  3TCJ A;  5HK3 A;  3A8O B;  2QQB A;  3CCV T;  1ZBX A;  5FU6 B;  2KQW A;  2R5M A;  1VQ6 A;  3LW5 E;  4OB2 B;  4EMH A;  3BFM A;  1VQN T;  4M7D D;  2DTO A;  4M78 E;  3DLM A;  5I2S A;  5GAM j;  1ZQ1 A;  3SWN C;  3OYY A;  4PJO A;  5GAM d;  4M7A D;  2Y90 A;  3JCM g;  1VQ8 A;  4M77 F;  4M77 A;  5D6Y A;  3ER0 A;  4A53 A;  5CKD A;  3E9F A;  1OZ3 A;  3PMI A;  1UGS B;  3M55 A;  4MZM A;  3SWN B;  5FLX E;  3PGG A;  5KCH A;  3HSB A;  1W2B A;  4M7D A;  2H3J A;  3JSC A;  4JRK A;  1O75 A;  3E1S A;  4JRP A;  4M75 G;  2O4X B;  2QDY B;  4O5V A;  5DM7 R;  3OBW A;  4DOW A;  3PIP A;  2JVV A;  3VU3 C;  3EFR A;  4F7U E;  1QVG S;  4PKC C;  2PUK B;  3QZ9 B;  2QQA A;  3OSV A;  4PLL A;  4XU1 A;  2DTI A;  1OI1 A;  4L6V 5;  5GMK i;  3J81 E;  3CPW S;  3NTH A;  1VQK A;  2L89 A;  2GFA A;  3BDL A;  2E5Q A;  3HKS A;  2LVM A;  4C0Z A;  1IRE B;  3CCU T;  4BI3 A;  3OYE A;  3CCL A;  2DTH A;  3OYM A;  4BE0 A;  2V8J A;  3WVD B;  2KY9 A;  5FRN A;  2DJZ A;  2YLC A;  4KUD K;  4MDX A;  4JLI A;  5CQY A;  4C8Q C;  2LQ8 A;  1VQM A;  2DXU A;  1BI0 A;  3OS1 A;  2GF7 A;  3QJ6 A;  2HAX A;  5CR2 A;  3G71 T;  2PVG B;  4JJN K;  3JB9 F;  2E64 A;  4C8Q B;  3SD4 A;  3OYI A;  3PMT A;  4ZN1 A;  3FC3 A;  4IUR A;  3RUX A;  2RD1 A;  5D6X A;  1I4K 1;  3CCS T;  3Q1J A;  1QP2 A;  2X4W A;  3HL8 A;  1RL2 A;  1S72 A;  3CPF A;  3M53 A;  3OYD A;  3CCS A;  4IUT A;  3OYF A;  2GQV A;  2JNG A;  3QYG B;  3MO8 A;  3SDZ A;  1P92 A;  3RKW A;  2EWN A;  2EJF A;  2FVU A;  3HRT A;  3LWH A;  2X4J A;  3M56 A;  3CC4 T;  3A8H B;  2M1H A;  4PJO E;  4LDW A;  2XU8 A;  5GAO l;  3GP8 A;  4JRQ A;  4Z02 A;  2E70 A;  3KUF A;  5GAM e;  4HCB A;  4M77 E;  3GPL A;  4M75 D;  4HT9 A;  3C94 A;  3QYH B;  4Q5W A;  1H64 1;  3VKI A;  3M54 A;  3M58 A;  5GAN h;  3M57 A;  3CCM T;  4M7D E;  3G4S T;  1LNX A;  1YIT T;  2A7Y A;  3SWN A;  1OYX A;  3BDU A;  3S3O A;  1K8A U;  4ELY C;  1VQ9 A;  4M7A E;  2FL7 A;  1M1K C;  1Q81 C;  1Y7X A;  1KQ1 A;  2JZ2 A;  2O4X A;  3CC7 A;  4M7A C;  5GAO m;  2L3R A;  4XU3 A;  2XDP A;  4XK8 E;  3DLL A;  4L5G A;  4J5Y A;  2KSS A;  2HNI A;  2CZ0 B;  4J7I A;  4QW2 A;  3OW2 S;  1G3Y A;  1TH7 A;  3CMA T;  3OS5 A;  3LGF A;  1K9M C;  4GY5 A;  4TVR A;  5GAN j;  4M7A B;  2R58 A;  2BIV