2KE5A

Solution structure and dynamics of the small gtpase ralb in its active conformation: significance for effector protein binding
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
174
structure length
174
Chain Sequence
LALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGLEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of the small GTPase RalB in its active conformation: significance for effector protein binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related protein Ral-B
total genus 33
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ke5A00
1JAIA 1XPOA 2W6IA 1KO8A 5EUMA 3QPWA 5F9FA 4EPTA 1CKEA 4FWIB 3QF7A 1ZIPA 2W2VA 5C4GB 2ZRJA 1VPLA 2ZTSA 4NCJA 3QXHA 2ZEJA 5BN4A 1GUAA 4TLAA 2REOA 4IEIA 4JBYA 1AQYA 1DAEA 3N5CA 1SGWA 2J7PA 1XWIA 2GAOA 1PUIA 2I1QA 1EK0A 3TR5A 2VP0A 2OLJA 1EFUA 2Z5FA 3N2EA 1SVIA 3NH6A 1AN0A 3NTUA 4IXNA 4V0ME 4B75A 2AN9A 2QI9C 4B3DA 4AWXA 2D7CA 3ZS8A 1NSTA 5E95A 1TMKA 1W2HA 5A0FA 1KSFX 4JSTA 1XP8A 4WIAA 3DPUA 4LJ4A 4DLWA 2QL6A 1G7CA 3UKDA 1E79A 4JLKA 3MUFA 3R8FA 4JJZA 2VH5R 4NYMR 1P72A 4HSEA 2F3RA 2NO9A 3LLMA 3OAAA 3GJ7A 2OM2A 1G7TA 4XD7D 4HB2A 2UZ3A 2BOVA 4Q18A 2IYTA 4TYQA 1FUUA 4HEJA 3K0CC 1IN8A 2FF7A 4BFUA 1OV4A 3FKSA 4MYHA 2PZFA 2YYZA 4Z1MD 2WICA 4I99A 3GLHB 4R9UC 1NG1A 4RD3A 4BLTA 1XEXA 4C7OA 4DC9A 5FH9A 2B7BA 1CJKC 1NBME 2OHFA 1ZYUA 2A5JA 3KXKA 4KSBA 1I2MA 4GRAA 4NZYA 5EXTA 2O8BB 1PZNA 5EP2A 5FOVA 5CJ2A 2Q3MA 2OFXA 3E70C 1X6VA 1KI9A 1MT0A 4FN5A 4YDSA 4G5OA 3GP8A 3GLHA 1AQUA 4OQNA 4D0LB 1Z0AA 2FZ4A 3ECCA 1M74A 5J4LA 1G8FA 2XNDD 5KDLA 1BMFD 2EVWX 1ZM9A 3W6OA 2H5EA 1QHXA 2IYLD 2OBLA 4TMZA 3FHTA 2C98A 5EXXA 1G3UA 5G3YA 3QG5A 3U6KA 1FZQA 3OFNA 4FMBB 1ZD8A 2F43B 1NKTA 3TVTA 3VR2A 1ESNA 4P0TA 1G8YA 4D6PA 2HXYA 5GJBA 4B3GA 4V02A 3TNFA 4PPGA 4Q00A 3SU8A 2IK8A 5FPKA 3QKSB 2RGNC 1TEXA 4B71A 3ZGXA 3ZD7A 2WWFA 4X8MA 1E2GA 1RKBA 2FFHA 3QEJA 5KO2A 1JR3A 2GK6A 4ZI3A 2WJJA 1EXMA 1PV4A 4BPBA 2ZVPX 1XMVA 3N70A 2N42A 4D4MA 3K0CA 1N6LA 1QHNA 1UBFA 3BB3A 1E9BA 1KI3A 4JL8A 1XDBA 3BJIC 2O8EB 1OIXA 2QSYA 3BE4A 4M8NE 1E9DA 3RAPR 2ZRCA 1D2EA 2AWNA 1S96A 4M4SA 3GMTA 4GOJA 4TQAA 3Q3JB 2XOKA 2BEJA 1J90A 2IT1A 1U8AA 4UXIA 4JVLA 1J70A 2VO1A 3PCRB 5A4JA 1R5NA 2F1HA 1XD8A 3IO5A 3R7WB 3PJRA 4TYYA 1KDTA 3QVVA 2WWYA 1KDRA 5EE9A 5KYKA 2XOKD 2FNAA 1E98A 1ETUA 4H9GA 2BJVA 1NSFA 1T6NA 1A7JA 3ONWA 1W4CA 4M1MA 1N0UA 3PITA 3I4LA 1GL9B 2R6CA 4HAUA 1P61B 3T5GA 4EQ6A 4G1UC 5KSZA 4DCNA 4WZAE 4HAYA 3VR5A 1OB5A 4MRNA 2H92A 1B0UA 2AX4A 2ZI9A 4XIGS 1G5PA 2EQBA 3ADKA 3IBYA 4EFNA 2H17A 2D62A 3U6BA 3UWOA 2PEZA 4K81B 3KKMA 3QXCA 2QBYA 3LBIA 3AVXA 1MRNA 2AD1A 4OJKA 3X2SA 4BZXA 3RSLA 3K09A 