2KDVA

Solution structure of rna pyrophosphohydrolase rpph from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
164
structure length
164
Chain Sequence
MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA pyrophosphohydrolase
publication title Solution structure of RNA pyrophosphohydrolase RppH from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 39
structure length 164
sequence length 164
ec nomenclature ec 3.6.1.-:
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2kdvA00
1F3YA 1VIUA 3CNGA 5ANWA 1V8WA 2VNPA 3BAPA 3H95A 3MGMA 1NFSA 2YVNA 2YVMA 5GHOA 1GA7A 4JZSA 3P6YA 4NFXA 3X0LA 1OW2A 5ISYA 5GHMA 3Q4IA 5GHPA 3GWYA 1SOIA 4ILQA 2GB5A 2CL3A 3X0QA 3MDGA 3Q2TA 2QJOA 3O61A 4C9WA 3FSPA 4YOQA 3G0QA 1RRQA 2DHOA 1V8MA 3SMDA 1VCDA 3GZ5A 2B2KA 4S2XA 2A6TA 3O52A 3X0PA 5FSMA 3Q93A 1IRYA 2ICJA 4JZTA 5BS6A 5IW5A 3FJYA 3A6TA 1V8LA 2KDWA 2QKMB 3SHDA 5DPKA 3X0MA 5GHNA 1PPWA 1PUQA 1QVJA 3COUA 3Q91A 3WHWA 1TUMA 3O6ZA 3F6AA 1SZ3A 1PVFA 1R67A 1MP2A 1VHGA 3I9XA 3O8SA 1X84A 3GZ8A 2DSDA 4ICKA 3KVHA 3EXQA 4YPHA 1K26A 3ACAA 1KTGA 1RYAA 1MQEA 2GT4A 2A8SA 3AC9A 5LPGA 1V8NA 3O69A 5ANUA 3A6VA 2O5FA 1V8SA 3RH7A 1V8RA 4MPOA 1MQWA 2G73A 2KDVA 4KYXA 3GZ6A 1VC9A 1V8UA 1VHZA 4NFWA 1PUSA 2ICKA 2QJTA 3HHJA 2GT2A 1SJYA 5BONA 4DYWA 4JZUA 3BM4A 5ANTA 3N77A 1PUNA 1G0SA 4IJXA 5FSIA 5DDGA 2VNQA 2RRKA 5CFJA 4YPRA 4V14A 2AZWA 1NQYA 2DSCA 3N9UA 5DEQA 3SONA 3DKUA 4KG4A 3FCMA 5FSOA 5GHIA 4KG3A 5HZXA 3L85A 3J7Ye 3EESA 2O5WA 1G9QA 4N1UA 5ANSA 1JRKA 1MUTA 3U53A 2A8QA 3EEUA 3X0JA 3Q2SA 2I6KA 4HFQA 3FFUA 1SU2A 2DSBA 2I8UA 1V8IA 3X0RA 1JKNA 2G74A 1Q54A 1VC8A 2YYHA 4N1TA 4C9XA 3I7UA 3ID9A 5ANVA 3I7VA 2FKBA 3X0IA 2YVOA 4HVYA 4JZVA 5FSKA 2B0VA 5CFIA 1RRSA 1NFZA 2FMLA 3QSJA 2W4EA 1V8VA 2DUKA 2A8RA 3Q1PA 3X0NA 1XSAA 2FVVA 3R03A 2J8QA 1MR2A 1Q27A 5C7QA 2O1CA 1VK6A 1MK1A 3P5TA 3ZR0A 2I8TA 2JVBA 1VRLA 1XSCA 2R5WA 2PQVA 3OGAA 1NQZA 4K6EA 2A8PA 3GRNA 2XSQA 3EF5A 1I9AA 3A6UA 5GHQA 4ZG0A 4S2WA 1Q33A 3GG6A 4S2VA 5C7TA 3ZR1A 1KHZA 3FK9A 1PPXA 1KT9A 2A8TA 1V8YA 3HYQA 3X0OA 1HZTA 1K2EA 5I8UA 1X83A 5IW4A 2YVPA 2Q9PA 3A6SA 4S2YA 4KTBA 1XSBA 2B06A 1HX3A 3X0KA 5DD4A 5C8LA 2PNYA 5GHJA 1U20A 3BHOA 5FSLA 3DUPA 1VIQA 1X51A 1PPVA 3F13A 1V8TA 3X0SA 3MDIA 5FSNA 3E57A 3MCFA