A;  3CMA A;  1VQ7 T;  5A0D A;  3UDC A;  2XDD A;  3CCQ T;  2I2L A;  2XK0 A;  4R56 A;  5HK0 A;  1KHC A;  3P8D A;  4JS4 A;  5GAM f;  3CCJ T;  2EQM A;  2QTX A;  1Q86 C;  4C92 G;  1X01 A;  3QHS A;  4QVD A;  1K73 U;  2QI2 A;  1BIB A;  1IZ6 A;  5CIU A;  4X9D A;  4QQ6 A;  3HP9 A;  2E12 A;  1RI0 A;  4IUV A;  1VQ5 T;  1FWZ A;  3OYK A;  3JB9 I;  2XDB A;  2EQK A;  2RI2 A;  1M90 U;  3LX7 A;  4J6Y A;  3QO3 A;  1BKB A;  2OTJ A;  2E41 A;  4C8Q F;  1XNI A;  4OB1 B;  4C8Q A;  2RJF A;  3PIO A;  2P0Q A;  1K73 C;  4EPC A;  3ASK A;  3JCM b;  3MEW A;  3E19 A;  5A2Q E;  5GAN 8;  1VQL A;  5GAO r;  1M4Z A;  1BYM A;  3ZBD A;  3L2Z A;  1U1T A;  5GAM g;  2DK3 A;  1YJ9 A;  4GLK A;  4A4H A;  1NE8 A;  1H3Z A;  2DXC A;  3JB9 J;  3A8L B;  4HCC A;  2YLB A;  4NOY A;  1B34 B;  2QQS A;  4KUI A;  2V8I A;  4NL3 A;  4WF2 A;  1KC8 U;  3MEA A;  4II1 A;  2K4Y A;  4JUV A;  2LQK A;  4JS5 A;  2FB7 A;  2WSC E;  1R8O B;  3BY7 A;  3CCV A;  3NTK A;  3QDR B;  1Q7Y U;  4PJO F;  4XTZ A;  1BIA A;  2DEQ A;  3OYJ A;  4E7H A;  1NJI C;  2HQX A;  1VQN A;  1W2B S;  3OMG A;  4JRI A;  4M75 C;  1VQ4 T;  2K3Y A;  2LCL A;  4O6J A;  5LL6 S;  3MEU A;  4Y28 E;  5CK9 A;  2EQJ A;  4BY6 C;  2RO0 A;  2XKO C;  5LJ5 h;  3S6W A;  4HCZ A;  5KE2 A;  4M7D F;  4V2S A;  1KHI A;  2ZPI B;  4OP0 A;  1VQO T;  3CCE T;  4M75 B;  4VUB A;  4C92 D;  3GNF B;  3QKJ A;  3JRZ A;  2MAM A;  1N9S A;  3DKM A;  3AHU A;  4FT4 A;  4M7A A;  4M7A F;  4BY6 B;  3OS0 A;  3ME9 A;  4FU6 A;  2O01 E;  4RCC A;  2FYK A;  4FIB A;  3VYG A;  2L8D A;  3M59 A;  4BE1 A;  3VYH B;  2ZPG B;  4XTW A;  5D6W A;  3JCM h;  2PUO B;  5LJ3 h;  2YRV A;  3MP6 A;  2LT4 A;  3L2U A;  3LGL A;  5FRO A;  3X24 B;  1Y71 A;  2RH2 A;  2KDS A;  5LJ5 j;  2EJG A;  3N5B B;  4M78 G;  2K5I A;  5FU7 C;  5GAO q;  3I56 T;  3DB3 A;  2ZPH B;  1I81 A;  3X26 B;  1YI2 T;  2VXF A;  1MGQ A;  2ZPE B;  4C8Q E;  5GAN 7;  1M1F A;  3CCU A;  2DKG A;  4MDW A;  1YI2 A;  1M8V A;  1VQP T;  4A4E A;  3LH0 A;  5FU7 B;  3OYG A;  4D6W A;  2PVD B;  3V7S A;  1UGP B;  5J3B A;  2K5F A;  5J26 A;  5LJ3 j;  1VQP A;  2K5L A;  4PLI A;  4JDS A;  2RK1 A;  4CI0 C;  4XAX B;  1YJN T;  1WJS A;  2NLU A;  2E6Z A;  3G7Z A;  3LWI A;  2VGN A;  4FL6 A;  4IUU A;  3FDR A;  4E7K A;  3G71 