1BKDR 2QRNA 3BORA 2JA1A 3IIKA 3W9YA 1UBGA 3ZZUA 1G18A 4RZ2A 4WVFA 2JLQA 1US8B 5CYPA 1COWD 1T0JB 2IS6A 2Q9BA 4W5WA 3W90A 4AKHA 1P73A 2VHCA 3IQWA 1II9A 2GKSA 4QJ5A 1XTJA 3CRQA 5DI9A 2WMNB 2ZRBA 4G5GA 2VPPA 1WA5A 3FHOA 1V5WA 2C04A 5FPSA 3M1IA 4DDVA 3T1QA 2GVDC 1Z0IA 3LXXA 1OH7A 3RDPA 4HAWA 1H8HA 1UAAA 3R8CA 2E9SA 4KYUA 3I72A 4LJ9A 3NC1C 1NN3A 4B6FA 3LNCA 3QKRA 2IWHA 3KTAB 3P32A 4V0KA 3KFXA 4L9WA 4MKIA 1AGRA 1NKSA 3P4XA 4LDJA 5KSOA 3CX7A 1KSHA 3EX7C 1E9AA 1U0LA 4MQBA 3DO6A 2QTVB 3B9PA 1NBMD 4OQLA 3FMIA 3CH5A 3GJ5A 4C3ZA 2MMGA 4NYMQ 5IF9A 2P65A 2WIAA 1E0SA 1JJVA 2ZANA 1CXZA 2XX3A 4A92A 2FSHA 1W46A 1N0WA 3LDAA 5EE1A 2P6NA 1L8QA 1UPTA 4BFVA 3AQ4A 721PA 1CU1A 3QQ5A 3AEZA 1RJ9A 3NBZC 5M04A 5JI2E 4R71A 3KFVA 1OLOA 4CEIA 2EYQA 2ZU0C 3KXIA 1DEKA 5C18A 5JCPA 4GP7A 1OIWA 2OLKA 5DLQC 1VYVA 4UNSA 5E4FA 4YQFA 5LD2B 2GZAA 1ZM4A 2B8WA 3U44B 2HXSA 2G9NA 3B78A 4CEIB 1Z0FA 4L16A 2ODWA 4Q9LA 4E03A 2CLCX 2JEOA 2CHVA 4B43A 1UJ2A 3B60A 3Q5DA 2J0UB 2HLDA 3GLGB 1FUKA 2QGZA 5BXQC 4ZDWA 1CJVC 5TXGA 4DCSA 2ZI3A 1Q1BA 3WMGA 1YZNA 3CBQA 3GEEA 3OE7D 4ZDIA 1D2NA 4URUR 3TE6A 4GMDA 4XWKA 2BC9A 3K0EA 4FI3C 4TMVA 5JWRA 1IXZA 4YMTA 1YR6A 2GILA 1KO5A 2ZUDA 2P5TB 3RC3A 2CL7X 3RS7A 3RYTC 3TUJC 2BVNA 4UXJA 5HKKA 4Q21A 3SE0A 1JB1A 1W0JA 3GCGA 1PLLA 3KXLA 3R20A 1HQYE 4HLQB 1L2TA 4I1SA 2WKRA 2ZRGA 4OYHA 2XTZA 2QTHA 1KI7A 1QF9A 2ZI5A 2JLVA 2IS1A 2RGNA 1U0HC 3X1ZA 4I1OA 2BBTA 2QA5A 3LWNA 2N1BA 2VLIA 5FPYA 3WRYC 5JJLA 4HUQB 1GITA 1OYWA 1RE0A 1PJRA 4DCVA 3RRYA 3ADCA 4UQOA 3OE7A 1G8GA 4A0RA 1G8HA 1BH2A 5CM8B 4PHGA 4LBYA 1U94A 2CJWB 2ZYTX 3IPYA 2IYXA 3GPLA 3BH6A 4KI0A 2C78A 3HU1A 2QPOA 4OK5A 5CJPA 4CVNA 5JSZB 4TL6A 2D2FA 4QL3A 3TAHA 4US1R 1XD2B 4AC9A 2JCSA 5KNCA 2J87A 2PMKA 1W44A 4TQUS 1P2UA 1SKYB 4OHYA 4QHSA 4E22A 1Z29A 2EFGA 1ZNYA 3NEYA 4WOPA 3L0SA 3DM5A 5BYKA 3AKYA 4TMKA 4UJ5A 2BWJA 4X8LA 2G1JA 1M2OB 3AF3A 2IA5A 4D26A 3MCAA 3GFOA 4F7WA 1A82A 1XMJA 2ZRMA 2AFHE 2K5UA 2IXFA 2P3SA 3Q7QA 3VKGA 2CXXA 1DAGA 3ZS9A 2AK2A 2GJ9A 3GFTA 1L7VC 2PCLA 5G3ZA 1IJFA 1E1QA 1G19A 1RW4A 3TAUA 4TSFD 1N6PA 4PZLA 4PZZA 3S1AA 4JLBA 3BFVA 4LYFA 4C0AC 4ZDKA 2QM7A 2MMCA 1XZPA 4FMCB 2WJVA 2IWRA 1EFHA 1P9RA 1MV5A 1F48A 3KKOA 2V7QD 4EJSB 1CLUA 1F6BA 4UNRA 4RSGA 1EFCA 2ORWA 1GDDA 1WRBA 5L3QA 2XSZD 1E9RA 1HH4A 1Q21A 4PSVA 1XNJA 3QXJA 3ZYCA 4D4JA 3G0HA 2ZJAA 1CEEA 1J7KA 3L8YA 5D3MA 5AUQA 2GRJA 1NLYA 4TSFA 2ZAOA 3DEFA 3DOEA 2C95A 1RFLA 2XSZA 4IOJA 1UF9A 3KUDA 3I32A 1VKJA 5L3QB 4KO8A 1UEIA 2ZUCA 1XMIA 2QRZA 3JVUA 4HAVA 4B48A 2B6HA 3BIFA 1OHHD 3IQXA 1SVOA 3PQCA 5DHAA 2IEZA 4DCUA 4TLDA 1E2DA 4D4KA 1XTQA 1YE8A 3M4YA 4PC1A 1NIJA 4KFUA 1XZQA 5FTLA 4HLUA 2PMDA 3VHLB 2HF9A 