chains in the Genus database with same CATH superfamily
1F3YA 1VIUA 3CNGA 5ANWA 1V8WA 2VNPA 3BAPA 3H95A 3MGMA 1NFSA 2YVNA 2YVMA 5GHOA 1GA7A 4JZSA 3P6YA 4NFXA 3X0LA 1OW2A 5ISYA 5GHMA 3Q4IA 5GHPA 3GWYA 1SOIA 4ILQA 2GB5A 2CL3A 3X0QA 3MDGA 3Q2TA 2QJOA 3O61A 4C9WA 3FSPA 4YOQA 3G0QA 1RRQA 2DHOA 1V8MA 3SMDA 1VCDA 3GZ5A 2B2KA 4S2XA 2A6TA 3O52A 3X0PA 5FSMA 3Q93A 1IRYA 2ICJA 4JZTA 5BS6A 5IW5A 3FJYA 3A6TA 1V8LA 2KDWA 2QKMB 3SHDA 5DPKA 3X0MA 5GHNA 1PPWA 1PUQA 1QVJA 3COUA 3Q91A 3WHWA 1TUMA 3O6ZA 3F6AA 1SZ3A 1PVFA 1R67A 1MP2A 1VHGA 3I9XA 3O8SA 1X84A 3GZ8A 2DSDA 4ICKA 3KVHA 3EXQA 4YPHA 1K26A 3ACAA 1KTGA 1RYAA 1MQEA 2GT4A 2A8SA 3AC9A 5LPGA 1V8NA 3O69A 5ANUA 3A6VA 2O5FA 1V8SA 3RH7A 1V8RA 4MPOA 1MQWA 2G73A 2KDVA 4KYXA 3GZ6A 1VC9A 1V8UA 1VHZA 4NFWA 1PUSA 2ICKA 2QJTA 3HHJA 2GT2A 1SJYA 5BONA 4DYWA 4JZUA 3BM4A 5ANTA 3N77A 1PUNA 1G0SA 4IJXA 2CZRA 5FSIA 5DDGA 2VNQA 2RRKA 5CFJA 4YPRA 4V14A 2AZWA 1NQYA 2DSCA 3N9UA 5DEQA 3SONA 3DKUA 4KG4A 3FCMA 5FSOA 5GHIA 4KG3A 5HZXA 3L85A 3J7Ye 3EESA 2O5WA 1G9QA 4N1UA 5ANSA 1JRKA 1MUTA 3U53A 2A8QA 3EEUA 3X0JA 3Q2SA 2I6KA 4HFQA 3FFUA 1SU2A 2DSBA 2I8UA 1V8IA 3X0RA 1JKNA 2G74A 1Q54A 1VC8A 2YYHA 4N1TA 4C9XA 3I7UA 3ID9A 5ANVA 3I7VA 2FKBA 3X0IA 2YVOA 4HVYA 4JZVA 5FSKA 2B0VA 5CFIA 1RRSA 1NFZA 2FMLA 3QSJA 2W4EA 1V8VA 2DUKA 2A8RA 3Q1PA 3X0NA 1XSAA 2FVVA 3R03A 2J8QA 1MR2A 1Q27A 5C7QA 2O1CA 1VK6A 1MK1A 3P5TA 3ZR0A 2I8TA 2JVBA 1VRLA 1XSCA 2R5WA 2PQVA 3OGAA 1NQZA 4K6EA 2A8PA 3GRNA 2XSQA 3EF5A 1I9AA 4J7HA 3A6UA 5GHQA 4ZG0A 4S2WA 1Q33A 3GG6A 4S2VA 5C7TA 3ZR1A 1KHZA 3FK9A 1PPXA 1KT9A 4J7GA 2A8TA 1V8YA 3HYQA 3X0OA 1HZTA 1K2EA 5I8UA 1X83A 5IW4A 2YVPA 2Q9PA 3A6SA 4S2YA 4KTBA 1XSBA 2B06A 1HX3A 3X0KA 5DD4A 5C8LA 2PNYA 5GHJA 1U20A 3BHOA 5FSLA 3DUPA 1VIQA 1X51A 1PPVA 3F13A 1V8TA 3X0SA 3MDIA 5FSNA 3E57A 3MCFA
