2KDSA

Structure of ribosomal protein l14e from sulfolobus solfataricus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
PAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L14e
publication title Structure and Stability of the Archael L14e Ribosomal Protein from Sulfolobus solfataricus
rcsb
source organism Sulfolobus solfataricus
molecule tags Ribosomal protein
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kdsA01
5J26A 3I55T 1VQ4T 2MWOA 3G6EA 3CCVT 3CMAT 1SSFA 1VQ6T 3CD6T 2JOYA 3CCLT 3CCET 2OTLT 3TREA 1VQ7A 3CPFA 3KBGA 3CPWS 3I56T 3CPWA 3CCQT 3I55A 1VQ4A 1KD1C 3LH0A 3CCVA 3CMAA 1NJIC 1Q82C 1VQ6A 4QQDA 3CD6A 3CCJT 3CCEA 1S72T 2OTLA 3CCLA 1XTDA 2MWPA 1VQ9T 3I56A 2QEXT 3CCQA 1K8AC 3CCJA 1S72A 3J81E 3CCRT 1RL2A 1M90U 1VQ9A 5IT9E 3PIOA 3CCUT 2E70A 1YJWT 3G71T 3CMET 2DO3A 1VQPT 1K9MU 1YBYA 3LGLA 2JNGA 3J80E 1NPPA 1M1KU 3CCRA 1KC8C 3CC4T 2E6ZA 1NPRA 1N8RC 1VQKT 3CCUA 1Q81U 1IZ6A 1YJWA 3G71A 3CMEA 1VQLT 1VQPA 3DLLA 1X6OA 5LL6S 3PIPA 1VQ5T 3CC4A 1VQKA 3A5ZB 1VQOT 1YIJT 1Q86U 1YJNT 1VQLA 1EIFA 2JVVA 4YTLA 5DM7R 1JJ2S 1KD1U 1VQ5A 1QVFS 1Q7YU 1QVFA 2JUFA 2G3RA 2IG0A 1YIJA 2QEXA 1YJNA 2LVMA 3JAME 1QVGS 2QA4T 1QVGA 1VQ8T 4X34A 1KQSS 1KQSA 3G4ST 5A2QE 5HY6A 3J7AF 1YHQT 1K73U 5J3BA 4ZN3A 1UEBA 2KDSA 3OYYA 2L3RA 1VQ8A 2QA4A 1YJ9T 1M90C 3G4SA 2OTJT 1YHQA 4RG2A 1K9MC 4TVRA 1M1KC 1YJ9A 5FLXE 2OTJA 3OW2S 1Q81C 3OW2A 1JJ2A 3DB3A 2EIFA 1NJIU 3CC7T 2LQ8A 1Q82U 2XHCA 1VQOA 1VQNT 3LGFA 1Q86C 1K8AU 1YI2T 3CC7A 3CCST 1XNIA 5DLQE 1NZ9A 1VQNA 1Q7YC 2KVQG 1YITT 1KHIA 3CC2T 2MI6A 3CCMT 3ER0A 1YI2A 3CCSA 1VQMT 2CKKA 3P8BB 1K73C 1KC8U 3DB4A 1M1GA 3G6ET 1N8RU 5IAYA 1YITA 3CC2A 4CRIA 3CCMA 1W2BS 3CXCS 1W2BA 3CXCA 2LCLA 1VQ7T 1VQMA 1BKBA 3HKSA 4ZN1A
chains in the Genus database with same CATH superfamily
5I21A 4EMKC 2ZGWA 1ZSZA 4Y28E 2C0TA 2VGMA 2AKLA 3CPFA 3EHQA 3SFMA 3HTRA 3OYMA 1BCMA 3CC4Q 3FEOA 1HYOA 2COYA 2ZPHB 5GANh 3P8DA 3CCLA 3OYEA 3VS4A 4Z89A 3OYJA 3ZBDA 3MP8A 2RMOA 2I0NA 3CCRT 3JCMf 2CDTA 2LMJA 2ZZDA 4M75C 1YJWT 2EQIA 3JCMJ 1ZBJA 5GMKl 3BDUA 2KT8A 1VYVA 4ME7A 4PJOE 2QQAA 1OU9A 2AHJB 3R6OA 2KRNA 4JS5A 1HD3A 2NWMA 1JJ2P 2R57A 2HZYA 2RB6A 1SG5A 1QVFS 5GJVB 1PM3A 2IPOB 5IH2A 3VJPA 3RIRA 1FMWA 3QWXX 1YHQT 2L3SA 2DRKA 4IKFA 2XU8A 4X9CA 1JEGA 2L3RA 4M7AE 1SHFA 1M90R 1E7OA 4M75G 2X51A 4L59A 1VUBA 1M8VA 2J06A 2CH4W 4MMKA 4RG8A 3HSBA 2VASA 1YJ9A 1G8XA 1LNXA 3QYHB 2KI7A 4M4ZA 2GFUA 3H8ZA 4F04B 4PFZA 3CC7A 2FZGB 2CYZB 4NL2A 4J83A 3VS1A 1S72Q 1K73C 2HAXA 1M4ZA 2V8KA 1N8RU 1VQ9Q 4J9CA 5CQXA 3QZ9B 1VQMA 5J26A 1IRXA 1WXTA 3HRSA 1VQ4T 3G6EA 4L6V5 5GAOq 1SSFA 3LYIA 4IIMA 4IIOA 3G71Q 2OTLT 4E7IA 3TREA 4ZTJA 2FYKA 1XJWB 4A4KA 1NLOC 4C8QA 4A4FA 2DL4A 1X6GA 2K4YA 2AK5A 3G1JA 1XTDA 1D0YA 2KR3A 2RI2A 4N4GA 5IXFA 3OBYA 2LNHB 2QEXQ 3M56A 3E19A 2DD5A 1UHCA 4RTXA 4C0GA 2P84A 4ATOA 3CMET 1AOJA 2DM1A 3HFNA 1VOMA 3QXEB 1D3BA 4C8QD 2CREA 2RPNA 4PJOB 5GMKj 3VV0A 3NTIA 1JRIA 3PVLA 2YRCA 1M3AA 2A36A 1KD1U 4ZNXA 3QSUA 4DOWA 2CZ1B 5CQYA 2LCCA 1QVGA 4BI4A 2PUKB 5A2QE 4N0AC 3C12A 3H9NA 5GMKh 1WHGA 1KC8R 1OZ3A 3QYGB 2QA4A 2KYBA 2OTJT 1M1FA 3D7SB 3TCJA 4M7AB 3CXCP 3X25B 4FW1A 1O9SA 3I9QA 1XOVA 2DBMA 1T0HA 5KYXA 1KK7A 3MHXA 1Q82U 2DILA 1M8MA 2E3IA 2DPPB 4IUVA 2RHXA 1WDXA 2VYTA 3H6ZA 3CCVQ 1TSFA 4PFOA 2BZXA 4PL6A 2RJCA 3SWNC 1IB8A 3ER0A 1C1AA 2O9VA 3V7RA 2LJ0A 2K3XA 2DERA 5FU6B 2FZKB 3EH1A 2JXBA 1WIEA 2XDDA 3OYHA 2QTXA 2J6KA 5A0DA 2EWNA 3E9GA 3EFOA 3KBGA 1ABQA 1FWZA 2CP6A 4J7IA 1I07A 2PVGB 3JCMX 2O88A 2YUQA 1HXDA 2O9SA 5GANe 1QVFP 2MIOA 4JLIA 5HK0A 2QAZA 3EHRA 1M30A 5HKCA 3QDFA 4OB2B 2EFIA 1B3QA 2QTVA 3C0CA 3CCJA 1IREB 4BDYA 3NHNA 1PHTA 2JZ2A 2DO3A 3L42A 3JCMb 2X35A 2CP7A 2WSCE 4FIBA 3CCUQ 1M1KU 2RI3A 2DYIA 1RAGB 1ARKA 1QVPA 3QZ5B 2CZ7B 3CC4A 4J9FA 1PKTA 2GTJA 3FJPA 4LNPA 2AT1B 4C8QC 1E6GA 5FW9A 1CKAA 2JN0A 2EKOA 4LUEA 2LT4A 2K3YA 1JXOA 4FYWB 2ROLA 2LX7A 4J9DA 1WPYA 2YUPA 1ZX6A 2X4WA 2EBPA 4PJOF 1WYXA 3JCMP 3RBBB 3RNJA 5GAN6 2DVJA 2P4TA 5GAOn 1ZUYA 3CCMQ 1PSEA 1I81A 3M0SA 3DB3A 1NEBA 4JZ3A 1VQNT 4LN2A 4M7DE 4BE2A 4P5NA 4C8QG 1VQ6Q 3CD6Q 1XNIA 2VWFA 4N4IA 4BI8B 2LP5A 3TEEA 4M7AF 1BI1A 5I2SA 1FYNA 1T3LA 3VS7A 2EPDA 3M0PA 4OF1A 2CT4A 5GAN8 3L2WA 3L2VA 2CZ6B 2KXCA 2X4JA 1YWPA 4HA8A 5CO7A 1W2BA 1K9AA 3HFOA 3HKSA 5FU7B 4ZN1A 3I55T 4JRQA 1BI0A 1MMNA 2M0OA 3OYNA 4JDSA 1LVKA 1TXQA 2XIDA 1RAEB 5GAOp 3PVQA 1OV3A 1Q82R 3CCEA 3E9FA 2J05A 1VQ5Q 2LCSA 2JMCA 3OS0A 1IHVA 3FRNA 1S72A 1UGPB 1VQ9A 1TUDA 1VQPT 1OQKA 1SRMA 1B34B 1KC8C 4F14A 4PJLA 2JTMA 2DTHA 2M0YA 3G71A 3T9NA 4LXCA 4XQ3A 3LWHA 3MJXA 4M78C 1ZA1B 2FG0A 2HBPA 2QEXA 3LWIA 2BIVA 2HQXA 5HY6A 3J7AF 5J3BA 1A0NB 5GAMe 4ZN3A 2QK0A 2OX7A 1JXMA 1GCPA 2XI9A 2K57A 3EGXA 4C92E 1NM7A 1YJ9Q 3M9QA 1AWOA 3A8LB 4K11A 2MCNA 4C0FA 4A4HA 1PC0A 2VXEA 1BU1A 3PMIA 3L2QA 2F5TX 2ECZA 2M1HA 4GLMA 4EMHA 5EG2A 1ZUKA 1Q86C 2ESWA 2PVOB 1K0SA 4DA4A 4M7DB 4CC3A 3L1AA 1Q7YC 2JM8A 1X69A 1Y0MA 4EMKA 2RQUA 3PT9A 4DQ2A 2DMOA 2E3HA 5FWBA 5LJ3f 1RAIB 1B07A 4AFZC 4VUBA 2X4XA 3CPWA 2AZSA 3A8MB 3CCQT 2YRVA 3CCVA 3P8HA 4M75A 1VQLQ 2LT1A 1D1AA 2EYXA 3I56A 3OBWA 2A08A 3JB9D 1O75A 1MMDA 2XKOC 1H8KA 3O5ZA 2E6ZA 1VQKT 3LX7A 4OB1B 4O6JA 2F5KA 3OS5A 3DLLA 4C0DC 2NUTB 2DKGA 4D6WA 4E7HA 2PUOB 2ENMA 5A0LA 4M75D 1SHGA 4XU1A 2GQVA 2ZPEB 1M9SA 2RH2A 3M0QA 3L2RA 1OX9A 5CKHA 1YJNA 1VQ8T 1KQSA 4JZ4A 3SB2A 2AZVA 2KT1A 1TS9A 2KDSA 2D0NA 1Y7XA 1G3WA 1UGQB 4XTWA 1PD1A 2DZ9A 4AFSC 5GAMg 2V1RA 1M3BA 1YITQ 3IQLA 4EDUA 3CC2Q 4L5GA 4F16A 2GGRA 4C92B 3I5SA 1Q81C 1OPLA 5GAOm 5CIUA 1WHKA 1NJIU 4DBHA 2LQ8A 1UFFA 1RLQC 2XHCA 2FZCB 2X3XD 3BY7A 4JPBW 1AT1B 3V7SA 4E7JA 5I22A 5KE2A 2YSQA 1IXDA 4C8QE 2D8JA 1U3OA 3GF5A 1ZSZB 2MK5A 5LJ5f 3C95A 4KT0E 4J5YA 3CCMA 4R55A 1MMAA 4IUQA 4C5GA 3HP9A 3CMAT 1MMGA 2KBTA 4LE9A 1U1SA 2HQHA 4M7DF 1PRMC 2DFUA 1TUGB 5GAMd 4IUPA 4PNOA 4Z02A 1VQ6A 3CD6A 2CSQA 2K5FA 4EIKA 1J3TA 2KROA 3OS1A 2XG8D 4RTUA 5GAN7 2L8DA 2E10A 2VUBA 1RUWA 3C4SA 3E1SA 4PJMA 3RMQA 2KK4A 2LQKA 4GBQA 2CP3A 4GY5A 1GBRA 1T3SA 3VU3C 2YXYA 1K9MU 1VIEA 1ZA2B 1AWJA 4J6XA 5LJ3d 3JCMe 1NYFA 3BW1A 4N0AA 1K8AR 1WGSA 2E12A 4OGEA 3H41A 1M2VB 4MZPA 1VQ5A 4M77C 5GAOr 1QW1A 2CH4A 2DD4A 2YLBA 4LDYA 1LPLA 5GAOl 3GBQA 3JAME 4MDXA 2VKNA 2OAUA 1NE8A 2A3LA 3A1PA 1Y57A 1QCNA 2NYSA 3VRYA 3QWYA 1HSQA 3JB9G 3GIBA 3OYCA 2CUDA 3JRZA 4KGZB 1B7TA 4NOYA 4FM4B 3SWNA 4JJDA 5I2MA 4FSXA 1NEGA 3UWNA 5KYNA 4HVVA 3NFCA 1AZGB 3RERA 4JS4A 4M77G 4KRTA 5GAN4 2MI6A 2D0QB 2FPFA 4C92F 1E6HA 2RHUA 4IUTA 4KH1B 1W70A 3LW5E 4CRIA 2XDBA 5IN1A 2CSIA 3CCRQ 2P0QA 4BD3A 4FYYB 3OQ5A 4WF2A 1YJWQ 2E1HA 4FYXB 3L2UA 3CCEQ 