A;  5GMK h;  3VUB A;  4ZN3 A;  4F7U G;  4KUL A;  2B8A A;  3M9Q A;  1G3S A;  4C5H A;  2E6N A;  3HRU A;  3JCM P;  2XG8 D;  1B34 A;  3TEE A;  1YIJ T;  4MZP A;  2GFU A;  4OB3 B;  1YHQ T;  1LOJ A;  3FB9 A;  1Q82 U;  2XIC A;  3FJP A;  4OF1 A;  2P4T A;  1I8F A;  4J6X A;  4BAC A;  2DPP B;  1NZ9 A;  4ATO A;  3URG A;  2VC8 A;  3CC4 A;  5KH6 A;  1N27 A;  1I5L A;  2AHJ B;  2HBP A;  4LD6 A;  3CCR T;  2LT1 A;  3HRS A;  3OQ5 A;  3OYN A;  4NL2 A;  1Q82 C;  3QUI A;  4XU0 A;  5GAN g;  3GIB A;  2F69 A;  2G3R A;  1QW1 A;  4LDV A;  4MZT A;  3WXM B;  3CCM A;  2DAQ A;  1JJ2 A;  2QEX T;  3JB9 H;  3G4S A;  1Y96 B;  5EG2 A;  1YIT A;  2OAU A;  3QJY A;  5GAN 2;  3BW1 A;  3KXT A;  4M75 F;  2BKD N;  2ZCF B;  4M75 A;  3JCM Q;  2QEX A;  2ZPB B;  4RKU E;  5CQX A;  3OS2 A;  4E7L A;  3CD6 T;  2RHY A;  5CO7 A;  3RKY A;  2RHZ A;  4M78 D;  4MML A;  2CKK A;  1D3B B;  2X4Y A;  3M4G A;  2HD0 A;  3QPH A;  1O9S A;  4A4G A;  2X4X A;  4J6W A;  1HK9 A;  4ELZ C;  5GAN d;  3HHT B;  2XD0 A;  2EAY A;  1X6O A;  4B9W A;  4C92 C;  1K8A C;  3PNW C;  3R6O A;  2VUB A;  2K57 A;  3INZ A;  4P5N A;  3OA6 A;  2K3X A;  4X34 A;  1VQ7 A;  1N8R U;  4C0F A;  3L2R A;  2L5Q A;  1XQH A;  3A5Z B;  4ZGE B;  3CCQ A;  3QG1 A;  2EIF A;  4M77 G;  1YCY A;  4C0G A;  4C92 B;  1N9R A;  5DLQ E;  1SSF A;  4N4G A;  2EQU A;  3CCJ A;  5C0M A;  1JBM A;  3MP1 A;  3NTI A;  1UB4 A;  3MEV A;  4MMK A;  3I55 T;  1KQS A;  2LX9 A;  2RM4 A;  2EYQ A;  2MWP A;  3OYA A;  5IT9 E;  1VQ5 A;  2M9U A;  1PSE A;  3RKX A;  3CBP A;  4A4K A;  3CBM A;  4XTU A;  2RI5 A;  3TRE A;  5GAN 3;  4ME7 A;  3V7R A;  5DLO A;  1VQK T;  3CC2 T;  4C5E A;  3J7A F;  3T9N A;  2X35 A;  3VV0 A;  1M90 C;  2JOY A;  4XQ3 A;  2RHI A;  3X28 B;  1KQ2 A;  3CC2 A;  2MWO A;  2OTL T;  4N4I A;  4BE2 A;  4PL6 A;  4DQ2 A;  5KE3 A;  3QZ5 B;  2CZ6 B;  2JN0 A;  3V8K A;  4HKE A;  3J80 E;  2QQ9 A;  3S3M A;  3M4Y A;  4EMK C;  4HT8 A;  1G3T A;  1M5Q 1;  1YJW T;  1WNL A;  2K2V A;  4FM4 B;  4BUG A;  4E7J A;  3OYL A;  4OB0 B;  2EFI A;  1UEB A;  3JCM W;  1Y07 A;  3X20 B;  3PTA A;  5GAN 5;  4LD9 K;  3EAE A;  2RB6 A;  3GNG A;  4EMK B;  5CKE A;  3SFM A;  1PSF A;  4ZTJ A;  4R55 A;  3M5A A;  4M75 E;  1UGR B;  5LJ3 f;  3JB9 G;  5KCO A;  2E1H A;  1Y96 