chains in the Genus database with same CATH topology
1F3YA 1VIUA 3CNGA 5ANWA 1V8WA 2VNPA 3BAPA 3H95A 3MGMA 1NFSA 2YVNA 2YVMA 5GHOA 1GA7A 4JZSA 3P6YA 4NFXA 3X0LA 1OW2A 5ISYA 5GHMA 3Q4IA 5GHPA 3GWYA 1SOIA 4ILQA 2GB5A 2CL3A 3X0QA 3MDGA 3Q2TA 2QJOA 3O61A 4C9WA 3FSPA 4YOQA 3G0QA 1RRQA 2DHOA 1V8MA 3SMDA 1VCDA 3GZ5A 2B2KA 4S2XA 2A6TA 3O52A 3X0PA 5FSMA 3Q93A 1IRYA 2ICJA 4JZTA 5BS6A 5IW5A 3FJYA 3A6TA 1V8LA 2KDWA 2QKMB 3SHDA 5DPKA 3X0MA 5GHNA 1PPWA 1PUQA 1QVJA 3COUA 3Q91A 3WHWA 1TUMA 3O6ZA 3F6AA 1SZ3A 1PVFA 1R67A 1MP2A 1VHGA 3I9XA 3O8SA 1X84A 3GZ8A 2DSDA 4ICKA 3KVHA 3EXQA 4YPHA 1K26A 3ACAA 1KTGA 1RYAA 1MQEA 2GT4A 2A8SA 3AC9A 5LPGA 1V8NA 3O69A 5ANUA 3A6VA 2O5FA 1V8SA 3RH7A 1V8RA 4MPOA 1MQWA 2G73A 2KDVA 4KYXA 3GZ6A 1VC9A 1V8UA 1VHZA 4NFWA 1PUSA 2ICKA 2QJTA 3HHJA 2GT2A 1SJYA 5BONA 4DYWA 4JZUA 3BM4A 5ANTA 3N77A 1PUNA 1G0SA 4IJXA 2CZRA 5FSIA 5DDGA 2VNQA 2RRKA 5CFJA 4YPRA 4V14A 2AZWA 1NQYA 2DSCA 3N9UA 5DEQA 3SONA 3DKUA 4KG4A 3FCMA 5FSOA 5GHIA 4KG3A 5HZXA 3L85A 3J7Ye 3EESA 2O5WA 1G9QA 4N1UA 5ANSA 1JRKA 1MUTA 3U53A 2A8QA 3EEUA 3X0JA 3Q2SA 2I6KA 4HFQA 3FFUA 1SU2A 2DSBA 2I8UA 1V8IA 3X0RA 1JKNA 2G74A 1Q54A 1VC8A 2YYHA 4N1TA 4C9XA 3I7UA 3ID9A 5ANVA 3I7VA 2FKBA 3X0IA 2YVOA 4HVYA 4JZVA 5FSKA 2B0VA 5CFIA 1RRSA 1NFZA 2FMLA 3QSJA 2W4EA 1V8VA 2DUKA 2A8RA 3Q1PA 3X0NA 1XSAA 2FVVA 3R03A 2J8QA 1MR2A 1Q27A 5C7QA 2O1CA 1VK6A 1MK1A 3P5TA 3ZR0A 2I8TA 2JVBA 1VRLA 1XSCA 2R5WA 2PQVA 3OGAA 1NQZA 4K6EA 2A8PA 3GRNA 2XSQA 3EF5A 1I9AA 4J7HA 3A6UA 5GHQA 4ZG0A 4S2WA 1Q33A 3GG6A 4S2VA 5C7TA 3ZR1A 1KHZA 3FK9A 1PPXA 1KT9A 4J7GA 2A8TA 1V8YA 3HYQA 3X0OA 1HZTA 1K2EA 5I8UA 1X83A 5IW4A 2YVPA 2Q9PA 3A6SA 4S2YA 4KTBA 1XSBA 2B06A 1HX3A 3X0KA 5DD4A 5C8LA 2PNYA 5GHJA 1U20A 3BHOA 5FSLA 3DUPA 1VIQA 1X51A 1PPVA 3F13A 1V8TA 3X0SA 3MDIA 5FSNA 3E57A 3MCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3Y A;  1VIU A;  3CNG A;  5ANW A;  1V8W A;  2VNP A;  