1E0KA 4ARZB 1XRJA 1KJZA 4QRHA 5A5GA 1SXJD 2QQEA 1YZUA 4IXMA 1LTQA 3EIQA 5JRJA 4P4UA 4NCKA 3C15C 5HZKA 1R5BA 4L15A 3FOZA 2ZRDA 2C8VA 2REBA 2O8FA 2TMKA 2CE7A 4ILEA 1DBSA 1IN5A 5EZ6B 1OFUX 3W5IA 4RZXA 4JKIA 5BW8A 3RWOA 4NKRA 1TQ6A 1U90A 1TNDA 1CR2A 2WWIA 4HZUB 5KDOA 1R0ZA 1NJFA 4G5SA 4AKIA 3D7MA 5IK2D 2J46A 2YOFA 1LFDB 3OZXA 4FXPA 4HI0E 3THXA 2XZPA 2O8BA 1WP9A 3CX8A 3DKPA 4QBGB 3RSOA 1CP2A 2OILA 4URWR 3RRNA 4DSUA 4M1WA 2NOAA 4KFSA 4JYBA 2VYFA 3T34A 2IF2A 4EAQA 2C9CA 1NP6A 2QNRA 1E32A 3OIYA 3G82C 4FW9A 2IYUA 1GM5A 4M9QA 4Q4JA 2LCFA 4BLPA 1KI8A 1H8EA 1NN5A 2F9MA 4KVGA 4OI0A 2JJ1D 2EFDB 3VU9B 3D3QA 3U3MA 4TYWA 2HEIA 3W5JA 1X1SA 5L3VA 3MFYA 4F4IA 1J99A 4NPHA 4Z8XA 2GXSA 1D5CA 1AA9A 1JXMA 4TTRA 3L82B 4JLMA 4ACBA 2GHIA 3MJRA 2FPMA 2C9OA 2XITA 1MH1A 3EZFA 2OAQ1 3THYB 5EP3A 3L8ZA 3DKVA 1DAFA 2Q9AA 5GJCA 3UMFA 1WB9A 2JAQA 3MWJA 1LS6A 1FNNA 4MRVA 1E3MA 3H2YA 3AGQA 3W6PA 4DWJA 1Z3IX 2SHKA 2YWGA 4OQXA 4URZR 2HUPA 5FL7A 1H8ED 2OAP1 2J7KA 2EWWA 2WPDA 3QPUA 2YOHA 3CF2A 1G291 4A9AA 1E1RD 3OESA 4NHOA 3RRZA 4CT5A 2A78A 2ZREA 4M53A 4TMWA 4TTPA 3HP1A 5KPJA 1KI4A 4I1UA 3U3KA 5JS7A 4KBFA 3U7EB 1ZC4A 3BAFA 3VTKA 1CRPA 4YMUA 4B47A 1IQPA 3ZZ0A 1FMJA 4PHHA 2IEYA 4XD7A 4W9MC 4BLSA 4BFZA 3CW2A 3I8SA 3CUEF 2PLRA 4RD1A 4OBEA 3I73A 4YXWD 4EJSC 1TF7A 4LZZA 2ZAMA 4HZIA 4PANA 5DO9A 1F2UB 4U00A 4PAOA 3NBYC 1VIYA 4V0LA 4QNMA 1ZIOA 2R6AA 5FR1A 4NL4H 4AI6A 3KQKA 1YVDA 4F4JA 4JLVA 4XWAA 2W83A 2PJZA 4JLNA 2D4HA 1GP2A 3B1WA 4NTZA 3TSOA 5F2EA 5AR1A 4FCWA 4C7OB 4DVGA 1XEXB 1G20E 2JDID 1F2UA 4ARZA 1E6CA 3G5UA 1RPZA 1NMYA 5EE5B 1F2TA 2PCJA 1Z6XA 1Z47A 1M6NA 1TUIA 4X8HA 1XFAA 5CB8A 4A8JA 3IGFA 3HWSA 1U2RA 1JBKA 2XJ4A 3QKRB 5KU1A 3OIUA 2WBLC 4ZIRA 1JECA 1NVWQ 1CULC 3RHFA 3ZH9B 1P3JA 2W0SA 2XTMA 3Q85A 2FV8A 2CJWA 4B3CA 2QZ4A 1ZM2A 5CK4A 3CR8A 2CE2X 5DISB 4QJ4A 3Q5EA 3P1JA 2QE7A 2GXAA 1E79D 1Z63A 1GL6A 3TVDA 4TQ9A 2BMDA 1IONA 1LVGA 3RWMB 3BOSA 3WNBA 2CNWD 3KJIA 1QVAA 2AK3A 2ZRKA 5JHGB 3QF4B 1Z6AA 1KI6A 3WXMA 1W5SA 2QE7D 1JALA 3D8BA 1VECA 2G83A 1U9IC 3MRSA 4DKXA 1ESMA 4FCVA 2FWRA 3FKSD 3VU9A 2H57A 1Q22A 3GLFE 2H8KA 5AUNB 1I4TD 1WXQA 1E1RA 4K8OA 2FOLA 4KVAA 2ZS8A 3ICEA 5EZ5A 2J0VA 4GT1A 1IY2A 2W6JD 3PUVA 4JLJA 4EQ6B 4M1SA 3CH4B 4O0MA 3A1TA 4LBVA 1RRGA 5AJWA 1E2EA 3BGWA 3U3RA 3W8NA 4RCYA 2BMEA 4AKGA 4RZUA 2ERYA 2OCAA 3BH7A 4D80A 2ZUBA 4PQYA 1AIPA 4PQRA 1RRFA 4F38A 4CDGA 3ND8A 4TLEA 2FSGA 5KSYA 3ND9A 5LPNA 2W2XA 5JHHB 4JBXA 2YZ2A 2JJ2A 2ZJ5A 4LK2A 4QJ3A 1F60A 2ATXA 5AJXA 5JBQA 2YINC 1XD2A 1UKVY 2C5LA 2PEYA 1OFIA 2NZJA 2WWGA 3AKEA 2IYZA 2C77A 2R62A 1G16A 1OKKA 2P6UA 3L2OB 4RD0A 2GZDA 1Z0JA 5FL7D 4DLZA 4B33A 5J47A 4LX0A 4PAMA 4A2PA 2VBCA 2WWHA 