2MPXC 1EZZB 2PVDB 4ANJA 1WQ7A 2YWWA 4ORZA 4RTWA 2VGNA 1AWWA 2XD0A 3I35A 2QEXT 5CVIA 3O8VA 2EQKA 1D3BB 4DBFA 4RTTA 1JQQA 1UECA 3J80E 2FRYA 2QG9B 1X27A 5CKEA 1YHQQ 1X75C 4UC4A 2HSEB 2A7YA 2RF0A 1X6OA 5D7UA 4LDUA 3OYGA 3JCMV 2JW4A 1G3TA 4CC7A 2QDLA 2EQJA 1VIFA 3M58A 1VQLA 1UJYA 1KIKA 4II1A 1CKBA 4AMCA 1VQOQ 2QXFA 3JCMg 4BY6B 2IG0A 1RADB 1QVGS 4X34A 3EFSA 4A54A 4FW2A 1G2BA 5L8RE 3NTKA 1TU0B 3FDRA 2KGTA 3AT1B 4HVWA 1Z9ZA 3VUZA 2RK1A 3RUXA 5GAMj 2EYQA 2KE9A 3I5RA 4NL3A 2RI5A 3OY9A 2GQIA 4Z8AA 2DX1A 1V76A 1VQ4Q 4X9DA 3BFMA 5GAMh 2JTFA 2DYBA 2OTLQ 4LDWA 2K6DA 1IO6A 5J39A 1YI2A 3JSCA 3Q1JA 3EFOB 3JCMd 1M1GA 3VS0A 1H641 1YITA 4E6RA 3CC2A 4F7UE 1VQ7T 3FJ5A 1BKBA 2GBQA 4J9GA 3CMEQ 4QVDA 4A63B 1WX6A 4E2FB 2E5KA 5LJ3h 2R58A 1AVZC 2DZCA 8AT1B 3I56Q 1WXUA 5IHIA 3MPUB 1SF9A 1W6XA 4FCYA 3JCMW 4OMNA 2V8IA 1K8AC 3MEAA 1N9RA 2LC4A 4B6MA 3UA7A 2LQNA 3CCUT 2GNCA 1JU5C 1UTIA 3H0HA 3OYBA 1R0CB 2NUZA 3LGLA 4M78A 4J9EA 1NPRA 3OMGA 3NMZC 4XU3A 1GBQA 1TWBA 1IZ6A 1Y96B 2DXBA 5KYUB 2YLCA 1BI3A 4PJJA 2K5IA 1YIJT 2DE0X 2RQTA 1YJNQ 2BZYA 1WI7A 5GJWB 2Y90A 4CC2A 3M57A 4DBRA 2ED0A 4RTVA 3G4ST 2JMAA 4LDVA 1K4US 1N8RR 4PJOD 4M78D 1M90C 5CAIA 1NLPC 3ZL7C 1YNZA 2RHYA 2YUOA 2D9TA 5GANf 4XTVA 4XK8E 2AIRB 2K5LA 2Y4XA 1MGQA 4Y92A 3CCST 1RAHB 4M7AD 3SHWA 1NZ9A 3RMSA 3GNFB 1KHIA 3UF4A 2J7IA 5KH6A 1PKSA 2RM4A 4M75E 2VV5A 4FYVB 2EJGA 4LD9K 2L5QA 2HMAA 1W2BS 2HD0A 2RD1A 4BB7A 2RA2A 4F7UB 3CCLT 5GAN3 2EKHA 4E7SA 2OJ2A 1BIBA 3EG2A 1KD1R 2YHTA 1OULA 1FMVA 1ACMB 1LJOA 2HDAA 1QVGP 1GFDA 2RJEA 1YCYA 1X01A 3MP1A 1AZEA 3JB9J 2WSEE 3G7ZA 2O4XA 1YFNA 1R0BG 2F2XA 3CCRA 1M2OA 4ZGEB 1YJWA 2FPDA 1M3CA 5LL6S 3UATA 5CK9A 1UGSB 3MEUA 3RR6A 1JB0E 4C5EA 1QCFA 3TQ7P 2DL7A 2G6FX 3TU4K 3PMTA 1I4K1 3VYHB 1I1JA 1VQNQ 1K73U 2NUPA 2V8JA 1YJ9T 1OPKA 1P92A 2ZPGB 1YHQA 4RG2A 3JCMh 4PJOC 2ZPBB 3UPUA 4J6WA 4XTUA 3EGDA 3OW2A 3JV3A 2M51A 4FT2A 3CC7T 4HT8A 2HKNA 1VQOA 2B8AA 3VS6A 2L3QA 1MV3A 4OMFB 4FSSA 2DJZA 5KCOA 1AD5A 2EQUA 3S3NA 4M7AC 2CP5A 1VQMT 3EG9B 3DB4A 1M1KR 2QASA 3G6ET 5IAYA 3OA6A 4NS5A 2XDPA 4M75B 1SKUB 2ROTA 3EG0A 5KYYB 1RLPC 2MWOA 4PJOG 4M78G 2GCXA 1VQPQ 2HSPA 2LNVA 4KBMB 3ULRB 3CPWS 4QKUA 1VQ4A 4ELYC 4QQ6A 5LJ3e 3NPFA 2OTLA 2KMTA 1I0CA 2R5AA 2DK3A 4B9WA 5FU6C 1KSWA 4J9HA 3CBMA 2DBKA 2E4HA 4E7LA 4F7UF 2HQEA 3X26B 5CKDA 4M7AG 2DLPA 3WXMB 3M0TA 1N8RC 3EH2A 5KYWB 5C6SA 2KRMA 3CMEA 2DRMA 2I2LA 4A53A 4M77A 2JM9A 2HCKA 2J6OA 1HJDA 5GAN2 5D6WA 2ZCFB 2QQRA 2RHIA 3S3MA 1JJ2S 2EVRA 1WHMA 3REBB 2LZ6B 1KQ1A 2E41A 1G3SA 2K2MA 2RN8A 3QIIA 3RDVA 2QA4T 1FXXA 1S1NA 1KQSS 2EQMA 2YT6A 1Y71A 1C0MA 4RCCA 4RCBA 4EMGA 3S3OA 2J6FA 2LTOA 2RNAA 1JO8A 1W2BP 2HBWA 4M77D 3HHTB 4TVRA 1ZHIA 2OTJA 2BE9B 1C6VX 1JJ2A 1GRIA 1N6AA 4AG2C 2W0ZA 3LGFA 4C5IA 3L2ZA 4KGVB 5DLQE 3FLGA 3RKXA 1CSKA 1YI2Q 4PLIA 3CCQQ 1BB9A 3P8BB 1TUCA 3R6NA 3FC3A 4HXJA 1D1CA 4MZTA 1K76A 1R77A 4JJNK 2M02A 3CBOA 1UUEA 2P0KA 3META 4M7DD 1ZLMA 2EJFA 4JJCA 1UB4A 4WCIA 5LJ5e 1VQKQ 2F1LA 3LH0A 3MO8A 2XICA 1Q82C 3X20B 3CCJT 2FPEA 2MWPA 4R56A 2DXTA 4HKEA 3NGPA 4M75F 5LJ3g 4E7ZA 1EX4A 2PU9B 3VRZA 2NUTA 5FU7C 1Q95G 2JTEA 2JNGA 1VQ8Q 2CGHA 3HL8A 3CC4T 1UJ0A 1WHLA 2RQWA 2VB6A 1IHWA 1M27C 2MMPA 4JRIA 4KULA 1MNDA 4RTYA 3MP6A 1BK2A 2FVUA 2DA9A 4PJNA 4AFQC 2DTOA 1WZOA 1KHCA 2LVMA 5L23A 2C06A 4XTZA 4KGXB 4BE0A 1VYTA 4FU6A 3M5AA 1QKXA 3SWNB 8ATCB 4LDXA 4MDWA 3OB9A 1M1KC 4JLGA 4MZMA 3M59A 3QG1A 1RABB 3A8OB 4OMMA 3CPWP 1QMCA 3EG1A 3EG3A 3VS2A 4Y91A 2ABLA 3EAEA 1GCQC 2ATCB 2FL7A 4XU0A 4J7FA 5AT1B 3CMAQ 1QQJA 3OSVA 3RKYA 4BUGA 1H92A 1WQWA 1VQNA 2LX9A 4C5HA 3OYLA 1AEYA 2YDLA 2DVEA 4C92D 5M9OA 3EGUA 1QWFA 1KC8U 3M53A 1GL5A 4HCCA 3PFSA 1WJQA 2ZAEA 1HK9A 1PSFA 3CXCA 1V1CA 1SPKA 2HEQA 4DEXA 3CCET 4WTOB 2EJ9A 3QKJA 4OMOA 3LLRA 3ASKA 4M78E 3I55A 4M7DC 4OB3B 3PTAA 3BE3A 4QQDA 4J9BA 1S72T 4CI0C 2E5QA 3OYAA 2LDMA 1EFNA 2EGCA 1VQ9T 5LJ5g 2GTOA 1KQSP 4C8QB 5AYFA 2JJ9A 2CUBA 2E70A 4D8KA 3G71T 3HRTA 1YBYA 2K79A 3CBPA 5IHNA 4PK4A 1M2VA 4AT1B 2EYWA 1ZQ1A 1VQPA 2K2VA 2MF2A 1NJIR 2BZ8A 3ZFJA 1VQOT 2A28A 1Q86U 4FT4A 1EIFA 1OZ2A 3OMCA 2XK0A 5DM7R 2KRSA 1ZUUA 4M7DG 2MYSA 3MKDA 3TSZA 1JBMA 3E2UA 1Q7YU 5FRNA 1QVFA 2CS7A 2DEQA 2FO0A 2WSFE 3F70A 2D1XA 2H3JA 2HL3A 3U23A 5IHKA 2X9HA 2WACA 3GNGA 2M16A 4B9XA 3OYKA 2LQWA 1OX8A 5LJ5d 3OYIA 1BI2A 1NG2A 3V7CA 5ECAA 2KQWA 4HVUA 2RQVA 2W10A 1LOJA 2DXUA 2IVWA 4DEYA 1RI9A 1LCKA 2KY9A 1NBEB 5KYXB 4X1VA 1WFWA 1IGQA 4AFUC 1VA7A 3UT1A 3OSSC 1ZSGA 1K9MR 1G5VA 4A4GA 4KUIA 1GFCA 3QDRB 4C92C 1D0ZA 2C0IA 4E47A 1OI1A 3C94A 2JS2A 3CCVT 4ZGDB 4C0ZA 5IXBA 3I56T 1H3ZA 4D8DA 1TTHB 2FHDA 2PQWA 4DBQA 4F17A 1ZSZC 4O5VA 2EGAA 4M78B 4QVZA 1KJWA 3CCQA 4BDZA 2DIGA 3CQTA 4RMOA 1N5ZA 5LJ3j 3TSWA 2B86A 2DAQA 2RO0A 5EC7A 2AKKA 1NPPA 3PE0A 3THKA 2CP2A 1N9SA 4C92G 3OYFA 2HL5C 1Q81U 4R0KA 2NLUA 3ZEHA 4JRPA 3PIPA 4C8QF 1VQKA 2VVKA 3A5ZB 1U8RA 1YJNT 3A98A 1G83A 1BIAA 4ZTFA 2O31A 2L2PA 4OB0B 2QGGA 3QHSA 4PJOA 3BDLA 1UHFA 5D6YA 2QQSA 2VXFA 4HCBA 1VQ8A 2FRWA 2V26A 1PNJA 2DF6A 2DL8A 2OTJQ 1ZBXA 2DIQA 2K7AA 2P0PA 5DY9A 3JB9H 3A8HB 1RAFB 4FL6A 3EFRA 1UGVA 2KEAA 3REAB 5KCHA 5FWCA 2CZ0B 4N4HA 4LD6A 1VQ7Q 2QYZA 1PG5B 5CKFA 4E7KA 3MCAB 1SSHA 1Q86R 4M7AA 3HRUA 1PCXA 3X24B 2MOXA 4GLKA 2LRQA 1Q7YR 2KVQG 3KUFA 1DJ7B 1Z9QA 2EAYA 4DOVA 5HK3A 3CCMT 2D8HA 4EPCA 2F2VA 2RK2A 2GFAA 2A37A 2M9UA 2QGFB 2CT3A 3VS3A 1VQ6T 3CD6T 4A4EA 1QP2A 3PNWC 4QT7A 1SEMA 2O4XB 3UA6A 4C0DB 1NJIC 3CMAA 2YRDA 1FX7A 2DXCA 2FEIA 5CCAA 4M77E 4QVCA 1YIJQ 3OYDA 2P4RA 1Y96A 1W4SA 5KYUA 5LJ5j 2OI3A 3JB9I 5IT9E 2JT4A 5FROA 3V8KA 1U5SA 1BYMA 4J9IA 1I5OB 1OOTA 1YN8A 2HKQB 3G4SQ 4XTXA 3QUIA 1RI0A 3RKWA 5LJ5h 4OMPA 2L0AA 4M78F 3M4GA 1VQ5T 2ZPFB 1PWTA 1UDLA 2NUPB 2H8HA 1RACB 3V8JA 4YTLA 3FB9A 1MV0B 5FRMA 3KFVA 4XU2A 1MUZA 1WHJA 1R8OB 3VYGA 3EGDB 3S6WA 2ED1A 3OYYA 2Y4YA 3CCSQ 3M0RA 2BTTA 1RAAB 2KYMA 1K9MC 1GXIE 5GAN5 1X43A 3LH5A 4J8OA 1Q81R 3OW2S 4BY6C 2X4YA 2COZA 5C0MA 1AHJB 3EGXB 2BKDN 2OAWA 4MMLA 3QPHA 4OP0A 1Y07A 2ZPIB 3CCLQ 4HT9A 2L89A 2E6NA 1MHNA 1UE9A 4F7UA 2CKKA 3SD4A 1MNEA 5GANg 1T0JA 1TG0A 4QQGA 1YCSB 2EW3A 2V1QA 1YWOA 1X2QA 4XTYA 4EMKB 2EYZA 3PGGA 2JOYA 2PTKA 3I55Q 2QQ9A 2IIMA 3SEMA 3CEYA 1NYGA 2KAFA 1QWEA 3DLMA 5D6XA 4IUUA 4QW2A 3VKIA 1WHHA 2D6FA 3ME9A 2KNBB 1OU8A 1V29B 2VC8A 3J81E 4M77B 1PRLC 1K1ZA 3TVTA 3PIOA 3JCMc 5GMKe 3URGA 1X2KA 3VS5A 1VQLT 5KE3A 1KQ2A 1SRLA 2BE7D 5GANd 5GAMf 1U1TA 1WLPB 4OMLA 1OYXA 2JVVA 3MEWA 1B34A 1D0XA 1PD0A 3NTHA 1KFZA 4JRKA 2SRCA 2G3RA 3QBYA 3GOXA 2F2WA 3CC7Q 2QDYB 4JJBA 1XQHA 1QCOA 4XAXB 4RTZA 1W1FA 1D1BA 1X6BA 4J6YA 3GLXA 3FIFA 2E65A 3H0IA 2DJQA 5GMKi 1GCQA 