3BAP A;  3H95 A;  3MGM A;  1NFS A;  2YVN A;  2YVM A;  5GHO A;  1GA7 A;  4JZS A;  3P6Y A;  4NFX A;  3X0L A;  1OW2 A;  5ISY A;  5GHM A;  3Q4I A;  5GHP A;  3GWY A;  1SOI A;  4ILQ A;  2GB5 A;  2CL3 A;  3X0Q A;  3MDG A;  3Q2T A;  2QJO A;  3O61 A;  4C9W A;  3FSP A;  4YOQ A;  3G0Q A;  1RRQ A;  2DHO A;  1V8M A;  3SMD A;  1VCD A;  3GZ5 A;  2B2K A;  4S2X A;  2A6T A;  3O52 A;  3X0P A;  5FSM A;  3Q93 A;  1IRY A;  2ICJ A;  4JZT A;  5BS6 A;  5IW5 A;  3FJY A;  3A6T A;  1V8L A;  2KDW A;  2QKM B;  3SHD A;  5DPK A;  3X0M A;  5GHN A;  1PPW A;  1PUQ A;  1QVJ A;  3COU A;  3Q91 A;  3WHW A;  1TUM A;  3O6Z A;  3F6A A;  1SZ3 A;  1PVF A;  1R67 A;  1MP2 A;  1VHG A;  3I9X A;  3O8S A;  1X84 A;  3GZ8 A;  2DSD A;  4ICK A;  3KVH A;  3EXQ A;  4YPH A;  1K26 A;  3ACA A;  1KTG A;  1RYA A;  1MQE A;  2GT4 A;  2A8S A;  3AC9 A;  5LPG A;  1V8N A;  3O69 A;  5ANU A;  3A6V A;  2O5F A;  1V8S A;  3RH7 A;  1V8R A;  4MPO A;  1MQW A;  2G73 A;  2KDV A;  4KYX A;  3GZ6 A;  1VC9 A;  1V8U A;  1VHZ A;  4NFW A;  1PUS A;  2ICK A;  2QJT A;  3HHJ A;  2GT2 A;  1SJY A;  5BON A;  4DYW A;  4JZU A;  3BM4 A;  5ANT A;  3N77 A;  1PUN A;  1G0S A;  4IJX A;  5FSI A;  5DDG A;  2VNQ A;  2RRK A;  5CFJ A;  4YPR A;  4V14 A;  2AZW A;  1NQY A;  2DSC A;  3N9U A;  5DEQ A;  3SON A;  3DKU A;  4KG4 A;  3FCM A;  5FSO A;  5GHI A;  4KG3 A;  5HZX A;  3L85 A;  3J7Y e;  3EES A;  2O5W A;  1G9Q A;  4N1U A;  5ANS A;  1JRK A;  1MUT A;  3U53 A;  2A8Q A;  3EEU A;  3X0J A;  3Q2S A;  2I6K A;  4HFQ A;  3FFU A;  1SU2 A;  2DSB A;  2I8U A;  1V8I A;  3X0R A;  1JKN A;  2G74 A;  1Q54 A;  1VC8 A;  2YYH A;  4N1T A;  4C9X A;  3I7U A;  3ID9 A;  5ANV A;  3I7V A;  2FKB A;  3X0I A;  2YVO A;  4HVY A;  4JZV A;  5FSK A;  2B0V A;  5CFI A;  1RRS A;  1NFZ A;  2FML A;  3QSJ A;  2W4E A;  1V8V A;  2DUK A;  2A8R A;  3Q1P A;  3X0N A;  1XSA A;  2FVV A;  3R03 A;  2J8Q A;  1MR2 A;  1Q27 A;  5C7Q A;  2O1C A;  1VK6 A;  1MK1 A;  3P5T A;  3ZR0 A;  2I8T A;  2JVB A;  1VRL A;  1XSC A;  2R5W