3B7GA 4PSAA 2H7VA 4BFWA 4HDCA 2CDNA 3IPXA 4QFMA 3ZDQA 3UPUA 3R9XA 2V8OA 1G3RA 1P4SA 2FMXA 3FGNA 4MH0R 5AK0A 3W3ZB 4AKEA 3A37A 1II8B 2ORIA 1GWNA 1HE8B 1YZQA 1S0UA 4O3MA 2YHSA 3HJNA 2GVZC 5FTMA 2DWQA 1JQJC 3SEAA 3FTQA 1NVUQ 3LO5A 3U44A 4UNNA 4EDHA 4BRWA 1YHNA 1N6NA 4A82A 5D3QA 4BLOA 4M0LA 3U3OA 4BGDA 1ELOA 4WZ6A 3C7KA 4DDTA 4JSYA 4R2IA 1KY2A 1ZM7A 2JLXA 3SZRA 3QY0A 2DFLA 2RCNA 4QBHA 5DH9A 1X8LA 1MR3F 2DHRA 2QPTA 1IOZA 1BMFA 4OJQA 1DO0A 2E87A 2HDNB 1HT2E 5F98A 1XTKA 4DB2A 3AUXA 4L9SA 3X1XA 5K8TA 4KXFB 4RCZA 2GESA 3UANA 4PSKA 4D25A 2NO6A 3AVUA 1IN4A 3ETLA 3SI7A 2O0JA 3CWZA 5EUQB 2GAAA 4Q7KA 3ZVRA 2CCGA 2NMVA 4MGYR 1XEWX 1KI2A 5CB6A 1XJCA 2QBYB 1N6HA 1W4AA 4EPYA 5KHOC 1S4QA 3QNUA 4G0NA 5HZHA 4UKDA 5SZJA 1E94E 2CHGA 4H1VA 3EARA 3KTAA 2DWPA 1QG4A 2QMHA 5IK2A 2R6GA 4CYMA 5FUWA 3A1SA 1A4RA 3QPVA 5FUYA 4Q48A 3WRXC 3CLVA 4XH9B 1UADA 1VIAA 5BYJA 4LHWA 4Q66C 2C2HA 4L8GA 2X77A 4DLUA 1I4LD 3ZIAD 2WVJA 1DELA 2WJYA 4TLCA 2HLDD 3QIAA 3K70D 1FPMA 3EA0A 3LVQE 1SHKA 3EZ6A 3MD0A 4ZKEA 2VP9A 3LAWA 1CRQA 2JASA 3AVTA 2NG1A 3T5DA 1DE0A 5DNYB 1P60A 1HUQA 3ZVMA 1M34E 1S3GA 4IDQA 2WJHA 3VNVA 1G3IA 1XMSA 1A2BA 3RS2A 3AF0A 1NMZA 3PV0A 3LH5A 1LB1B 3TH5A 1EWRA 4W5JA 4GP6A 4XVRA 3SJBA 2P5SA 521PA 2CEAA 2F9LA 1KAGA 1XCPA 5L8VA 3D6TB 5FBQB 3UXMA 1FL9A 1U99A 1FTNA 1UBCA 3PIRA 1E9FA 4LOAA 2OE2A 1XBTA 2C03A 4P4SB 1US8A 2IF0A 1VG0B 2QGNA 5AWFC 1B23P 3K0AA 4QGAA 4CZ2A 2UZIR 1WE2A 3FYHA 3GLFA 4HLCA 4Q1FA 1E0AA 3K0SA 4Q4AA 4BFYA 2ZI6A 2ORVA 1M7HA 1U9IA 1G5RA 3EXAA 5J5CA 4NCNA 5SZHB 3AVVA 3NVAA 2B92A 2ZSEA 1XXHA 2KI5A 3AKCA 1NJGA 4C9BA 1GRNA 3UK6A 4DIDA 2V3CC 4GDFA 5KNDA 5KPDA 2DCUA 3K0FB 1KKLA 1NNEA 4XVQA 5HCNA 5SZIA 1OHHA 3GEIA 2BBOA 4IDNA 4Q7JB 5FTJA 2BCGY 1W49A 1SHZA 4ESHA 3NDBB 2ZETA 4LCBA 3KJHA 4C0QC 4LYAA 1Z83A 2NIPA 4QM6A 4B2LA 4HB3A 3CF6R 3CIOA 3KKPA 2RHDA 4LWZA 4MKFA 1KGDA 5HPYB 2V7QA 1U8YA 2BV3A 4MGKR 4V03A 4XTRA 1JNYA 1VCIA 4IDPA 4B73A 5DYGA 1E1QD 4BEJA 1QVRA 1XF9A 1NY5A 2QTFA 1VG1A 3AUYA 3QOFA 1NG9A 2F6RA 1Y3AA 3F3YA 2GEUA 4LUCA 2Q21A 1NN0A 1U8ZA 2GDJA 2PT7A 2BM0A 4IEEA 4BFTA 4LV6A 1Q1ZA 3QKUA 2OV2A 4W5HA 2C99A 3VR6A 3SBEA 1YR8A 1XJ0A 2MSCB 3ZJYA 3REFA 3AB3A 1G17A 2IUTA 1T3SA 2OXRA 3BWDD 4KBGA 1Z6YA 3JZAA 4Q1BA 5HTKA 3ZVLA 4TZ6A 4XVUA 4O25A 5JRZA 4ZCMA 1Z6TA 1QHIA 1X8JA 3FWYA 3T1VA 2NQ2C 1S9HA 2A5DA 2CCKA 4W7SA 4B34A 3U4QB 4Q9KA 5FUXA 5FUVA 1ZC3A 1D6JA 2OCYC 4M22A 4CIDA 4H1UA 4M9SA 2O5VA 2WKQA 1DADA 4M9XA 1XD9A 3I5YA 4RJLA 2ONKA 1FW6A 5E7MA 3QXSA 3I1FA 2B7CA 3GJ4A 2BBSA 4ESVA 4Q4JB 4EPXA 2P0EA 1IBRA 4RKFA 3IEUA 2QT0A 3B8HA 4RD6A 3SJZA 3I5XA 1G21E 2QEQA 1EG7A 1YZLA 1C4OA 3ADDA 3LRPA 2FFBA 1M1YE 2J3EA 2JJ8A 3U7FB 