1VQMQ 1QKWA 1AWXA 3G6EQ 2DETA 1YP5A 3WVEB 2EIFA 3M0UA 3M55A 4BI3A 3OS2A 2EYYA 3DKMA 3RESA 1FMKA 4OVAA 3EG9A 4JUVA 1K8AU 1YI2T 9ATCB 2X3WD 4IURA 2PZ1A 1F1BB 4OMQA 5A0GA 5CKBA 1G3YA 1YITT 3M4YA 5KYYA 3CC2T 1UGRB 4PKCC 2Z0WA 3JCMQ 2LCLA 4M7DA 3VUBA 1TOVA 2HNIA 5I11A 2BUDA 1OEBA 1VQ7A 2QI2A 2A0FB 2XMFA 1KG1A 4ELZC 1KD1C 1U06A 3QJ6A 2RHZA 3QJYA 2O2OA 3GP8A 2L3PA 2CP0A 2H3EB 1K73R 1WJSA 2LJ1A 5DLOA 1WJRA 5KYWA 1WA7A 4RKUE 4OGCA 1RL2A 1M90U 1IGUA 4PLLA 4BE1A 1D09B 3JB9F 2DEUA 4HCZA 4KUDK 2E64A 4BACA 1TH7A 3V8LA 2QA4Q 2GF7A 5CR2A 2K3BA 1WNLA 3GPLA 3CCUA 2O01E 4PFPA 1N27A 2MAMA 3OW2P 1VYUA 2DNUA 4M77F 2K9GA 1H3HA 2RJFA 2RJDA 1WXBA 1UG1A 1K0XA 4RUGA 2SEMA 3HPWA 1BCOA 6AT1B 3MEVA 4ESRA 1YIJA 3KXTA 3INZA 1I5LA 4LUDA 5GMKm 3X28B 1UEBA 4ZGJB 4HCKA 1QLYA 4CC4B 2DL5A 3G4SA 2FB7A 4V2SA 2QQBA 4AG1C 2JS0A 4F7UG 2DL3A 2KXDA 2PNIA 3WVDB 5FLXE 3H0FA 2EGEA 2R5MA 7AT1B 2LJ3A 3A8GB 3N5BB 1I8FA 5HCKA 1QP3A 4Q5WA 3M54A 3QO3A 4C92A 4Z88A 2KSSA 2DTIA 3CCSA 2RQRA 3AHUA 3CCJQ 2F69A 1BBZA 4KH0B 3UDCA 2COWA 1ABOA 3SDZA 2YUNA 3CXCS 1M5Q1 2C0OA 5GANj 2JUFA
chains in the Genus database with same CATH topology
5I21A 3C94A 4BB7A 4EMKC 2ZGWA 3CCVT 4Y28E 2RA2A 4F7UB 3CCLT 4ZGDB 2VGMA 4VUBA 5GAN3 3CPFA 2X4XA 3SFMA 4C0ZA 3I56T 1BIBA 3OYMA 3CPWA 3A8MB 3CCQT 1H3ZA 2PQWA 2FHDA 2YHTA 2YRVA 3FEOA 3CCVA 3P8HA 2ZPHB 4M75A 3P8DA 5GANh 3OYEA 3CCLA 4O5VA 2LT1A 4M78B 3OYJA 1LJOA 4QVZA 3I56A 3CCQA 4BDZA 3ZBDA 2DIGA 1YCYA 2RJEA 3MP8A 3OBWA 1X01A 3MP1A 3CCRT 3JB9D 3JB9J 2WSEE 4RMOA 3G7ZA 1O75A 3JCMf 2ZZDA 4M75C 2O4XA 5LJ3j 1YJWT 2XKOC 2DAQA 2RO0A 1NPPA 3JCMJ 3CCRA 2E6ZA 1N9SA 1VQKT 4ZGEB 5GMKl 3BDUA 3LX7A 4C92G 4OB1B 3OYFA 1YJWA 1Q81U 4O6JA 4ME7A 4PJOE 2QQAA 2NLUA 2F5KA 3OS5A 3DLLA 4C0DC 3R6OA 2AHJB 5LL6S 4JS5A 3ZEHA 5CK9A 4JRPA 2DKGA 4D6WA 3PIPA 4E7HA 1UGSB 3MEUA 1JB0E 4C8QF 1VQKA 4C5EA 2PUOB 2R57A 3A5ZB 1M5Q1 5A0LA 1U8RA 1YJNT 2RB6A 4M75D 4XU1A 2GQVA 2ZPEB 1BIAA 3TU4K 4ZTFA 1M9SA 1QVFS 2RH2A 3L2RA 3PMTA 5CKHA 1YJNA 1VQ8T 4OB0B 1I4K1 1KQSA 3SB2A 3QHSA 3VJPA 3RIRA 3VYHB 1YHQT 1K73U 4PJOA 4IKFA 3BDLA 2XU8A 4X9CA 2V8JA 5D6YA 2QQSA 2KDSA 2VXFA 2L3RA 4M7AE 4HCBA 1VQ8A 1Y7XA 1YJ9T 4M75G 1G3WA 1UGQB 4XTWA 4L59A 1VUBA 1P92A 2DZ9A 2ZPGB 5GAMg 4RG2A 1YHQA 1M8VA 4MMKA 4RG8A 3JCMh 3HSBA 4EDUA 1ZBXA 2DIQA 2ZPBB 4PJOC 3UPUA 4J6WA 4L5GA 2P0PA 4XTUA 5DY9A 1YJ9A 3A8HB 3JB9H 4FL6A 4C92B 1Q81C 3OW2A 1LNXA 3EFRA 5GAOm 5CIUA 4FT2A 5KCHA 1NJIU 3CC7T 2LQ8A 2CZ0B 3QYHB 4LD6A 4N4HA 4HT8A 2XHCA 1VQOA 2B8AA 5CKFA 4E7KA 2GFUA 3H8ZA 3BY7A 3MCAB 4M7AA 3HRUA 3X24B 3CC7A 3V7SA 4E7JA 4GLKA 2LRQA 5KE2A 2CYZB 2KVQG 3KUFA 4OMFB 4C8QE 1DJ7B 2DJZA 2EAYA 3GF5A 4NL2A 2EQUA 4J83A 4DOVA 5KCOA 5HK3A 3S3NA 3CCMT 4M7AC 4EPCA 1VQMT 1K73C 5LJ5f 3C95A 2HAXA 1M4ZA 2V8KA 3DB4A 3G6ET 2RK2A 1N8RU 2GFAA 5IAYA 3OA6A 4KT0E 4NS5A 5CQXA 2XDPA 4J5YA 4R55A 4IUQA 3QZ9B 4M75B 3CCMA 1VQMA 5J26A 4C5GA 1VQ4T 2MWOA 3HRSA 3G6EA 4L6V5 2M9UA 5GAOq 3HP9A 3CMAT 4PJOG 4M78G 1SSFA 1VQ6T 1U1SA 3LYIA 3CD6T 4A4EA 2GCXA 2OTLT 4E7IA 4M7DF 3TREA 2LNVA 4KBMB 4ZTJA 1QP2A 2FYKA 4A4KA 4C8QA 3PNWC 3CPWS 4A4FA 5GAMd 1VQ4A 2O4XB 2K4YA 4C0DB 3CMAA 1NJIC 4IUPA 4PNOA 4ELYC 4Z02A 1VQ6A 4QQ6A 5LJ3e 3CD6A 2K5FA 2OTLA 1XTDA 1FX7A 2DXCA 5CCAA 3OS1A 2RI2A 4M77E 2KMTA 2R5AA 2XG8D 2DK3A 4N4GA 4B9WA 5GAN7 2L8DA 2E10A 2VUBA 5FU6C 3OBYA 4QVCA 3C4SA 3E1SA 3OYDA 3M56A 1Y96A 1W4SA 3RMQA 5LJ5j 3CBMA 2KK4A 2LQKA 3E19A 2DD5A 3JB9I 4C0GA 4E7LA 4GY5A 4F7UF 5IT9E 4ATOA 5FROA 3V8KA 2HQEA 3CMET 3X26B 5CKDA 4M7AG 3VU3C 1BYMA 3WXMB 1K9MU 1VIEA 1N8RC 4XTXA 3HFNA 5C6SA 3QUIA 1RI0A 3QXEB 3RKWA 5LJ5h 3CMEA 2I2LA 4M78F 4M77A 4J6XA 4A53A 1D3BA 3M4GA 4C8QD 5LJ3d 1VQ5T 2ZPFB 5GAN2 3JCMe 3BW1A 4PJOB 5D6WA 2ZCFB 2QQRA 5GMKj 2RHIA 4N0AA 3NTIA 3V8JA 3VV0A 1JRIA 1WGSA 2E12A 4OGEA 4YTLA 3S3MA 1JJ2S 4MZPA 3FB9A 1KD1U 1VQ5A 4M77C 5GAOr 3QSUA 1QW1A 2YLBA 2DD4A 4DOWA 5FRMA 2CZ1B 5CQYA 1KQ1A 2E41A 1G3SA 3QIIA 2LCCA 4LDYA 4XU2A 5GAOl 3JAME 1FXXA 4BI4A 2QA4T 2EQMA 2PUKB 1Y71A 4EMGA 4N0AC 3C12A 4RCBA 1R8OB 4RCCA 5A2QE 5GMKh 3VYGA 3S3OA 4MDXA 2LTOA 3S6WA 3OYYA 2OAUA 1OZ3A 2Y4YA 3QYGB 1NE8A 2QA4A 2A3LA 2OTJT 1M1FA 3TCJA 4M7AB 3X25B 1K9MC 3JB9G 3GIBA 4M77D 3HHTB 3OYCA 5GAN5 1GXIE 4TVRA 3JRZA 1ZHIA 4J8OA 2OTJA 1O9SA 3OW2S 1XOVA 4BY6C 4NOYA 1JJ2A 2X4YA 3MHXA 4FM4B 1Q82U 5C0MA 1AHJB 1N6AA 3SWNA 2BKDN 2DPPB 4IUVA 2RHXA 4MMLA 3LGFA 2VYTA 3QPHA 4OP0A 5I2MA 4FSXA 1Y07A 3H6ZA 3UWNA 4C5IA 3NFCA 3L2ZA 2ZPIB 3RERA 5DLQE 4HT9A 4JS4A 3FLGA 4M77G 4PL6A 2L89A 3RKXA 2RJCA 4PLIA 5GAN4 3SWNC 2E6NA 2MI6A 3ER0A 2D0QB 1MHNA 4C92F 4F7UA 2CKKA 3SD4A 3P8BB 4IUTA 2RHUA 3V7RA 2K3XA 5FU6B 5GANg 4QQGA 3FC3A 3LW5E 4CRIA 2XDBA 5IN1A 2XDDA 4MZTA 3OYHA 2QTXA 4JJNK 2P0QA 4XTYA 5A0DA 3CBOA 4BD3A 2EWNA 3E9GA 3OQ5A 4EMKB 4WF2A 2P0KA 3META 4M7DD 3PGGA 2JOYA 2EJFA 1UB4A 2E1HA 2QQ9A 3KBGA 3L2UA 5LJ5e 1FWZA 3CEYA 2PVDB 3LH0A 3MO8A 2KAFA 2XICA 4J7IA 1QVGA 1WQ7A 1Q82C 2PVGB 3DLMA 5D6XA 3X20B 3JCMX 3CCJT 4IUUA 1HXDA 2MWPA 2VGNA 4QW2A 2DXTA 5GANe 4R56A 2XD0A 3VKIA 2QEXT 4JLIA 5HK0A 5CVIA 3O8VA 4HKEA 5HKCA 2D6FA 2EQKA 3ME9A 4M75F 5LJ3g 4OB2B 2EFIA 1V29B 2VC8A 3J81E 4M77B 3CCJA 1IREB 1D3BB 4BDYA 2PU9B 3PIOA 5FU7C 2JZ2A 2DO3A 3L42A 3JCMb 2X35A 2WSCE 3JCMc 3J80E 2JNGA 4FIBA 3URGA 5GMKe 2CGHA 2RI3A 3HL8A 3CC4T 1M1KU 5CKEA 1X75C 2MMPA 4UC4A 2A7YA 1VQLT 1QVPA 4JRIA 3QZ5B 5KE3A 1X6OA 3OYGA 4LDUA 3JCMV 1KQ2A 2CZ7B 4KULA 1G3TA 3CC4A 3MP6A 2EQJA 5GANd 5GAMf 1U1TA 2FVUA 1VIFA 3M58A 1OYXA 1VQLA 3FJPA 2JVVA 3MEWA 4II1A 4C8QC 1B34A 2JN0A 2QXFA 3NTHA 3JCMg 4BY6B 2EKOA 4JRKA 2G3RA 2LT4A 3QBYA 2DTOA 2IG0A 1KHCA 2LVMA 3GOXA 1QVGS 2K3YA 2QDYB 4X34A 1XQHA 3EFSA 4A54A 2C06A 4XTZA 5L8RE 4XAXB 3NTKA 4BE0A 3FDRA 4J6YA 1WPYA 3GLXA 3FIFA 2E65A 2X4WA 4PJOF 4FU6A 3M5AA 3SWNB 3VUZA 3JCMP 4MDWA 4LDXA 5GAN6 2RK1A 3OB9A 2P4TA 5GMKi 5GAOn 1M1KC 3RUXA 4JLGA 4MZMA 5GAMj 1PSEA 2EYQA 1I81A 4NL3A 3M59A 2RI5A 3OY9A 3QG1A 3DB3A 3WVEB 2EIFA 3A8OB 3M55A 4BI3A 1VQNT 4Y91A 3EAEA 3OS2A 3DKMA 3RESA 4OVAA 4M7DE 2FL7A 4XU0A 4BE2A 4J7FA 4JUVA 4P5NA 4X9DA 1K8AU 3BFMA 1YI2T 4C8QG 5GAMh 1XNIA 2JTFA 3OSVA 4IURA 3RKYA 4BUGA 4N4IA 4LDWA 1WQWA 4BI8B 3TEEA 2LX9A 1VQNA 4M7AF 5A0GA 1BI1A 5CKBA 1G3YA 4C5HA 5I2SA 3OYLA 1YITT 2DVEA 4C92D 3M4YA 5J39A 3CC2T 1YI2A 5M9OA 3JSCA 1UGRB 3Q1JA 4PKCC 3JCMd 4OF1A 1KC8U 3M53A 1M1GA 1H641 5GAN8 1YITA 3L2WA 4HCCA 3JCMQ 3L2VA 3PFSA 1WJQA 2CZ6B 2X4JA 4HA8A 4F7UE 1VQ7T 1HK9A 5CO7A 1W2BA 1PSFA 2LCLA 3CXCA 4M7DA 1BKBA 3HFOA 3HKSA 5FU7B 3VUBA 4ZN1A 3I55T 1BI0A 4JRQA 2HNIA 2M0OA 2BUDA 3OYNA 4JDSA 3CCET 2EJ9A 4QVDA 2QI2A 3QKJA 2XIDA 1VQ7A 