A;  2PQV A;  3OGA A;  1NQZ A;  4K6E A;  2A8P A;  3GRN A;  2XSQ A;  3EF5 A;  1I9A A;  3A6U A;  5GHQ A;  4ZG0 A;  4S2W A;  1Q33 A;  3GG6 A;  4S2V A;  5C7T A;  3ZR1 A;  1KHZ A;  3FK9 A;  1PPX A;  1KT9 A;  2A8T A;  1V8Y A;  3HYQ A;  3X0O A;  1HZT A;  1K2E A;  5I8U A;  1X83 A;  5IW4 A;  2YVP A;  2Q9P A;  3A6S A;  4S2Y A;  4KTB A;  1XSB A;  2B06 A;  1HX3 A;  3X0K A;  5DD4 A;  5C8L A;  2PNY A;  5GHJ A;  1U20 A;  3BHO A;  5FSL A;  3DUP A;  1VIQ A;  1X51 A;  1PPV A;  3F13 A;  1V8T A;  3X0S A;  3MDI A;  5FSN A;  3E57 A;  3MCF A; 
#chains in the Genus database with same CATH topology
 1F3Y A;  1VIU A;  3CNG A;  5ANW A;  1V8W A;  2VNP A;  3BAP A;  3H95 A;  3MGM A;  1NFS A;  2YVN A;  2YVM A;  5GHO A;  1GA7 A;  4JZS A;  3P6Y A;  4NFX A;  3X0L A;  1OW2 A;  5ISY A;  5GHM A;  3Q4I A;  5GHP A;  3GWY A;  1SOI A;  4ILQ A;  2GB5 A;  2CL3 A;  3X0Q A;  3MDG A;  3Q2T A;  2QJO A;  3O61 A;  4C9W A;  3FSP A;  4YOQ A;  3G0Q A;  1RRQ A;  2DHO A;  1V8M A;  3SMD A;  1VCD A;  3GZ5 A;  2B2K A;  4S2X A;  2A6T A;  3O52 A;  3X0P A;  5FSM A;  3Q93 A;  1IRY A;  2ICJ A;  4JZT A;  5BS6 A;  5IW5 A;  3FJY A;  3A6T A;  1V8L A;  2KDW A;  2QKM B;  3SHD A;  5DPK A;  3X0M A;  5GHN A;  1PPW A;  1PUQ A;  1QVJ A;  3COU A;  3Q91 A;  3WHW A;  1TUM A;  3O6Z A;  3F6A A;  1SZ3 A;  1PVF A;  1R67 A;  1MP2 A;  1VHG A;  3I9X A;  3O8S A;  1X84 A;  3GZ8 A;  2DSD A;  4ICK A;  3KVH A;  3EXQ A;  4YPH A;  1K26 A;  3ACA A;  1KTG A;  1RYA A;  1MQE A;  2GT4 A;  2A8S A;  3AC9 A;  5LPG A;  1V8N A;  3O69 A;  5ANU A;  3A6V A;  2O5F A;  1V8S A;  3RH7 A;  1V8R A;  4MPO A;  1MQW A;  2G73 A;  2KDV A;  4KYX A;  3GZ6 A;  1VC9 A;  1V8U A;  1VHZ A;  4NFW A;  1PUS A;  2ICK A;  2QJT A;  3HHJ A;  2GT2 A;  1SJY A;  5BON A;  4DYW A;  4JZU A;  3BM4 A;  5ANT A;  3N77 A;  1PUN A;  1G0S A;  4IJX A;  2CZR A;  5FSI A;  5DDG A;  2VNQ A;  2RRK A;  5CFJ A;  4YPR A;  4V14 A;  2AZW A;  1NQY A;  2DSC A;  3N9U A;  5DEQ A;  3SON A;  3DKU A;  4KG4 A;  3FCM A;  