1R8QA 1KDOA 1UEJA 4CEHA 1XU4A 2VF7A 1T0HB 3AH8A 4ABYA 3C14C 3F5FA 1GRRA 1FX0B 2OG2A 2GEDA 4UNQA 4ZKDA 2ZE5A 2X2EA 2BMFA 2AKYA 2J5XA 1BS1A 4QBIA 3B5JA 4URYR 3H0KA 4RKEA 2QORA 1DO2A 2ZE6A 3TJZA 5JECA 1Q57A 3L43A 3FFBA 3HPQA 1YKSA 1Z5ZA 3SFZA 4MRSA 4F92B 4B2IA 4M2LA 1N5IA 2BEKA 4XWOA 4NYJQ 4GOXA 1G7RA 1RC8A 3EASA 4LC1A 4NBSA 4NYJR 1SULA 3QVUA 5H70A 3MWKA 1Z2CA 1KZGB 2A2ZA 1D8TA 2RMKA 2XEXA 1D2MA 2Z4SA 3C16C 3QF4A 4GNKA 5D3MB 1SQ5A 3WNDA 5KTYA 5TDHA 4D4LA 4DJTA 4BLRA 3C8UA 3KKNA 3GQBA 3THWA 3SOPA 3WHKA 1G1MA 4Q9IA 2H1LA 2ZI7A 4S2EA 3SHFA 5JSZA 1IN6A 1GNQA 1WCV1 1T4GA 3OEHD 1L4YA 1HA3A 1Z28A 3FDIA 3LXRA 1RZ3A 3BH0A 2O8CA 3EPHA 1CJUC 4K46A 1V43A 4PHTA 2JGNA 3B85A 2YC2C 2GF9A 4LJ8A 1BYIA 1XXHE 2ZRLA 4IOKA 3U4QA 2RGCA 4JLDA 4ZIRB 5E3HA 3LVRE 3RANA 1Q12A 1R6BX 2IHYA 5FOWA 4XJXA 1II0A 1VCMA 3VFDA 4C0KA 4DT1B 1DTSA 2REXB 4RZ3A 4URVR 3CWQA 1ZU5A 3IILA 4Z1MA 2HJGA 2V4ZA 2ANBA 4NU0A 2JJ2D 3MGCA 4C2TA 2XNDA 2ZRNA 2HJVA 4WAUA 2ODNA 2RGBA 3AF2A 4OHVA 4EFMA 3GJ0A 2A30A 3BD9A 1NVVQ 3KJEA 3TQCA 2X19A 5CM9C 2G1KA 2JLWA 4C0BA 3FMOB 1SVMA 4C4PA 5EXPA 4LY6A 1KMHB 1OXTA 1H65A 2QY9A 1CIPA 3MWYW 2O8DB 3V4RA 4WA7A 1HQCA 4WW0A 2GZHA 2PJRA 5FPHA 4G3XA 1KOFA 5HE8A 1XB2A 4A15A 2QG6A 3RS5A 1IXRC 3IUYA 3EC1A 4B74A 2Z6VA 4A1FA 3H4MA 2EWVA 4KSCA 1Z22A 2IL1A 1SXJB 2W2TA 4ERNA 4OK6A 3MSXA 1KIMA 3LV8A 3IEVA 2WZQA 4RFSB 3ADBA 1DVRA 2W0MA 4Z8YA 1VHLA 4N1AA 3LBNA 5KDDA 1U0JA 4HATA 3CB4A 1IAQA 2QMOA 1Q1QA 1W0KD 1XXHB 1TL7C 2BKEA 3JVVA 4B32A 3C41J 3VHXA 1MO6A 2BJWA 2VSOA 3KX2A 2OFWA 4V0NA 1DOAA 3VQTA 4A4DA 1XTIA 2FA9A 3A1WA 4MUAA 3H84A 3O47A 1Z0DA 2F1RA 2VEDA 1TPZA 3GLHE 4M21A 2JDIA 3AVWA 4M1TA 3WBJA 1P9WA 2B8TA 1FMLA 2R6DA 5B30A 5F9HA 1Q1EA 1QHHB 1ZNWA 2JLSA 1T3HA 3D31A 3BS4A 4IJMA 8OHMA 2BDTA 1E2KA 2EFHB 4Q03A 4KU4A 5FR2A 4PTLA 1QHGA 4QOSA 3EWAA 4G01B 4MYUA 3ZZTA 4C0SA 1E0JA 4C0JA 2IYSA 1MO3A 1TF5A 1UM8A 2QUZA 1LS1A 1Z07A 1ZU4A 2RGGA 1E2PA 4MYCA 2XZLA 2I4IA 1YR9A 2YJTD 3GD7A 1JR6A 4LI0A 1P7CA 5G41A 1TX4B 3EW9A 4DEYA 5L3SA 4WXPA 1C9KA 4BFXA 2NZ8A 2WHXA 1P2SA 3LY5A 3L0IB 1ZCAA 3RLFA 1CR4A 1C1YA 1G64A 2CNWA 4KITB 3K70B 4LPKA 1HE1C 2ONJA 3PFIA 1FNMA 2GWHA 5B64A 4UXHA 3T61A 1GKIA 5EP4A 1N6RA 2FFQA 2FE4A 1PLJA 2CL6X 1P2TA 3PUYA 1AS3A 4DDWA 2D7DA 1P75A 1YZTA 3PG5A 2J0QA 5DN6D 2QMEA 2F1JA 4IHQA 4BZPA 2ZITA 4HB4A 2V6IA 2P6RA 4GZLA 4QGHA 3QUSA 4ZI2A 1TUEA 1E9SA 1TEVA 4PXAA 4TL7A 1NL3A 3V00A 2W6JA 3LQRA 3A8TA 4TWZA 5H1YA 3ICQB 1AGPA 2AXPA 4IOLA 3ZQJA 4HLDA 1KK1A 2FEOA 2H18A 5K8IA 1P9NA 1KNXA 4A2WA 1OH6A 4IRUB 3V9PA 3HPRA 5DGXA 2A9KA 2FGKA 1ZUIA 4DB4A 4NCIA 1SVWA 2AFIE 2R2AA 4DT1A 4JMPA 1S1MA 2DB3A 5FI1B 2YWEA 1DG1G 1IHUA 2XJ9A 5GVRA 1Q44A 