3CC2A 3LLRA 1KG1A 5GAOp 3ASKA 4M78E 3I55A 4ELZC 1KD1C 4M7DC 5LJ3h 4OB3B 2R58A 2DZCA 3PTAA 4QQDA 1S72T 3CCEA 2RHZA 3QJ6A 2E5QA 3QJYA 2LDMA 4CI0C 3OYAA 3GP8A 3E9FA 3JCMW 1VQ9T 5LJ5g 2V8IA 3OS0A 1K8AC 3MEAA 1WJSA 4C8QB 1N9RA 3FRNA 5AYFA 2LC4A 5DLOA 1WJRA 1S72A 4RKUE 4OGCA 1RL2A 1M90U 1UGPB 1VQ9A 4PLLA 4BE1A 3JB9F 3CCUT 2E70A 4HCZA 4KUDK 3G71T 2E64A 1VQPT 3HRTA 3OYBA 4BACA 1TH7A 1YBYA 3LGLA 4M78A 3V8LA 1B34B 1KC8C 3CBPA 2GF7A 1NPRA 5CR2A 1WNLA 3OMGA 4XU3A 3GPLA 1Y96B 1IZ6A 2DXBA 2O01E 2JTMA 2DTHA 3G71A 3CCUA 1VQPA 1N27A 1ZQ1A 2K2VA 2MF2A 3T9NA 2MAMA 4XQ3A 2YLCA 3LWHA 1KQSS 1BI3A 4M78C 3ZFJA 2K5IA 1VQOT 1YIJT 1Q86U 4FT4A 4M77F 1EIFA 1OZ2A 3OMCA 2XK0A 5DM7R 2RJFA 2RJDA 4M7DG 1JBMA 1Q7YU 3HPWA 5FRNA 2CS7A 2DEQA 2Y90A 1QVFA 2HBPA 2WSFE 3F70A 3M57A 3MEVA 2QEXA 3KXTA 3LWIA 1YIJA 2BIVA 3INZA 2H3JA 1I5LA 3G4ST 2HQXA 5GMKm 5HY6A 3J7AF 4LDVA 5J3BA 3X28B 5GAMe 2WACA 3GNGA 4ZN3A 1UEBA 2M16A 4B9XA 4ZGJB 3OYKA 4PJOD 4M78D 1M90C 5LJ5d 3G4SA 2FB7A 3OYIA 2XI9A 5CAIA 4V2SA 2K57A 1BI2A 4C92E 3M9QA 2QQBA 3V7CA 4F7UG 3A8LB 4C0FA 2RHYA 3WVDB 2D9TA 5FLXE 4A4HA 2VXEA 5GANf 2KQWA 3L2QA 3PMIA 4XTVA 2F5TX 4XK8E 2M1HA 2K5LA 4EMHA 2R5MA 2Y4XA 1LOJA 2DXUA 2IVWA 5EG2A 3A8GB 1MGQA 3N5BB 1I8FA 1Q86C 1QP3A 4Q5WA 2PVOB 2KY9A 3CCST 3M54A 3QO3A 4M7AD 1NZ9A 4C92A 4DA4A 4M7DB 3L1AA 1Q7YC 3RMSA 3GNFB 2KSSA 1KHIA 2DTIA 3UT1A 3CCSA 3OSSC 4EMKA 3AHUA 5KH6A 2RM4A 2F69A 4A4GA 4KUIA 4M75E 1G5VA 2VV5A 3PT9A 2EJGA 3QDRB 4DQ2A 4LD9K 2L5QA 4C92C 3UDCA 5LJ3f 3SDZA 1W2BS 3CXCS 4E47A 2HD0A 1OI1A 2RD1A 5GANj 2JUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J26 A;  3I55 T;  1VQ4 T;  2MWO A;  3G6E A;  3CCV T;  3CMA T;  1SSF A;  1VQ6 T;  3CD6 T;  2JOY A;  3CCL T;  3CCE T;  2OTL T;  3TRE A;  1VQ7 A;  3CPF A;  3KBG A;  3CPW S;  3I56 T;  3CPW A;  3CCQ T;  3I55 A;  1VQ4 A;  1KD1 C;  3LH0 A;  3CCV A;  3CMA A;  1NJI C;  1Q82 C;  1VQ6 A;  4QQD A;  3CD6 A;  3CCJ T;  3CCE A;  1S72 T;  2OTL A;  3CCL A;  1XTD A;  2MWP A;  1VQ9 T;  3I56 A;  2QEX T;  3CCQ A;  1K8A C;  3CCJ A;  1S72 A;  3J81 E;  3CCR T;  1RL2 A;  1M90 U;  1VQ9 A;  5IT9 E;  3PIO A;  3CCU T;  2E70 A;  1YJW T;  3G71 T;  3CME T;  2DO3 A;  1VQP T;  1K9M U;  1YBY A;  3LGL A;  2JNG A;  3J80 E;  1NPP A;  1M1K U;  3CCR A;  1KC8 C;  3CC4 T;  2E6Z A;  1NPR A;  1N8R C;  1VQK T;  3CCU A;  1Q81 U;  1IZ6 A;  1YJW A;  3G71 A;  3CME A;  1VQL T;  1VQP A;  3DLL A;  1X6O A;  5LL6 S;  3PIP A;  1VQ5 T;  3CC4 A;  1VQK A;  3A5Z B;  1VQO T;  1YIJ T;  1Q86 U;  1YJN T;  1VQL A;  1EIF A;  2JVV A;  4YTL A;  5DM7 R;  1JJ2 S;  1KD1 U;  1VQ5 A;  1QVF S;  1Q7Y U;  1QVF A;  2JUF A;  2G3R A;  2IG0 A;  1YIJ A;  2QEX A;  1YJN A;  2LVM A;  3JAM E;  1QVG S;  2QA4 T;  1QVG A;  1VQ8 T;  4X34 A;  1KQS S;  1KQS A;  3G4S T;  5A2Q E;  5HY6 A;  3J7A F;  1YHQ T;  1K73 U;  5J3B A;  4ZN3 A;  1UEB A;  2KDS A;  3OYY A;  2L3R A;  1VQ8 A;  2QA4 A;  1YJ9 T;  1M90 C;  3G4S A;  2OTJ T;  1YHQ A;  4RG2 A;  1K9M C;  4TVR A;  1M1K C;  1YJ9 A;  5FLX E;  2OTJ A;  3OW2 S;  1Q81 C;  3OW2 A;  1JJ2 A;  3DB3 A;  2EIF A;  1NJI U;  3CC7 T;  2LQ8 A;  1Q82 U;  2XHC A;  1VQO A;  1VQN T;  3LGF A;  1Q86 C;  1K8A U;  1YI2 T;  3CC7 A;  3CCS T;  1XNI A;  5DLQ E;  1NZ9 A;  1VQN A;  1Q7Y C;  2KVQ G;  1YIT T;  1KHI A;  3CC2 T;  2MI6 A;  3CCM T;  3ER0 A;  1YI2 A;  3CCS A;  1VQM T;  2CKK A;  3P8B B;  1K73 C;  1KC8 U;  3DB4 A;  1M1G A;  3G6E T;  1N8R U;  5IAY A;  1YIT A;  3CC2 A;  4CRI A;  3CCM A;  1W2B S;  3CXC S;  1W2B A;  3CXC A;  2LCL A;  1VQ7 T;  1VQM A;  1BKB A;  3HKS A;  4ZN1 A; 
#chains in the Genus database with same CATH topology
 5I21 A;  4EMK C;  2ZGW A;  1ZSZ A;  4Y28 E;  2C0T A;  2VGM A;  2AKL A;  3CPF A;  3EHQ A;  3SFM A;  3HTR A;  3OYM A;  1BCM A;  3CC4 Q;  3FEO A;  1HYO A;  2COY A;  2ZPH B;  5GAN h;  3P8D A;  3CCL A;  3OYE A;  3VS4 A;  4Z89 A;  3OYJ A;  3ZBD A;  3MP8 A;  2RMO A;  2I0N A;  3CCR T;  3JCM f;  2CDT A;  2LMJ A;  2ZZD A;  4M75 C;  1YJW T;  2EQI A;  3JCM J;  1ZBJ A;  5GMK l;  3BDU A;  2KT8 A;  1VYV A;  4ME7 A;  4PJO E;  2QQA A;  1OU9 A;  2AHJ B;  3R6O A;  2KRN A;  4JS5 A;  1HD3 A;  2NWM A;  1JJ2 P;  2R57 A;  2HZY A;  2RB6 A;  1SG5 A;  1QVF S;  5GJV B;  1PM3 A;  2IPO B;  5IH2 A;  3VJP A;  3RIR A;  1FMW A;  3QWX X;  1YHQ T;  2L3S A;  2DRK A;  4IKF A;  2XU8 A;  4X9C A;  1JEG A;  2L3R A;  4M7A E;  1SHF A;  1M90 R;  1E7O A;  4M75 G;  2X51 A;  4L59 A;  1VUB A;  1M8V A;  2J06 A;  2CH4 W;  4MMK A;  4RG8 A;  3HSB A;  2VAS A;  1YJ9 A;  1G8X A;  1LNX A;  3QYH B;  2KI7 A;  4M4Z A;  2GFU A;  3H8Z A;  4F04 B;  4PFZ A;  3CC7 A;  2FZG B;  2CYZ B;  4NL2 A;  4J83 A;  3VS1 A;  1S72 Q;  1K73 C;  2HAX A;  1M4Z A;  2V8K A;  1N8R U;  1VQ9 Q;  4J9C A;  5CQX A;  3QZ9 B;  1VQM A;  5J26 A;  1IRX A;  1WXT A;  3HRS A;  1VQ4 T;  3G6E A;  4L6V 5;  5GAO q;  1SSF A;  3LYI A;  4IIM A;  4IIO A;  3G71 Q;  2OTL T;  4E7I A;  3TRE A;  4ZTJ A;  2FYK A;  1XJW B;  4A4K A;  1NLO C;  4C8Q A;  4A4F A;  2DL4 A;  1X6G A;  2K4Y A;  2AK5 A;  3G1J A;  1XTD A;  1D0Y A;  2KR3 A;  2RI2 A;  4N4G A;  5IXF A;  3OBY A;  2LNH B;  2QEX Q;  3M56 A;  3E19 A;  2DD5 A;  1UHC A;  4RTX A;  4C0G A;  2P84 A;  4ATO A;  3CME T;  1AOJ A;  2DM1 A;  3HFN A;  1VOM A;  3QXE B;  1D3B A;  4C8Q D;  2CRE A;  2RPN A;  4PJO B;  5GMK j;  3VV0 A;  3NTI A;  1JRI A;  3PVL A;  2YRC A;  1M3A A;  2A36 A;  1KD1 U;  4ZNX A;  3QSU A;  4DOW A;  2CZ1 B;  5CQY A;  2LCC A;  1QVG A;  4BI4 A;  2PUK B;  5A2Q E;  4N0A C;  3C12 A;  3H9N A;  5GMK h;  1WHG A;  1KC8 R;  1OZ3 A;  3QYG B;  2QA4 A;  2KYB A;  2OTJ T;  1M1F A;  3D7S B;  3TCJ A;  4M7A B;  3CXC P;  3X25 B;  4FW1 A;  1O9S A;  3I9Q A;  1XOV A;  2DBM A;  1T0H A;  5KYX A;  1KK7 A;  3MHX A;  1Q82 U;  2DIL A;  1M8M A;  2E3I A;  2DPP B;  4IUV A;  2RHX A;  1WDX A;  2VYT A;  3H6Z A;  3CCV Q;  1TSF A;  4PFO A;  2BZX A;  4PL6 A;  2RJC A;  3SWN C;  1IB8 A;  3ER0 A;  1C1A A;  2O9V A;  3V7R A;  2LJ0 A;  2K3X A;  2DER A;  5FU6 B;  2FZK B;  3EH1 A;  2JXB A;  1WIE A;  2XDD A;  3OYH A;  2QTX A;  2J6K A;  5A0D A;  2EWN A;  3E9G A;  3EFO A;  3KBG A;  1ABQ A;  1FWZ A;  2CP6 A;  4J7I A;  1I07 A;  2PVG B;  3JCM X;  2O88 A;  2YUQ A;  1HXD A;  2O9S A;  5GAN e;  1QVF P;  2MIO A;  4JLI A;  5HK0 A;  2QAZ A;  3EHR A;  1M30 A;  5HKC A;  3QDF A;  4OB2 B;  2EFI A;  1B3Q A;  2QTV A;  3C0C A;  3CCJ A;  1IRE B;  4BDY A;  3NHN A;  1PHT A;  2JZ2 A;  2DO3 A;  3L42 A;  3JCM b;  2X35 A;  2CP7 A;  2WSC E;  4FIB A;  3CCU Q;  1M1K U;  2RI3 A;  2DYI A;  1RAG B;  1ARK A;  1QVP A;  3QZ5 B;  2CZ7 B;  3CC4 A;  4J9F A;  