5FSO A;  5GHI A;  4KG3 A;  5HZX A;  3L85 A;  3J7Y e;  3EES A;  2O5W A;  1G9Q A;  4N1U A;  5ANS A;  1JRK A;  1MUT A;  3U53 A;  2A8Q A;  3EEU A;  3X0J A;  3Q2S A;  2I6K A;  4HFQ A;  3FFU A;  1SU2 A;  2DSB A;  2I8U A;  1V8I A;  3X0R A;  1JKN A;  2G74 A;  1Q54 A;  1VC8 A;  2YYH A;  4N1T A;  4C9X A;  3I7U A;  3ID9 A;  5ANV A;  3I7V A;  2FKB A;  3X0I A;  2YVO A;  4HVY A;  4JZV A;  5FSK A;  2B0V A;  5CFI A;  1RRS A;  1NFZ A;  2FML A;  3QSJ A;  2W4E A;  1V8V A;  2DUK A;  2A8R A;  3Q1P A;  3X0N A;  1XSA A;  2FVV A;  3R03 A;  2J8Q A;  1MR2 A;  1Q27 A;  5C7Q A;  2O1C A;  1VK6 A;  1MK1 A;  3P5T A;  3ZR0 A;  2I8T A;  2JVB A;  1VRL A;  1XSC A;  2R5W A;  2PQV A;  3OGA A;  1NQZ A;  4K6E A;  2A8P A;  3GRN A;  2XSQ A;  3EF5 A;  1I9A A;  4J7H A;  3A6U A;  5GHQ A;  4ZG0 A;  4S2W A;  1Q33 A;  3GG6 A;  4S2V A;  5C7T A;  3ZR1 A;  1KHZ A;  3FK9 A;  1PPX A;  1KT9 A;  4J7G A;  2A8T A;  1V8Y A;  3HYQ A;  3X0O A;  1HZT A;  1K2E A;  5I8U A;  1X83 A;  5IW4 A;  2YVP A;  2Q9P A;  3A6S A;  4S2Y A;  4KTB A;  1XSB A;  2B06 A;  1HX3 A;  3X0K A;  5DD4 A;  5C8L A;  2PNY A;  5GHJ A;  1U20 A;  3BHO A;  5FSL A;  3DUP A;  1VIQ A;  1X51 A;  1PPV A;  3F13 A;  1V8T A;  3X0S A;  3MDI A;  5FSN A;  3E57 A;  3MCF A; 
#chains in the Genus database with same CATH homology
 1F3Y A;  1VIU A;  3CNG A;  5ANW A;  1V8W A;  2VNP A;  3BAP A;  3H95 A;  3MGM A;  1NFS A;  2YVN A;  2YVM A;  5GHO A;  1GA7 A;  4JZS A;  3P6Y A;  4NFX A;  3X0L A;  1OW2 A;  5ISY A;  5GHM A;  3Q4I A;  5GHP A;  3GWY A;  1SOI A;  4ILQ A;  2GB5 A;  2CL3 A;  3X0Q A;  3MDG A;  3Q2T A;  2QJO A;  3O61 A;  4C9W A;  3FSP A;  4YOQ A;  3G0Q A;  1RRQ A;  2DHO A;  1V8M A;  3SMD A;  1VCD A;  3GZ5 A;  2B2K A;  4S2X A;  2A6T A;  3O52 A;  3X0P A;  5FSM A;  3Q93 A;  1IRY A;  2ICJ A;  4JZT A;  5BS6 A;  5IW5 A;  3FJY A;  3A6T A;  1V8L A;  2KDW A;  2QKM B;  3SHD A;  5DPK A;  3X0M A;  5GHN A;  1PPW A;  1PUQ A;  1QVJ A;  3COU A;  3Q91 A;  3WHW A;  1TUM A;  3O6Z A;  3F6A A;  