4LJYA 2JIZA 3TIFA 2ZVQX 4F93B 5JJIA 2ZYWX 1IN7A 5DYIA 3SYKA 1CR0A 1LNZA 2QM8A 3CR7A 4YDHB 1WBBA 2OESA 4TT3A 3P27A 5L3RA 1JAHA 2ZRFA 4YC7A 5BWMA 4AIIA 3CRRA 4KCGA 4A6XA 1R0YA 1KMQA 2GJKA 2DR3A 2ZRIA 1G4UR 1R10A 4P4TA 3TW8B 3VKHA 4ASUD 5AJZA 3DMNA 3EAQA 3BK7A 1X3SA 4Q4LA 4PC2A 1UKYA 4AYWA 1DAIA 1M7GA 3IDQA 2ZS7A 2F7SA 1S3SA 2ZE7A 3KL4A 3KZ1E 1TTTA 5LDDC 3H86A 4OI1A 2IYWA 1P2VA 4LPSA 1OIVA 4LC0A 4XOIA 2X8AA 1E96A 1MO5A 1GNPA 3TRFA 1R2QA 4KV9A 4IDOA 4XSHA 4Q4HA 5TVKA 1K6MA 3BERA 1KK0A 1NVVR 3EZ7A 3ZD6A 2Z43A 1PUJA 2FFAA 4HLUC 4WBSA 2DFNA 1IY1A 2KWIA 1UFQA 1EFRA 3I61A 4ZCIA 3KB1A 2CL0X 3PVSA 2ZM5A 2A3RA 2BKUA 2O52A 1ZINA 3FMPB 3KDSE 4EIWA 2RKOA 3E2IA 4JT4A 1QZXA 2HYIC 4Q9HA 1G9XA 2FN4A 4A6PA 5JEDA 2RGDA 3B13B 3MLEA 3X1YA 4AK9A 4HZUA 2R9VA 4Q9JA 2DY1A 1MOZA 2J1LA 3U5ZB 4S35A 5FTKA 5BN5A 1YU9A 2WMOB 4BASA 1TF2A 4DDUA 1MRSA 2NPIA 4JYCA 3BC1A 3A4LA 4MKGA 2KSQA 1OKKD 4QNRA 2GBLC 4B3BA 4F4CA 2R8RA 4RD4A 2ZXUA 3RNLA 3OEEA 4GPTA 4MUBA 5B57C 3M0EA 1P5ZB 3EA5A 4MGIR 4Q7MB 5C4MA 2J0SA 2FDCA 3PXGA 5KOYA 2VP2A 3KJGA 1NLFA 4IDHA 1U98A 2ZR0A 3GLFB 4LHZA 1HURA 1QBKC 3GJ6A 1OF1A 3O8RA 3GJ8A 4I81A 4I1VA 2IXEA 2RGXA 3AV0B 3VX3A 2DPXA 3CNLA 3H1TA 4HUQA 2OUKA 2ZYVX 4HYYA 3WYFA 3ZIAA 4QC2A 4L4UA 2ZRPA 1VDZA 1W48A 3IO3A 3NEJA 2QAJA 1J2JA 1N5LA 2OEPA 1GIAA 3LA6A 3W6NA 2LKDA 2W58A 4TMXA 3RS4A 4E07A 2IX3A 4KHZA 4NH0A 2JIZD 3QE0A 3PEYA 1KI6B 3OEHA 2ZS9A 1GNRA 1ZAKA 4U5XA 3O8DA 4JL5A 4DHEA 2VIIA 3KQLA 4TT3D 2OCPA 3CRMA 3LX5A 2QP3A 3BFXA 5KSPA 5AJVB 2X2FA 3CZPA 4C0LA 1ZD9A 3EG5A 4PC6A 2F55A 2J0UA 3UWKA 4LRWA 2NO7A 5JWHA 4DEXA 5CDFE 3SBDA 2UKDA 5CIWA 2PZGA 4M9ZA 4MKHA 2G77B 1EGAA 2GF0A 3AKDA 4E09A 1KZ7B 4M1KA 1FX0A 4OKSA 1S1CA 3GLGA 1R0XA 2HT1A 1Q3TA 3OIVA 5EQTA 2GJAA 1NLZA 2QAGA 2ZR9A 1G5TA 5AJYA 1AK2A 2CBZA 2J41A 3BBPA 3CKLA 4TMTA 4NDZA 2EFEB 5DI3A 2D06A 3KB2A 5UKDA 4BWYA 2ZJBA 1AM4D 1FQKA 1GOTA 1TQ4A 1ZUNB 2IYQA 2W00A 3P4YA 3P26A 4FIDA 4QGFA 1SKQA 4KFTA 1X86B 4L5BA 1JI0A 2ZJYA 5DHFA 1ODFA 2R65A 3T35A 5LB4A 3SC3A 4B2PA 4DLTA 1W7AA 3B1YA 4Q01A 4IW3B 2F1IA 4URXR 3CONA 4DSNA 1CJMA 3S1AB 4JBWA 4EUNA 1FOEB 1ZCBA 3HDTA 1CJTC 3QKTA 3VMFA 1F3OA 5J40A 3K9HA 2ZYUX 3GJXC 4PPFA 4AY2A 4YONB 1E2HA 4LJ6A 2VHTA 3AVQA 1VG8A 2LKCA 2CK3A 3FPAA 1K5GA 121PA 1CR1A 1X1RA 4JVNA 4HDOB 2AKAB 3W3AA 2IS2A 2J45A 3BFKA 2GNOA 1IY0A 4QXAA 2VP6A 2QROA 3WP1B 4B44A 3KKQA 2NPFA 4Q5IA 5LD2C 1GILA 2WTUA 3LBHA 3A58B 1KDPA 4EKDA 5L3SB 2VF8A 3EC2A 2KBEA 3THWB 2HF8A 1E9CA 2ZI4A 2ZSAA 3RABA 4LV5B 1OB2A 4YMVA 2RB4A 2QT1A 1ONBA 2F3TA 1LF5A 2OBNA 3DM9B 3TSZA 6Q21A 2D74A 2Z0MA 4AG6A 4U7DA 5HR5A 3EPKA 3HYRA 2QP4A 1HYQA 1TU4A 1VG9B 2PZEA 4JLOA 4RFVA 4A2QA 4BRUA 