1PKT A;  2GTJ A;  3FJP A;  4LNP A;  2AT1 B;  4C8Q C;  1E6G A;  5FW9 A;  1CKA A;  2JN0 A;  2EKO A;  4LUE A;  2LT4 A;  2K3Y A;  1JXO A;  4FYW B;  2ROL A;  2LX7 A;  4J9D A;  1WPY A;  2YUP A;  1ZX6 A;  2X4W A;  2EBP A;  4PJO F;  1WYX A;  3JCM P;  3RBB B;  3RNJ A;  5GAN 6;  2DVJ A;  2P4T A;  5GAO n;  1ZUY A;  3CCM Q;  1PSE A;  1I81 A;  3M0S A;  3DB3 A;  1NEB A;  4JZ3 A;  1VQN T;  4LN2 A;  4M7D E;  4BE2 A;  4P5N A;  4C8Q G;  1VQ6 Q;  3CD6 Q;  1XNI A;  2VWF A;  4N4I A;  4BI8 B;  2LP5 A;  3TEE A;  4M7A F;  1BI1 A;  5I2S A;  1FYN A;  1T3L A;  3VS7 A;  2EPD A;  3M0P A;  4OF1 A;  2CT4 A;  5GAN 8;  3L2W A;  3L2V A;  2CZ6 B;  2KXC A;  2X4J A;  1YWP A;  4HA8 A;  5CO7 A;  1W2B A;  1K9A A;  3HFO A;  3HKS A;  5FU7 B;  4ZN1 A;  3I55 T;  4JRQ A;  1BI0 A;  1MMN A;  2M0O A;  3OYN A;  4JDS A;  1LVK A;  1TXQ A;  2XID A;  1RAE B;  5GAO p;  3PVQ A;  1OV3 A;  1Q82 R;  3CCE A;  3E9F A;  2J05 A;  1VQ5 Q;  2LCS A;  2JMC A;  3OS0 A;  1IHV A;  3FRN A;  1S72 A;  1UGP B;  1VQ9 A;  1TUD A;  1VQP T;  1OQK A;  1SRM A;  1B34 B;  1KC8 C;  4F14 A;  4PJL A;  2JTM A;  2DTH A;  2M0Y A;  3G71 A;  3T9N A;  4LXC A;  4XQ3 A;  3LWH A;  3MJX A;  4M78 C;  1ZA1 B;  2FG0 A;  2HBP A;  2QEX A;  3LWI A;  2BIV A;  2HQX A;  5HY6 A;  3J7A F;  5J3B A;  1A0N B;  5GAM e;  4ZN3 A;  2QK0 A;  2OX7 A;  1JXM A;  1GCP A;  2XI9 A;  2K57 A;  3EGX A;  4C92 E;  1NM7 A;  1YJ9 Q;  3M9Q A;  1AWO A;  3A8L B;  4K11 A;  2MCN A;  4C0F A;  4A4H A;  1PC0 A;  2VXE A;  1BU1 A;  3PMI A;  3L2Q A;  2F5T X;  2ECZ A;  2M1H A;  4GLM A;  4EMH A;  5EG2 A;  1ZUK A;  1Q86 C;  2ESW A;  2PVO B;  1K0S A;  4DA4 A;  4M7D B;  4CC3 A;  3L1A A;  1Q7Y C;  2JM8 A;  1X69 A;  1Y0M A;  4EMK A;  2RQU A;  3PT9 A;  4DQ2 A;  2DMO A;  2E3H A;  5FWB A;  5LJ3 f;  1RAI B;  1B07 A;  4AFZ C;  4VUB A;  2X4X A;  3CPW A;  2AZS A;  3A8M B;  3CCQ T;  2YRV A;  3CCV A;  3P8H A;  4M75 A;  1VQL Q;  2LT1 A;  1D1A A;  2EYX A;  3I56 A;  3OBW A;  2A08 A;  3JB9 D;  1O75 A;  1MMD A;  2XKO C;  1H8K A;  3O5Z A;  2E6Z A;  1VQK T;  3LX7 A;  4OB1 B;  4O6J A;  2F5K A;  3OS5 A;  3DLL A;  4C0D C;  2NUT B;  2DKG A;  4D6W A;  4E7H A;  2PUO B;  2ENM A;  5A0L A;  4M75 D;  1SHG A;  4XU1 A;  2GQV A;  2ZPE B;  1M9S A;  2RH2 A;  3M0Q A;  3L2R A;  1OX9 A;  5CKH A;  1YJN A;  1VQ8 T;  1KQS A;  4JZ4 A;  3SB2 A;  2AZV A;  2KT1 A;  1TS9 A;  2KDS A;  2D0N A;  1Y7X A;  1G3W A;  1UGQ B;  4XTW A;  1PD1 A;  2DZ9 A;  4AFS C;  5GAM g;  2V1R A;  1M3B A;  1YIT Q;  3IQL A;  4EDU A;  3CC2 Q;  4L5G A;  4F16 A;  2GGR A;  4C92 B;  3I5S A;  1Q81 C;  1OPL A;  5GAO m;  5CIU A;  1WHK A;  1NJI U;  4DBH A;  2LQ8 A;  1UFF A;  1RLQ C;  2XHC A;  2FZC B;  2X3X D;  3BY7 A;  4JPB W;  1AT1 B;  3V7S A;  4E7J A;  5I22 A;  5KE2 A;  2YSQ A;  1IXD A;  4C8Q E;  2D8J A;  1U3O A;  3GF5 A;  1ZSZ B;  2MK5 A;  5LJ5 f;  3C95 A;  4KT0 E;  4J5Y A;  3CCM A;  4R55 A;  1MMA A;  4IUQ A;  4C5G A;  3HP9 A;  3CMA T;  1MMG A;  2KBT A;  4LE9 A;  1U1S A;  2HQH A;  4M7D F;  1PRM C;  2DFU A;  1TUG B;  5GAM d;  4IUP A;  4PNO A;  4Z02 A;  1VQ6 A;  3CD6 A;  2CSQ A;  2K5F A;  4EIK A;  1J3T A;  2KRO A;  3OS1 A;  2XG8 D;  4RTU A;  5GAN 7;  2L8D A;  2E10 A;  2VUB A;  1RUW A;  3C4S A;  3E1S A;  4PJM A;  3RMQ A;  2KK4 A;  2LQK A;  4GBQ A;  2CP3 A;  4GY5 A;  1GBR A;  1T3S A;  3VU3 C;  2YXY A;  1K9M U;  1VIE A;  1ZA2 B;  1AWJ A;  4J6X A;  5LJ3 d;  3JCM e;  1NYF A;  3BW1 A;  4N0A A;  1K8A R;  1WGS A;  2E12 A;  4OGE A;  3H41 A;  1M2V B;  4MZP A;  1VQ5 A;  4M77 C;  5GAO r;  1QW1 A;  2CH4 A;  2DD4 A;  2YLB A;  4LDY A;  1LPL A;  5GAO l;  3GBQ A;  3JAM E;  4MDX A;  2VKN A;  2OAU A;  1NE8 A;  2A3L A;  3A1P A;  1Y57 A;  1QCN A;  2NYS A;  3VRY A;  3QWY A;  1HSQ A;  3JB9 G;  3GIB A;  3OYC A;  2CUD A;  3JRZ A;  4KGZ B;  1B7T A;  4NOY A;  4FM4 B;  3SWN A;  4JJD A;  5I2M A;  4FSX A;  1NEG A;  3UWN A;  5KYN A;  4HVV A;  3NFC A;  1AZG B;  3RER A;  4JS4 A;  4M77 G;  4KRT A;  5GAN 4;  2MI6 A;  2D0Q B;  2FPF A;  4C92 F;  1E6H A;  2RHU A;  4IUT A;  4KH1 B;  1W70 A;  3LW5 E;  4CRI A;  2XDB A;  5IN1 A;  2CSI A;  3CCR Q;  2P0Q A;  4BD3 A;  4FYY B;  3OQ5 A;  4WF2 A;  1YJW Q;  2E1H A;  4FYX B;  3L2U A;  3CCE Q;  2MPX C;  1EZZ B;  2PVD B;  4ANJ A;  1WQ7 A;  2YWW A;  4ORZ A;  4RTW A;  2VGN A;  1AWW A;  2XD0 A;  3I35 A;  2QEX T;  5CVI A;  3O8V A;  2EQK A;  1D3B B;  4DBF A;  4RTT A;  1JQQ A;  1UEC A;  3J80 E;  2FRY A;  2QG9 B;  1X27 A;  5CKE A;  1YHQ Q;  1X75 C;  4UC4 A;  2HSE B;  2A7Y A;  2RF0 A;  1X6O A;  5D7U A;  4LDU A;  3OYG A;  3JCM V;  2JW4 A;  1G3T A;  4CC7 A;  2QDL A;  2EQJ A;  1VIF A;  3M58 A;  1VQL A;  1UJY A;  1KIK A;  4II1 A;  1CKB A;  4AMC A;  1VQO Q;  2QXF A;  3JCM g;  4BY6 B;  2IG0 A;  1RAD B;  1QVG S;  4X34 A;  3EFS A;  4A54 A;  4FW2 A;  1G2B A;  5L8R E;  3NTK A;  1TU0 B;  3FDR A;  2KGT A;  3AT1 B;  4HVW A;  1Z9Z A;  3VUZ A;  2RK1 A;  3RUX A;  5GAM j;  2EYQ A;  2KE9 A;  3I5R A;  4NL3 A;  2RI5 A;  3OY9 A;  2GQI A;  4Z8A A;  2DX1 A;  1V76 A;  1VQ4 Q;  4X9D A;  3BFM A;  5GAM h;  2JTF A;  2DYB A;  2OTL Q;  4LDW A;  2K6D A;  1IO6 A;  5J39 A;  1YI2 A;  3JSC A;  3Q1J A;  3EFO B;  3JCM d;  1M1G A;  3VS0 A;  1H64 1;  1YIT A;  4E6R A;  3CC2 A;  4F7U E;  1VQ7 T;  3FJ5 A;  1BKB A;  2GBQ A;  4J9G A;  3CME Q;  4QVD A;  4A63 B;  1WX6 A;  4E2F B;  2E5K A;  5LJ3 h;  2R58 A;  1AVZ C;  2DZC A;  8AT1 B;  3I56 Q;  1WXU A;  5IHI A;  3MPU B;  1SF9 A;  1W6X A;  4FCY A;  3JCM W;  4OMN A;  2V8I A;  1K8A C;  3MEA A;  1N9R A;  2LC4 A;  4B6M A;  3UA7 A;  2LQN A;  3CCU T;  2GNC A;  1JU5 C;  1UTI A;  3H0H A;  3OYB A;  1R0C B;  2NUZ A;  3LGL A;  4M78 A;  4J9E A;  1NPR A;  3OMG A;  3NMZ C;  4XU3 A;  1GBQ A;  1TWB A;  1IZ6 A;  1Y96 B;  2DXB A;  5KYU B;  2YLC A;  1BI3 A;  4PJJ A;  2K5I A;  1YIJ T;  2DE0 X;  2RQT A;  1YJN Q;  2BZY A;  1WI7 A;  5GJW B;  2Y90 A;  4CC2 A;  3M57 A;  4DBR A;  2ED0 A;  4RTV A;  3G4S T;  2JMA A;  4LDV A;  1K4U S;  1N8R R;  4PJO D;  4M78 D;  1M90 C;  5CAI A;  1NLP C;  3ZL7 C;  1YNZ A;  2RHY A;  2YUO A;  2D9T A;  5GAN f;  4XTV A;  4XK8 E;  2AIR B;  2K5L A;  2Y4X A;  1MGQ A;  4Y92 A;  3CCS T;  1RAH B;  4M7A D;  3SHW A;  1NZ9 A;  3RMS A;  3GNF B;  1KHI A;  3UF4 A;  2J7I A;  5KH6 A;  1PKS A;  2RM4 A;  4M75 E;  2VV5 A;  4FYV B;  2EJG A;  4LD9 K;  2L5Q A;  2HMA A;  1W2B S;  2HD0 A;  2RD1 A;  4BB7 A;  2RA2 A;  4F7U B;  3CCL T;  5GAN 3;  2EKH A;  4E7S A;  2OJ2 A;  1BIB A;  3EG2 A;  1KD1 R;  2YHT A;  1OUL A;  1FMV A;  1ACM B;  1LJO A;  2HDA A;  1QVG P;  1GFD A;  2RJE A;  1YCY A;  1X01 A;  3MP1 A;  1AZE A;  3JB9 J;  2WSE