1SZ3 A;  1PVF A;  1R67 A;  1MP2 A;  1VHG A;  3I9X A;  3O8S A;  1X84 A;  3GZ8 A;  2DSD A;  4ICK A;  3KVH A;  3EXQ A;  4YPH A;  1K26 A;  3ACA A;  1KTG A;  1RYA A;  1MQE A;  2GT4 A;  2A8S A;  3AC9 A;  5LPG A;  1V8N A;  3O69 A;  5ANU A;  3A6V A;  2O5F A;  1V8S A;  3RH7 A;  1V8R A;  4MPO A;  1MQW A;  2G73 A;  2KDV A;  4KYX A;  3GZ6 A;  1VC9 A;  1V8U A;  1VHZ A;  4NFW A;  1PUS A;  2ICK A;  2QJT A;  3HHJ A;  2GT2 A;  1SJY A;  5BON A;  4DYW A;  4JZU A;  3BM4 A;  5ANT A;  3N77 A;  1PUN A;  1G0S A;  4IJX A;  2CZR A;  5FSI A;  5DDG A;  2VNQ A;  2RRK A;  5CFJ A;  4YPR A;  4V14 A;  2AZW A;  1NQY A;  2DSC A;  3N9U A;  5DEQ A;  3SON A;  3DKU A;  4KG4 A;  3FCM A;  5FSO A;  5GHI A;  4KG3 A;  5HZX A;  3L85 A;  3J7Y e;  3EES A;  2O5W A;  1G9Q A;  4N1U A;  5ANS A;  1JRK A;  1MUT A;  3U53 A;  2A8Q A;  3EEU A;  3X0J A;  3Q2S A;  2I6K A;  4HFQ A;  3FFU A;  1SU2 A;  2DSB A;  2I8U A;  1V8I A;  3X0R A;  1JKN A;  2G74 A;  1Q54 A;  1VC8 A;  2YYH A;  4N1T A;  4C9X A;  3I7U A;  3ID9 A;  5ANV A;  3I7V A;  2FKB A;  3X0I A;  2YVO A;  4HVY A;  4JZV A;  5FSK A;  2B0V A;  5CFI A;  1RRS A;  1NFZ A;  2FML A;  3QSJ A;  2W4E A;  1V8V A;  2DUK A;  2A8R A;  3Q1P A;  3X0N A;  1XSA A;  2FVV A;  3R03 A;  2J8Q A;  1MR2 A;  1Q27 A;  5C7Q A;  2O1C A;  1VK6 A;  1MK1 A;  3P5T A;  3ZR0 A;  2I8T A;  2JVB A;  1VRL A;  1XSC A;  2R5W A;  2PQV A;  3OGA A;  1NQZ A;  4K6E A;  2A8P A;  3GRN A;  2XSQ A;  3EF5 A;  1I9A A;  4J7H A;  3A6U A;  5GHQ A;  4ZG0 A;  4S2W A;  1Q33 A;  3GG6 A;  4S2V A;  5C7T A;  3ZR1 A;  1KHZ A;  3FK9 A;  1PPX A;  1KT9 A;  4J7G A;  2A8T A;  1V8Y A;  3HYQ A;  3X0O A;  1HZT A;  1K2E A;  5I8U A;  1X83 A;  5IW4 A;  2YVP A;  2Q9P A;  3A6S A;  4S2Y A;  4KTB A;  1XSB A;  2B06 A;  1HX3 A;  3X0K A;  5DD4 A;  5C8L A;  2PNY A;  5GHJ A;  1U20 A;  3BHO A;  5FSL A;  3DUP A;  1VIQ A;  1X51 A;  1PPV A;  3F13 A;  1V8T A;  3X0S A;  3MDI A;  5FSN A;  3E57 A;  3MCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...