1W36D 4DLSA 4Q02A 2VSFA 5CK5A 4GL2A 3DL0A 2DFTA 1FTSA 1GFIA 3W34A 5HKKD 1OSNA 1YQTA 2XB2A 4I4LA 4YMSA 4JJKA 1G41A 4TL9A 2OXCA 4LGMA 1TU3A 2QPAA 4PHFA 4XSGA 1MABB 2PL3A 1JR3E 5C2JB 4OQFA 1CTQA 3SJAA 2ZU6A 2GTPA 4CEJB 2DBYA 5CLLA 1Q3HA 4Q19A 1HT1E 2IC5A 3B2EA 2ZJOA 1LW7A 2ZSDA 4DIEA 2AD5A 4R2HA 1QG2A 1MABA 1UDXA 3I3SR 3PUZA 3DMDA 4D0GA 1N2CE 4OHZA 1BIFA 2ERXA 5FOUA 1AS2A 4KLZA 2GA8A 4DBLC 1G3MA 4B3XA 1EWQA 4DRZA 1W2GA 3TUIC 4FCTA 4ZO4A 3ZLJA 1E2FA 3GFPA 2KJQA 4G5RA 1VYUA 5FPTA 1NY6A 5C1BA 2ZJ8A 2FG5A 2O8DA 2IYVA 2JATA 1RRCA 2O0KA 4X8OA 3A6PC 1N6OA 2ZRAA 3AVPA 5SZKB 5B2ZA 3TW4A 1AZSC 4LYHA 5E7IA 2PT5A 3SS8A 1HTWA 3MG9A 1M8PA 3NBFA 4PC3A 2R6FA 4BE7B 5FBLB 4EFLA 1F5NA 1KK2A 1NBMA 3A4MA 2WJIA 3T06B 5ELXA 1AKYA 4IKEA 3WYAA 1E4VA 3PEWA 3QI2A 1A2KC 2OO7A 2LWIA 3IBGA 4AYTA 4DLYA 1ZM3A 1K5DA 1T8UA 2RHMA 5CLQA 5JFGA 2QP9X 5EE0A 4NE2A 2FSIA 4GFDA 4QG7A 2CMKA 3QG1A 2PX0A 2V54A 2F43A 5JJKA 2L0XA 4QGGA 2ANCA 2PLFA 4YXWA 3RS0A 2V1XA 4MITA 3SHWA 3I8XA 1OFHA 3QBTA 3SYNA 1LV7A 1VYTA 1OH8A 5FL3A 4JIMA 1JJ7A 1W36C 3RC8A 3UG6A 1GSIA 3CZQA 2ZRHA 5FBWB 2IHBA 4DUGA 2G88A 3REGA 5JEEA 3LFUA 2VHQA 3PUWA 3CRVA 3CRW1 1N5JA 2RGEA 5LBIA 2P67A 5TY0A 5DI3B 2CVFA 3K09C 1SVKA 5DSZA 2WOOA 1CF4A 3FHCB 3K1JA 4II7A 4P31A 2IYYA 4LV8B 5BN3A 4C2UA 3U7HB 2WAXA 5IHPA 4YMWA 1E4YA 1ZMXA 5EXSA 3KQHA 2J9RA 3ZQ6A 3LW8A 2HCJB 1DAHA 1EFRD 2CCJA 4FMDF 3NHBA 4JVSB 3HR7A 4LHVA 1KK3A 1T5LA 1FFHA 2KB0A 3L0OA 4KLNA 5TMPA 2MSDB 3SR0A 2CLDX 4UJ3A 1E9EA 1RYFA 3AF1A 1A5TA 1NRJB 1KO1A 4PC7A 4KODA 5GJVC 1E2MA 3HR8A 3MAAC 3UMRA 4F91B 4LJAA 1Z8FA 2PX3A 1RIFA 2ECKA 1YZGA 1ZNZA 3DHWC 2FX3A 3ASZA 3QENA 2FJUA 2VL7A 1NVXQ 1XX6A 2IW3A 2I1VB 3DOFA 4MGZR 1OXVA 1XJQA 1I4DD 4IFBA 4LHXA 3UG7A 2NO1A 4IVQA 4A36A 3B6EA 3I62A 3B1ZA 4Q47A 2QENA 1KHTA 3FFAA 3P20A 3SN6A 4ZPXA 4P4SA 1SXJE 3LX8A 5J4YA 2KBFA 2VHJA 1MKYA 1T3LA 4QM7A 4NYIR 3U7GA 1TQDA 5G40A 4NYIQ 5DE3A 3O8CA 3AP3A 3A1UA 5F3WB 1JR3D 2EYUA 1KY3A 3T12A 4LBWA 4O2RA 2ZJ2A 2QSZA 5AUOB 1Z0KA 221PA 2EFCB 2Q0HA 2GCNA 3OAAD 4KFRA 1WF3A 4MDFA 3EPLA 3T1OA 1EESA 3K9LA 2GK7A 4DXAA 2JJ1A 1EX6A 1KO7A 1Q20A 5JMTA 1A1VA 2BM1A 1ZW6A 1COWA 5FTNA 3QEOA 3DZ8A 4IVRA 2FPLA 2VHUA 1SVSA 1WBDA 3T15A 3VR3A 5JS8A 1S9DA 1YJ5A 3THXB 1DAKA 1R5OA 2ZROA 1JEEA 3ASYA 3EZ9A 3MWLA 2HV8A 4AYXA 5FFMA 3SDZA 1OYYA 3FMFA 2EW1A 1UDWA 2YVUA 3RVBA 5B58C 1LF0A 3IHLA 4J0QA 3EPJA 1FP7A 1OXUA 2ODEA 5EE3A 1X8KA 2A7QA 3W8RA 3VAAA 2WM9B 4WXRA 1OT3A 1VHTA 1W1WA 2G3YA 4QHYA 4DLRA 3QBVA 2ATVA 3TUZC 2RAPA 4LJ7A 2J7PD 4HB0A 1RRPA 2ZE8A 4XTCS 1DAMA 4JZKA 2ZIAA 2BMJA 4JLAA 5CIQA 1QHYA 3IHWA 1NN1A 1J8YF 2FSFA 3K0FA 5JI3E 1QRAA 4OHWA 5BQ5A 3HU3A 2QQ0A 1OXXK 2MSEB 1N6IA 