E;  3G7Z A;  2O4X A;  1YFN A;  1R0B G;  2F2X A;  3CCR A;  1M2O A;  4ZGE B;  1YJW A;  2FPD A;  1M3C A;  5LL6 S;  3UAT A;  5CK9 A;  1UGS B;  3MEU A;  3RR6 A;  1JB0 E;  4C5E A;  1QCF A;  3TQ7 P;  2DL7 A;  2G6F X;  3TU4 K;  3PMT A;  1I4K 1;  3VYH B;  1I1J A;  1VQN Q;  1K73 U;  2NUP A;  2V8J A;  1YJ9 T;  1OPK A;  1P92 A;  2ZPG B;  1YHQ A;  4RG2 A;  3JCM h;  4PJO C;  2ZPB B;  3UPU A;  4J6W A;  4XTU A;  3EGD A;  3OW2 A;  3JV3 A;  2M51 A;  4FT2 A;  3CC7 T;  4HT8 A;  2HKN A;  1VQO A;  2B8A A;  3VS6 A;  2L3Q A;  1MV3 A;  4OMF B;  4FSS A;  2DJZ A;  5KCO A;  1AD5 A;  2EQU A;  3S3N A;  4M7A C;  2CP5 A;  1VQM T;  3EG9 B;  3DB4 A;  1M1K R;  2QAS A;  3G6E T;  5IAY A;  3OA6 A;  4NS5 A;  2XDP A;  4M75 B;  1SKU B;  2ROT A;  3EG0 A;  5KYY B;  1RLP C;  2MWO A;  4PJO G;  4M78 G;  2GCX A;  1VQP Q;  2HSP A;  2LNV A;  4KBM B;  3ULR B;  3CPW S;  4QKU A;  1VQ4 A;  4ELY C;  4QQ6 A;  5LJ3 e;  3NPF A;  2OTL A;  2KMT A;  1I0C A;  2R5A A;  2DK3 A;  4B9W A;  5FU6 C;  1KSW A;  4J9H A;  3CBM A;  2DBK A;  2E4H A;  4E7L A;  4F7U F;  2HQE A;  3X26 B;  5CKD A;  4M7A G;  2DLP A;  3WXM B;  3M0T A;  1N8R C;  3EH2 A;  5KYW B;  5C6S A;  2KRM A;  3CME A;  2DRM A;  2I2L A;  4A53 A;  4M77 A;  2JM9 A;  2HCK A;  2J6O A;  1HJD A;  5GAN 2;  5D6W A;  2ZCF B;  2QQR A;  2RHI A;  3S3M A;  1JJ2 S;  2EVR A;  1WHM A;  3REB B;  2LZ6 B;  1KQ1 A;  2E41 A;  1G3S A;  2K2M A;  2RN8 A;  3QII A;  3RDV A;  2QA4 T;  1FXX A;  1S1N A;  1KQS S;  2EQM A;  2YT6 A;  1Y71 A;  1C0M A;  4RCC A;  4RCB A;  4EMG A;  3S3O A;  2J6F A;  2LTO A;  2RNA A;  1JO8 A;  1W2B P;  2HBW A;  4M77 D;  3HHT B;  4TVR A;  1ZHI A;  2OTJ A;  2BE9 B;  1C6V X;  1JJ2 A;  1GRI A;  1N6A A;  4AG2 C;  2W0Z A;  3LGF A;  4C5I A;  3L2Z A;  4KGV B;  5DLQ E;  3FLG A;  3RKX A;  1CSK A;  1YI2 Q;  4PLI A;  3CCQ Q;  1BB9 A;  3P8B B;  1TUC A;  3R6N A;  3FC3 A;  4HXJ A;  1D1C A;  4MZT A;  1K76 A;  1R77 A;  4JJN K;  2M02 A;  3CBO A;  1UUE A;  2P0K A;  3MET A;  4M7D D;  1ZLM A;  2EJF A;  4JJC A;  1UB4 A;  4WCI A;  5LJ5 e;  1VQK Q;  2F1L A;  3LH0 A;  3MO8 A;  2XIC A;  1Q82 C;  3X20 B;  3CCJ T;  2FPE A;  2MWP A;  4R56 A;  2DXT A;  4HKE A;  3NGP A;  4M75 F;  5LJ3 g;  4E7Z A;  1EX4 A;  2PU9 B;  3VRZ A;  2NUT A;  5FU7 C;  1Q95 G;  2JTE A;  2JNG A;  1VQ8 Q;  2CGH A;  3HL8 A;  3CC4 T;  1UJ0 A;  1WHL A;  2RQW A;  2VB6 A;  1IHW A;  1M27 C;  2MMP A;  4JRI A;  4KUL A;  1MND A;  4RTY A;  3MP6 A;  1BK2 A;  2FVU A;  2DA9 A;  4PJN A;  4AFQ C;  2DTO A;  1WZO A;  1KHC A;  2LVM A;  5L23 A;  2C06 A;  4XTZ A;  4KGX B;  4BE0 A;  1VYT A;  4FU6 A;  3M5A A;  1QKX A;  3SWN B;  8ATC B;  4LDX A;  4MDW A;  3OB9 A;  1M1K C;  4JLG A;  4MZM A;  3M59 A;  3QG1 A;  1RAB B;  3A8O B;  4OMM A;  3CPW P;  1QMC A;  3EG1 A;  3EG3 A;  3VS2 A;  4Y91 A;  2ABL A;  3EAE A;  1GCQ C;  2ATC B;  2FL7 A;  4XU0 A;  4J7F A;  5AT1 B;  3CMA Q;  1QQJ A;  3OSV A;  3RKY A;  4BUG A;  1H92 A;  1WQW A;  1VQN A;  2LX9 A;  4C5H A;  3OYL A;  1AEY A;  2YDL A;  2DVE A;  4C92 D;  5M9O A;  3EGU A;  1QWF A;  1KC8 U;  3M53 A;  1GL5 A;  4HCC A;  3PFS A;  1WJQ A;  2ZAE A;  1HK9 A;  1PSF A;  3CXC A;  1V1C A;  1SPK A;  2HEQ A;  4DEX A;  3CCE T;  4WTO B;  2EJ9 A;  3QKJ A;  4OMO A;  3LLR A;  3ASK A;  4M78 E;  3I55 A;  4M7D C;  4OB3 B;  3PTA A;  3BE3 A;  4QQD A;  4J9B A;  1S72 T;  4CI0 C;  2E5Q A;  3OYA A;  2LDM A;  1EFN A;  2EGC A;  1VQ9 T;  5LJ5 g;  2GTO A;  1KQS P;  4C8Q B;  5AYF A;  2JJ9 A;  2CUB A;  2E70 A;  4D8K A;  3G71 T;  3HRT A;  1YBY A;  2K79 A;  3CBP A;  5IHN A;  4PK4 A;  1M2V A;  4AT1 B;  2EYW A;  1ZQ1 A;  1VQP A;  2K2V A;  2MF2 A;  1NJI R;  2BZ8 A;  3ZFJ A;  1VQO T;  2A28 A;  1Q86 U;  4FT4 A;  1EIF A;  1OZ2 A;  3OMC A;  2XK0 A;  5DM7 R;  2KRS A;  1ZUU A;  4M7D G;  2MYS A;  3MKD A;  3TSZ A;  1JBM A;  3E2U A;  1Q7Y U;  5FRN A;  1QVF A;  2CS7 A;  2DEQ A;  2FO0 A;  2WSF E;  3F70 A;  2D1X A;  2H3J A;  2HL3 A;  3U23 A;  5IHK A;  2X9H A;  2WAC A;  3GNG A;  2M16 A;  4B9X A;  3OYK A;  2LQW A;  1OX8 A;  5LJ5 d;  3OYI A;  1BI2 A;  1NG2 A;  3V7C A;  5ECA A;  2KQW A;  4HVU A;  2RQV A;  2W10 A;  1LOJ A;  2DXU A;  2IVW A;  4DEY A;  1RI9 A;  1LCK A;  2KY9 A;  1NBE B;  5KYX B;  4X1V A;  1WFW A;  1IGQ A;  4AFU C;  1VA7 A;  3UT1 A;  3OSS C;  1ZSG A;  1K9M R;  1G5V A;  4A4G A;  4KUI A;  1GFC A;  3QDR B;  4C92 C;  1D0Z A;  2C0I A;  4E47 A;  1OI1 A;  3C94 A;  2JS2 A;  3CCV T;  4ZGD B;  4C0Z A;  5IXB A;  3I56 T;  1H3Z A;  4D8D A;  1TTH B;  2FHD A;  2PQW A;  4DBQ A;  4F17 A;  1ZSZ C;  4O5V A;  2EGA A;  4M78 B;  4QVZ A;  1KJW A;  3CCQ A;  4BDZ A;  2DIG A;  3CQT A;  4RMO A;  1N5Z A;  5LJ3 j;  3TSW A;  2B86 A;  2DAQ A;  2RO0 A;  5EC7 A;  2AKK A;  1NPP A;  3PE0 A;  3THK A;  2CP2 A;  1N9S A;  4C92 G;  3OYF A;  2HL5 C;  1Q81 U;  4R0K A;  2NLU A;  3ZEH A;  4JRP A;  3PIP A;  4C8Q F;  1VQK A;  2VVK A;  3A5Z B;  1U8R A;  1YJN T;  3A98 A;  1G83 A;  1BIA A;  4ZTF A;  2O31 A;  2L2P A;  4OB0 B;  2QGG A;  3QHS A;  4PJO A;  3BDL A;  1UHF A;  5D6Y A;  2QQS A;  2VXF A;  4HCB A;  1VQ8 A;  2FRW A;  2V26 A;  1PNJ A;  2DF6 A;  2DL8 A;  2OTJ Q;  1ZBX A;  2DIQ A;  2K7A A;  2P0P A;  5DY9 A;  3JB9 H;  3A8H B;  1RAF B;  4FL6 A;  3EFR A;  1UGV A;  2KEA A;  3REA B;  5KCH A;  5FWC A;  2CZ0 B;  4N4H A;  4LD6 A;  1VQ7 Q;  2QYZ A;  1PG5 B;  5CKF A;  4E7K A;  3MCA B;  1SSH A;  1Q86 R;  4M7A A;  3HRU A;  1PCX A;  3X24 B;  2MOX A;  4GLK A;  2LRQ A;  1Q7Y R;  2KVQ G;  3KUF A;  1DJ7 B;  1Z9Q A;  2EAY A;  4DOV A;  5HK3 A;  3CCM T;  2D8H A;  4EPC A;  2F2V A;  2RK2 A;  2GFA A;  2A37 A;  2M9U A;  2QGF B;  2CT3 A;  3VS3 A;  1VQ6 T;  3CD6 T;  4A4E A;  1QP2 A;  3PNW C;  4QT7 A;  1SEM A;  2O4X B;  3UA6 A;  4C0D B;  1NJI C;  3CMA A;  2YRD A;  1FX7 A;  2DXC A;  2FEI A;  5CCA A;  4M77 E;  4QVC A;  1YIJ Q;  3OYD A;  2P4R A;  1Y96 A;  1W4S A;  5KYU A;  5LJ5 j;  2OI3 A;  3JB9 I;  5IT9 E;  2JT4 A;  5FRO A;  3V8K A;  1U5S A;  1BYM A;  4J9I A;  1I5O B;  1OOT A;  1YN8 A;  2HKQ B;  3G4S Q;  4XTX A;  3QUI A;  1RI0 A;  3RKW A;  5LJ5 h;  4OMP A;  2L0A A;  4M78 F;  3M4G A;  1VQ5 T;  2ZPF B;  1PWT A;  1UDL A;  2NUP B;  2H8H A;  1RAC B;  3V8J A;  4YTL A;  3FB9 A;  1MV0 B;  5FRM A;  3KFV A;  4XU2 A;  1MUZ A;  1WHJ A;  1R8O B;  3VYG A;  3EGD B;  3S6W A;  2ED1 A;  3OYY A;  2Y4Y A;  3CCS Q;  3M0R A;  2BTT A;  1RAA B;  2KYM A;  1K9M C;  1GXI E;  5GAN 5;  1X43 A;  3LH5 A;  4J8O A;  1Q81 R;  3OW2 S;  4BY6 C;  2X4Y A;  2COZ A;  5C0M A;  1AHJ B;  3EGX B;  2BKD N;  2OAW A;  4MML A;  3QPH A;  4OP0 A;  1Y07 A;  2ZPI B;  3CCL Q;  4HT9 A;  2L89 A;  2E6N