A;  3FLG A;  3CEY A;  3LYI A;  4N0A C;  4ZGJ B;  4Y91 A;  2WAC A;  4X9C A;  5GAN 6;  3LLR A;  3ZEH A;  1KC8 C;  1VQ4 A;  2KK4 A;  4RG8 A;  2VV5 A;  3HFN A;  1QVP A;  3V8J A;  3GF5 A;  1VQ6 T;  3PFS A;  1D3B A;  5LJ5 g;  5CAI A;  1NPR A;  4M77 D;  4RG2 A;  3CXC A;  1Q7Y C;  3KBG A;  2F5K A;  1BI3 A;  5GAN e;  1QVF S;  4C0D C;  4E7I A;  1VQO A;  3CCE A;  3ZFJ A;  3OYH A;  1QVF A;  3RIR A;  2LNV A;  3V8L A;  3JCM c;  3MHX A;  5I2M A;  1VQ8 T;  4M78 C;  3L42 A;  3NFC A;  1W4S A;  3X25 B;  2DD4 A;  4C0D B;  1VIE A;  4IKF A;  2LRQ A;  2YHT A;  4RMO A;  4C92 F;  2D9T A;  4EMG A;  4C92 A;  1DJ7 B;  4QQD A;  5LJ3 g;  2CZ7 B;  3A8G B;  4OVA A;  5C6S A;  4BB7 A;  4M78 B;  5LJ5 d;  2EJ9 A;  2LC4 A;  3I56 A;  3OBY A;  2KAF A;  5AYF A;  2RHU A;  4A54 A;  1M9S A;  3VJP A;  1XOV A;  1ZHI A;  3UPU A;  3O8V A;  3OMC A;  5DY9 A;  1U8R A;  2M0O A;  3RMS A;  4C5I A;  4IUP A;  1G3W A;  4KT0 E;  3JCM d;  3HPW A;  4HA8 A;  3MP8 A;  5LJ3 d;  1LJO A;  3F70 A;  4YTL A;  1V29 B;  1WQW A;  2WSE E;  3H6Z A;  3P8B B;  5GAN f;  4BDZ A;  1QVG A;  2LDM A;  3H8Z A;  2R57 A;  4C5G A;  4ZTF A;  1YJN A;  4QQG A;  4B9X A;  4BDY A;  1WPY A;  3CCL T;  3L2V A;  2RJC A;  2ZZD A;  2GCX A;  4XTV A;  4F7U B;  3CPW A;  3QBY A;  5M9O A;  1NPP A;  3JB9 D;  3OB9 A;  3OY9 A;  4OGC A;  2DIG A;  4JLG A;  2ZGW A;  4ZGD B;  1VQM T;  3L2Q A;  4NS5 A;  3MCA B;  2MMP A;  2Y4X A;  5HKC A;  1WJR A;  2MI6 A;  5CVI A;  1YIJ A;  3FIF A;  2WSF E;  1YHQ A;  2QA4 T;  4FSX A;  5CCA A;  3HFO A;  2HQE A;  3C95 A;  2RI3 A;  2XI9 A;  4LDU A;  2QA4 A;  4EMK A;  1QP3 A;  4LDY A;  1KG1 A;  3JCM X;  1WGS A;  4C8Q G;  2KVQ G;  5GMK j;  1JJ2 S;  2M16 A;  2P0P A;  2BUD A;  1S72 T;  2VXE A;  3S3N A;  2LCC A;  3CCR A;  4QVC A;  2JTM A;  2JUF A;  2CS7 A;  4BD3 A;  2ZPF B;  4QVZ A;  5GAO p;  3MET A;  5GAO n;  4N0A A;  4KBM B;  2DVE A;  2V8K A;  3PT9 A;  4XU2 A;  5I21 A;  1WQ7 A;  3E9G A;  3UWN A;  5A0L A;  3GOX A;  2QXF A;  1M1K U;  3EFS A;  1Q81 U;  4DOV A;  3CD6 A;  1M1G A;  1X75 C;  3RES A;  4PJO C;  2DZ9 A;  3QSU A;  2CZ1 B;  4C92 E;  4DA4 A;  1UGQ B;  4A4F A;  1BI2 A;  3P8H A;  4EDU A;  2PQW A;  2VYT A;  4M77 C;  2QQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...