A;  1MHN A;  1UE9 A;  4F7U A;  2CKK A;  3SD4 A;  1MNE A;  5GAN g;  1T0J A;  1TG0 A;  4QQG A;  1YCS B;  2EW3 A;  2V1Q A;  1YWO A;  1X2Q A;  4XTY A;  4EMK B;  2EYZ A;  3PGG A;  2JOY A;  2PTK A;  3I55 Q;  2QQ9 A;  2IIM A;  3SEM A;  3CEY A;  1NYG A;  2KAF A;  1QWE A;  3DLM A;  5D6X A;  4IUU A;  4QW2 A;  3VKI A;  1WHH A;  2D6F A;  3ME9 A;  2KNB B;  1OU8 A;  1V29 B;  2VC8 A;  3J81 E;  4M77 B;  1PRL C;  1K1Z A;  3TVT A;  3PIO A;  3JCM c;  5GMK e;  3URG A;  1X2K A;  3VS5 A;  1VQL T;  5KE3 A;  1KQ2 A;  1SRL A;  2BE7 D;  5GAN d;  5GAM f;  1U1T A;  1WLP B;  4OML A;  1OYX A;  2JVV A;  3MEW A;  1B34 A;  1D0X A;  1PD0 A;  3NTH A;  1KFZ A;  4JRK A;  2SRC A;  2G3R A;  3QBY A;  3GOX A;  2F2W A;  3CC7 Q;  2QDY B;  4JJB A;  1XQH A;  1QCO A;  4XAX B;  4RTZ A;  1W1F A;  1D1B A;  1X6B A;  4J6Y A;  3GLX A;  3FIF A;  2E65 A;  3H0I A;  2DJQ A;  5GMK i;  1GCQ A;  1VQM Q;  1QKW A;  1AWX A;  3G6E Q;  2DET A;  1YP5 A;  3WVE B;  2EIF A;  3M0U A;  3M55 A;  4BI3 A;  3OS2 A;  2EYY A;  3DKM A;  3RES A;  1FMK A;  4OVA A;  3EG9 A;  4JUV A;  1K8A U;  1YI2 T;  9ATC B;  2X3W D;  4IUR A;  2PZ1 A;  1F1B B;  4OMQ A;  5A0G A;  5CKB A;  1G3Y A;  1YIT T;  3M4Y A;  5KYY A;  3CC2 T;  1UGR B;  4PKC C;  2Z0W A;  3JCM Q;  2LCL A;  4M7D A;  3VUB A;  1TOV A;  2HNI A;  5I11 A;  2BUD A;  1OEB A;  1VQ7 A;  2QI2 A;  2A0F B;  2XMF A;  1KG1 A;  4ELZ C;  1KD1 C;  1U06 A;  3QJ6 A;  2RHZ A;  3QJY A;  2O2O A;  3GP8 A;  2L3P A;  2CP0 A;  2H3E B;  1K73 R;  1WJS A;  2LJ1 A;  5DLO A;  1WJR A;  5KYW A;  1WA7 A;  4RKU E;  4OGC A;  1RL2 A;  1M90 U;  1IGU A;  4PLL A;  4BE1 A;  1D09 B;  3JB9 F;  2DEU A;  4HCZ A;  4KUD K;  2E64 A;  4BAC A;  1TH7 A;  3V8L A;  2QA4 Q;  2GF7 A;  5CR2 A;  2K3B A;  1WNL A;  3GPL A;  3CCU A;  2O01 E;  4PFP A;  1N27 A;  2MAM A;  3OW2 P;  1VYU A;  2DNU A;  4M77 F;  2K9G A;  1H3H A;  2RJF A;  2RJD A;  1WXB A;  1UG1 A;  1K0X A;  4RUG A;  2SEM A;  3HPW A;  1BCO A;  6AT1 B;  3MEV A;  4ESR A;  1YIJ A;  3KXT A;  3INZ A;  1I5L A;  4LUD A;  5GMK m;  3X28 B;  1UEB A;  4ZGJ B;  4HCK A;  1QLY A;  4CC4 B;  2DL5 A;  3G4S A;  2FB7 A;  4V2S A;  2QQB A;  4AG1 C;  2JS0 A;  4F7U G;  2DL3 A;  2KXD A;  2PNI A;  3WVD B;  5FLX E;  3H0F A;  2EGE A;  2R5M A;  7AT1 B;  2LJ3 A;  3A8G B;  3N5B B;  1I8F A;  5HCK A;  1QP3 A;  4Q5W A;  3M54 A;  3QO3 A;  4C92 A;  4Z88 A;  2KSS A;  2DTI A;  3CCS A;  2RQR A;  3AHU A;  3CCJ Q;  2F69 A;  1BBZ A;  4KH0 B;  3UDC A;  2COW A;  1ABO A;  3SDZ A;  2YUN A;  3CXC S;  1M5Q 1;  2C0O A;  5GAN j;  2JUF A; 
#chains in the Genus database with same CATH homology
 5I21 A;  3C94 A;  4BB7 A;  4EMK C;  2ZGW A;  3CCV T;  4Y28 E;  2RA2 A;  4F7U B;  3CCL T;  4ZGD B;  2VGM A;  4VUB A;  5GAN 3;  3CPF A;  2X4X A;  3SFM A;  4C0Z A;  3I56 T;  1BIB A;  3OYM A;  3CPW A;  3A8M B;  3CCQ T;  1H3Z A;  2PQW A;  2FHD A;  2YHT A;  2YRV A;  3FEO A;  3CCV A;  3P8H A;  2ZPH B;  4M75 A;  3P8D A;  5GAN h;  3OYE A;  3CCL A;  4O5V A;  2LT1 A;  4M78 B;  3OYJ A;  1LJO A;  4QVZ A;  3I56 A;  3CCQ A;  4BDZ A;  3ZBD A;  2DIG A;  1YCY A;  2RJE A;  3MP8 A;  3OBW A;  1X01 A;  3MP1 A;  3CCR T;  3JB9 D;  3JB9 J;  2WSE E;  4RMO A;  3G7Z A;  1O75 A;  3JCM f;  2ZZD A;  4M75 C;  2O4X A;  5LJ3 j;  1YJW T;  2XKO C;  2DAQ A;  2RO0 A;  1NPP A;  3JCM J;  3CCR A;  2E6Z A;  1N9S A;  1VQK T;  4ZGE B;  5GMK l;  3BDU A;  3LX7 A;  4C92 G;  4OB1 B;  3OYF A;  1YJW A;  1Q81 U;  4O6J A;  4ME7 A;  4PJO E;  2QQA A;  2NLU A;  2F5K A;  3OS5 A;  3DLL A;  4C0D C;  3R6O A;  2AHJ B;  5LL6 S;  4JS5 A;  3ZEH A;  5CK9 A;  4JRP A;  2DKG A;  4D6W A;  3PIP A;  4E7H A;  1UGS B;  3MEU A;  1JB0 E;  4C8Q F;  1VQK A;  4C5E A;  2PUO B;  2R57 A;  3A5Z B;  1M5Q 1;  5A0L A;  1U8R A;  1YJN T;  2RB6 A;  4M75 D;  4XU1 A;  2GQV A;  2ZPE B;  1BIA A;  3TU4 K;  4ZTF A;  1M9S A;  1QVF S;  2RH2 A;  3L2R A;  3PMT A;  5CKH A;  1YJN A;  1VQ8 T;  4OB0 B;  1I4K 1;  1KQS A;  3SB2 A;  3QHS A;  3VJP A;  3RIR A;  3VYH B;  1YHQ T;  1K73 U;  4PJO A;  4IKF A;  3BDL A;  2XU8 A;  4X9C A;  2V8J A;  5D6Y A;  2QQS A;  2KDS A;  2VXF A;  2L3R A;  4M7A E;  4HCB A;  1VQ8 A;  1Y7X A;  1YJ9 T;  4M75 G;  1G3W A;  1UGQ B;  4XTW A;  4L59 A;  1VUB A;  1P92 A;  2DZ9 A;  2ZPG B;  5GAM g;  4RG2 A;  1YHQ A;  1M8V A;  4MMK A;  4RG8 A;  3JCM h;  3HSB A;  4EDU A;  1ZBX A;  2DIQ A;  2ZPB B;  4PJO C;  3UPU A;  4J6W A;  4L5G A;  2P0P A;  4XTU A;  5DY9 A;  1YJ9 A;  3A8H B;  3JB9 H;  4FL6 A;  4C92 B;  1Q81 C;  3OW2 A;  1LNX A;  3EFR A;  5GAO m;  5CIU A;  4FT2 A;  5KCH A;  1NJI U;  3CC7 T;  2LQ8 A;  2CZ0 B;  3QYH B;  4LD6 A;  4N4H A;  4HT8 A;  2XHC A;  1VQO A;  2B8A A;  5CKF A;  4E7K A;  2GFU A;  3H8Z A;  3BY7 A;  3MCA B;  4M7A A;  3HRU A;  3X24 B;  3CC7 A;  3V7S A;  4E7J A;  4GLK A;  2LRQ A;  5KE2 A;  2CYZ B;  2KVQ G;  3KUF A;  4OMF B;  4C8Q E;  1DJ7 B;  2DJZ A;  2EAY A;  3GF5 A;  4NL2 A;  2EQU A;  4J83 A;  4DOV A;  5KCO A;  5HK3 A;  3S3N A;  3CCM T;  4M7A C;  4EPC A;  1VQM T;  1K73 C;  5LJ5 f;  3C95 A;  2HAX A;  1M4Z A;  2V8K A;  3DB4 A;  3G6E T;  2RK2 A;  1N8R U;  2GFA A;  5IAY A;  3OA6 A;  4KT0 E;  4NS5 A;  5CQX A;  2XDP A;  4J5Y A;  4R55 A;  4IUQ A;  3QZ9 B;  4M75 B;  3CCM A;  1VQM A;  5J26 A;  4C5G A;  1VQ4 T;  2MWO A;  3HRS A;  3G6E A;  4L6V 5;  2M9U A;  5GAO q;  3HP9 A;  3CMA T;  4PJO G;  4M78 G;  1SSF A;  1VQ6 T;  1U1S A;  3LYI A;  3CD6 T;  4A4E A;  2GCX A;  2OTL T;  4E7I A;  4M7D F;  3TRE A;  2LNV A;  4KBM B;  4ZTJ A;  1QP2 A;  2FYK A;  4A4K A;  4C8Q A;  3PNW C;  3CPW S;  4A4F A;  5GAM d;  1VQ4 A;  2O4X B;  2K4Y A;  4C0D B;  3CMA A;  1NJI C;  4IUP A;  4PNO A;  4ELY C;  4Z02 A;  1VQ6 A;  4QQ6 A;  5LJ3 e;  3CD6 A;  2K5F A;  2OTL A;  1XTD A;  1FX7 A;  2DXC A;  5CCA A;  3OS1 A;  2RI2 A;  4M77 E;  2KMT A;  2R5A A;  2XG8 D;  2DK3 A;  4N4G A;  4B9W A;  5GAN 7;  2L8D A;  2E10 A;  2VUB A;  5FU6 C;  3OBY A;  4QVC A;  3C4S A;  3E1S A;  3OYD A;  3M56 A;  1Y96 A;  1W4S A;  3RMQ A;  5LJ5 j;  3CBM A;  2KK4 A;  2LQK A;  3E19 A;  2DD5 A;  3JB9 I;  4C0G A;  4E7L A;  4GY5 A;  4F7U F;  5IT9 E;  4ATO A;  5FRO A;  3V8K A;  2HQE A;  3CME T;  3X26 B;  5CKD A;  4M7A G;  3VU3 C;  1BYM A;  3WXM B;  1K9M U;  1VIE A;  1N8R C;  4XTX A;  3HFN A;  5C6S A;  3QUI A;  1RI0 A;  3QXE B;  3RKW A;  5LJ5 h;  3CME A;  2I2L A;  4M78 F;  4M77 A;  4J6X A;  4A53 A;  1D3B A;  3M4G A;  4C8Q D;  5LJ3 d;  1VQ5 T;  2ZPF B;  5GAN 2;  3JCM e;  3BW1 A;  4PJO B;  5D6W A;  2ZCF B;  2QQR A;  5GMK j;  2RHI A;  4N0A A;  3NTI A;  3V8J A;  3VV0 A;  1JRI A;  1WGS A;  2E12 A;  4OGE A;  4YTL A;  3S3M A;  1JJ2 S;  4MZP A;  3FB9 A;  1KD1 U;  1VQ5 A;  4M77 C;  5GAO r;  3QSU A;  1QW1 A;  2YLB A;  2DD4 A;  4DOW A;  5FRM A;  2CZ1 B;  5CQY A;  1KQ1 A;  2E41 A;  1G3S A;  3QII A;  2LCC A;  4LDY A;  4XU2 A;  5GAO l;  3JAM E;  1FXX A;  4BI4 A;  2QA4 T;  2EQM A;  2PUK B;  1Y71 A;  4EMG A;  4N0A C;  3C12 A;  4RCB A;  1R8O B;  4RCC A;  5A2Q E;  5GMK h;  3VYG A;  3S3O A;  4MDX A;  2LTO A;  3S6W A;  3OYY A;  2OAU A;  1OZ3 A;  2Y4Y A;  3QYG B;  1NE8 A;  2QA4 A;  2A3L A;  2OTJ T;  1M1F A;  3TCJ A;  4M7A B;  3X25 B;  1K9M C;  3JB9 G;  3GIB A;  4M77 D;  3HHT B;  3OYC A;  5GAN 5;  1GXI E;  4TVR A;  3JRZ A;  1ZHI A;  4J8O A;  2OTJ A;  1O9S A;  3OW2 S;  1XOV A;  4BY6 C;  4NOY A;  1JJ2 A;  2X4Y A;  3MHX A;  4FM4 B;  1Q82 U;  5C0M A;  1AHJ B;  1N6A A;  3SWN A;  2BKD N;  2DPP B;  4IUV A;  2RHX A;  4MML A;  3LGF A;  2VYT A;  3QPH A;  4OP0 A;  5I2M A;  4FSX A;  1Y07 A;  3H6Z A;  3UWN A;  4C5I A;  3NFC A;  3L2Z A;  2ZPI B;  3RER A;  5DLQ E;  4HT9 A;  4JS4 A;  3FLG A;  4M77 G;  4PL6 A;  2L89 A;  3RKX A;  2RJC A;  4PLI A;  5GAN 4;  3SWN C;  2E6N A;  2MI6 A;  3ER0 A;  2D0Q B;  1MHN A;  4C92 F;  4F7U A;  2CKK A;  3SD4 A;  3P8B B;  4IUT A;  2RHU A;  3V7R A;  2K3X A;  5FU6 B;  5GAN g;  4QQG A;  3FC3 A;  3LW5 E;  4CRI A;  2XDB A;  5IN1 A;  2XDD A;  4MZT A;  3OYH A;  2QTX A;  4JJN K;  2P0Q A;  4XTY A;  5A0D A;  3CBO A;  4BD3 A;  2EWN A;  3E9G A;  3OQ5 A;  4EMK B;  4WF2 A;  2P0K A;  3MET A;  4M7D D;  3PGG A;  2JOY A;  2EJF A;  1UB4 A;  2E1H A;  2QQ9 A;  3KBG A;  3L2U A;  5LJ5 e;  1FWZ A;  3CEY A;  2PVD B;  3LH0 A;  3MO8 A;  2KAF A;  2XIC A;  4J7I A;  1QVG A;  1WQ7 A;  1Q82 C;  2PVG B;  3DLM A;  5D6X A;  3X20 B;  3JCM X;  3CCJ T;  4IUU A;  1HXD A;  2MWP A;  2VGN A;  4QW2 A;  2DXT A;  5GAN e;  4R56 A;  2XD0 A;  3VKI A;  2QEX T;  4JLI A;  5HK0 A;  5CVI A;  3O8V A;  4HKE A;  5HKC A;  2D6F A;  2EQK A;  3ME9 A;  4M75 F;  5LJ3 g;  4OB2 B;  2EFI A;  1V29 B;  2VC8 A;  3J81 E;  4M77 B;  3CCJ A;  1IRE B;  1D3B B;  4BDY A;  2PU9 B;  3PIO A;  5FU7 C;  2JZ2 A;  2DO3 A;  3L42 A;  3JCM b;  2X35 A;  2WSC E;  3JCM c;  3J80 E;  2JNG A;  4FIB A;  3URG A;  5GMK e;  2CGH A;  2RI3 A;  3HL8 A;  3CC4 T;  1M1K U;  5CKE A;  1X75 C;  2MMP A;  4UC4 A;  2A7Y A;  1VQL T;  1QVP A;  4JRI A;  3QZ5 B;  5KE3 A;  1X6O A;  3OYG A;  4LDU A;  3JCM V;  1KQ2 A;  2CZ7 B;  4KUL A;  1G3T A;  3CC4 A;  3MP6 A;  2EQJ A;  5GAN d;  5GAM f;  1U1T A;  2FVU A;  1VIF A;  3M58 A;  1OYX A;  1VQL A;  3FJP A;  2JVV A;  3MEW A;  4II1 A;  4C8Q C;  1B34 A;  2JN0 A;  2QXF A;  3NTH A;  3JCM g;  4BY6 B;  2EKO A;  4JRK A;  2G3R A;  2LT4 A;  3QBY A;  2DTO A;  2IG0 A;  1KHC A;  2LVM A;  3GOX A;  1QVG S;  2K3Y A;  2QDY B;  4X34 A;  1XQH A;  3EFS A;  4A54 A;  2C06 A;  4XTZ A;  5L8R E;  4XAX B;  3NTK A;  4BE0 A;  3FDR A;  4J6Y A;  1WPY A;  3GLX A;  3FIF A;  2E65 A;  2X4W A;  4PJO F;  4FU6 A;  3M5A A;  3SWN B;  3VUZ A;  3JCM P;  4MDW A;  4LDX A;  5GAN 6;  2RK1 A;  3OB9 A;  2P4T A;  5GMK i;  5GAO n;  1M1K C;  3RUX A;  4JLG A;  4MZM A;  5GAM j;  1PSE A;  2EYQ A;  1I81 A;  4NL3 A;  3M59 A;  2RI5 A;  3OY9 A;  3QG1 A;  3DB3 A;  3WVE B;  2EIF A;  3A8O B;  3M55 A;  4BI3 A;  1VQN T;  4Y91 A;  3EAE A;  3OS2 A;  3DKM A;  3RES A;  4OVA A;  4M7D E;  2FL7 A;  4XU0 A;  4BE2 A;  4J7F A;  4JUV A;  4P5N A;  4X9D A;  1K8A U;  3BFM A;  1YI2 T;  4C8Q G;  5GAM h;  1XNI A;  2JTF A;  3OSV A;  4IUR A;  3RKY A;  4BUG A;  4N4I A;  4LDW A;  1WQW A;  4BI8 B;  3TEE A;  2LX9 A;  1VQN A;  4M7A F;  5A0G A;  1BI1 A;  5CKB A;  1G3Y A;  4C5H A;  5I2S A;  3OYL A;  1YIT T;  2DVE A;  4C92 D;  3M4Y A;  5J39 A;  3CC2 T;  1YI2 A;  5M9O A;  3JSC A;  1UGR B;  3Q1J A;  4PKC C;  3JCM d;  4OF1 A;  1KC8 U;  3M53 A;  1M1G A;  1H64 1;  5GAN 8;  1YIT A;  3L2W A;  4HCC A;  3JCM Q;  3L2V A;  3PFS A;  1WJQ A;  2CZ6 B;  2X4J A;  4HA8 A;  4F7U E;  1VQ7 T;  1HK9 A;  5CO7 A;  1W2B A;  1PSF A;  2LCL A;  3CXC A;  4M7D A;  1BKB A;  3HFO A;  3HKS A;  5FU7 B;  3VUB A;  4ZN1 A;  3I55 T;  1BI0 A;  4JRQ A;  2HNI A;  2M0O A;  2BUD A;  3OYN A;  4JDS A;  3CCE T;  2EJ9 A;  4QVD A;  2QI2 A;  3QKJ A;  2XID A;  1VQ7 A;  3CC2 A;  3LLR A;  1KG1 A;  5GAO p;  3ASK A;  4M78 E;  3I55 A;  4ELZ C;  1KD1 C;  4M7D C;  5LJ3 h;  4OB3 B;  2R58 A;  2DZC A;  3PTA A;  4QQD A;  1S72 T;  3CCE A;  2RHZ A;  3QJ6 A;  2E5Q A;  3QJY A;  2LDM A;  4CI0 C;  3OYA A;  3GP8 A;  3E9F A;  3JCM W;  1VQ9 T;  5LJ5 g;  2V8I A;  3OS0 A;  1K8A C;  3MEA A;  1WJS A;  4C8Q B;  1N9R A;  3FRN A;  5AYF A;  2LC4 A;  5DLO A;  1WJR A;  1S72 A;  4RKU E;  4OGC A;  1RL2 A;  1M90 U;  1UGP B;  1VQ9 A;  4PLL A;  4BE1 A;  3JB9 F;  3CCU T;  2E70 A;  4HCZ A;  4KUD K;  3G71 T;  2E64 A;  1VQP T;  3HRT A;  3OYB A;  4BAC A;  1TH7 A;  1YBY A;  3LGL A;  4M78 A;  3V8L A;  1B34 B;  1KC8 C;  3CBP A;  2GF7 A;  1NPR A;  5CR2 A;  1WNL A;  3OMG A;  4XU3 A;  3GPL A;  1Y96 B;  1IZ6 A;  2DXB A;  2O01 E;  2JTM A;  2DTH A;  3G71 A;  3CCU A;  1VQP A;  1N27 A;  1ZQ1 A;  2K2V A;  2MF2 A;  3T9N A;  2MAM A;  4XQ3 A;  2YLC A;  3LWH A;  1KQS S;  1BI3 A;  4M78 C;  3ZFJ A;  2K5I A;  1VQO T;  1YIJ T;  1Q86 U;  4FT4 A;  4M77 F;  1EIF A;  1OZ2 A;  3OMC A;  2XK0 A;  5DM7 R;  2RJF A;  2RJD A;  4M7D G;  1JBM A;  1Q7Y U;  3HPW A;  5FRN A;  2CS7 A;  2DEQ A;  2Y90 A;  1QVF A;  2HBP A;  2WSF E;  3F70 A;  3M57 A;  3MEV A;  2QEX A;  3KXT A;  3LWI A;  1YIJ A;  2BIV A;  3INZ A;  2H3J A;  1I5L A;  3G4S T;  2HQX A;  5GMK m;  5HY6 A;  3J7A F;  4LDV A;  5J3B A;  3X28 B;  5GAM e;  2WAC A;  3GNG A;  4ZN3 A;  1UEB A;  2M16 A;  4B9X A;  4ZGJ B;  3OYK A;  4PJO D;  4M78 D;  1M90 C;  5LJ5 d;  3G4S A;  2FB7 A;  3OYI A;  2XI9 A;  5CAI A;  4V2S A;  2K57 A;  1BI2 A;  4C92 E;  3M9Q A;  2QQB A;  3V7C A;  4F7U G;  3A8L B;  4C0F A;  2RHY A;  3WVD B;  2D9T A;  5FLX E;  4A4H A;  2VXE A;  5GAN f;  2KQW A;  3L2Q A;  3PMI A;  4XTV A;  2F5T X;  4XK8 E;  2M1H A;  2K5L A;  4EMH A;  2R5M A;  2Y4X A;  1LOJ A;  2DXU A;  2IVW A;  5EG2 A;  3A8G B;  1MGQ A;  3N5B B;  1I8F A;  1Q86 C;  1QP3 A;  4Q5W A;  2PVO B;  2KY9 A;  3CCS T;  3M54 A;  3QO3 A;  4M7A D;  1NZ9 A;  4C92 A;  4DA4 A;  4M7D B;  3L1A A;  1Q7Y C;  3RMS A;  3GNF B;  2KSS A;  1KHI A;  2DTI A;  3UT1 A;  3CCS A;  3OSS C;  4EMK A;  3AHU A;  5KH6 A;  2RM4 A;  2F69 A;  4A4G A;  4KUI A;  4M75 E;  1G5V A;  2VV5 A;  3PT9 A;  2EJG A;  3QDR B;  4DQ2 A;  4LD9 K;  2L5Q A;  4C92 C;  3UDC A;  5LJ3 f;  3SDZ A;  1W2B S;  3CXC S;  4E47 A;  2HD0 A;  1OI1 A;  2RD1 A;  5GAN j;  2JUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...