2HCBA 1I2DA 4PO9A 1DARA 3WYGA 4U02A 1SZPA 1GKYA 1ANKA 4R7ZA 1R8SA 2XTNA 4PZYA 3BRWD 1QDEA 1D9XA 1RJ9B 4PR0A 3TBKA 1NMXA 3TKLA 1AKEA 5IDVA 1N6KA 3A1VA 1UKZA 3B1VA 2RH5A 4Q1CA 1IXSB 3QKSA 2QN6A 4PFSA 2YC4C 2NGRA 2QMUA 1ZRHA 3R9IA 4JLPA 4P3YA 2Q3FA 3TR0A 2IS4A 5GADl 2ZR7A 2NO0A 3X1DA 4OI2A 2AXNA 5H68A 4GMXA 4D2IA 1H8HD 3EIHA 2WSMA 5FOSA 5G53C 2GJSA 3CM0A 3QJYA 4ASUA 3ZVNA 3PR1A 3R9WA 3FVQA 4RY2A 3CNNA 5EP1A 3CO5A 2C9YA 2RGAA 4UNPA 4GBMA 2IUUA 3THOA 5K8LA 2QAGB 3PUXA 4P32A 4R98A 2XXAB 3VR1A 4Y0VA 4A0FA 5H8WA 1WQ1R 2YNMA 1O3YA 3SYLA 2DWOA 1ZVQA 5KUTA 2WSSA 2B21A 4A0GA 2VSXA 3E1SA 4IVPA 4HUTA 3AP1A 1S2MA 2GETA 2Z4RA 2XXAA 2Q3HA 4M1YA 2KE5A 4TL8A 2JLUA 3Q7PA 5CITA 3E5HA 4ITRC 3N2IA 2OFOA 2OCBA 1R7RA 1Q0UA 3AF4A 4OK3A 1NF3A 2ZSFA 4KYIB 3BB4A 1FQJA 5FBRB 1ZNXA 2G0TA 2GJ8A 3UMSA 4QHTA 5GVSA 3TGPA 2W6ID 4NMMA 3IIJA 4KJZA 1P62B 1GKUB 1VMAA 1Y63A 3KQUA 1EX7A 1KYIA 2WSSD 4GOKA 1M7BA 1E2QA 4ACAA 3EWSA 1GTVA 2ODBA 1W47A 2UVQA 1WDTA 3OEED 3V4FA 1QHSA 3LW7A 1E2JA 3NHAA 1VCOA 2JLYA 2VRWA 4AD8A 3GLIB 1VTKA 5DIFA 3GEHA 5P21A 5C46F 4MRRA 4FINA 2OSBA 4Q1EA 4TN1A 1ZBDA 3NXSA 1E69A 3WBKA 5JCZA 3A36A 1EFTA 2PBRA 3VR4A 4C30A 3WHLA 3WMEA 2G6BA 3WMFA 1JPNA 1JPJA 5FOXA 4DCTA 1YRAA 2YWHA 3AVOA 3F0TA 4A8JB 4AG5A 1XCMA 3WP0A 2VA8A 2O8EA 4QBFA 3LQQA 5IT5A 1II8A 1KAOA 1GL7A 1YR7A 2AL7A 3IKJA 2IBMA 4YLGA 2BBWA 1E2NA 3L0PA 4DLVA 4FWTA 3DDCA 4TYNA 3OHMA 1AJEA 3I92A 1KJWA 4Z54A 2BIFA 1G4AE 1R4AA 3LD9A 5K8UA 3SFVA 3GJ3A 4B35A 4DUGD 1UKEA 5JWOA 4B3FX 3QSYA 1IJEA 5TB5A 1W36B 1G6OA 1W5TA 2YOGA 1SVLA 4GI7A 3K9GA 3O8BA 2GCOA 3MMPA 1HY3A 2GCOB 3C5HA 3UIEA 2WKPA 3VKWA 1OPXA 3SQXA 3TLXA 3VX4A 4QKQA 1XEWY 4WZBE 1NI3A 1E2IA 2FU5C 3C5CA 4BUJA 621PA 1HV8A 4PO8A 4V0MA 2FGJA 4MRPA 3AM1A 2O8FB 1CBUA 1KSGA 1U81A 1DPFA 2Z83A 3A4NA 3NKVA 3RRMA 3LLUA 4V0OA 2ZSBA 3X1WA 3CPJB 4EPVA 4FMCF 5JLJA 2BHRA 2J59A 1L4UA 1O87A 1TQ2A 1YZKA 1KI1A 2A5FA 2H16A 2Y8EA 4DSOA 3U60B 4MYTA 3FE2A 1Z06A 3FB4A 4Q4HB 3B82A 3RS3A 1ZUHA 4BFSA 2VQSA 3K0AB 3NIBA 2JLRA 2O8CB 3CPHA 1KO4A 2IUSA 1RVDA 3Q9LA 4JT2A 1WMSA 4Q4AB 3WNCA 4N0DA 4CT4B 3SJCA 1KSJA 1R0WA 1DS6A 1T8TA 1T5IA 1FP6A 1JQLB 5HE9A 2WWXA 4Q1DA 4Z51A 1OE0A 1W4BA 2CLSA 2XGJA 4Q1AA 1AS0A 1T91A 4DZZA 4LYJA 3KUCA 3K70C 1OXSC 2VTKA 3NDPA 1D9ZA 1S8FA 2A5YB 2N46A 4JVMA 3Q8XB 1BO6A 4TYPA 4FD2A 3JZMA 3OIWA 3BB1A 3NG1A 2V6JA 3GLGE 1SXJC 4IOMA 4EJSA 4O2LA 1P6XA 2XNSA 4NP6A 4D81A 2YWFA 3QXXA 1T9HA 3Q72A 4LHYA 3TSWA 3EZ2A 2YV5A 2A5GA 1G6HA 4ON9A 5TARA 3U3JA 3SQWA 4CGZA 421PA 2FZLA 4N3NA 4Y0AA 4B76A 3GLIE 2WV9A 2AHOA 2V55B 2C96A 3T1TA 1HEIA 2XB4A 3K8YA 1N25A 1UBEA 1ZP6A 1BOFA 1GG2A 3WY9A 4MA4A 1CS4C 1K8RA 1LY1A 2X1VA 5J4KA 4OL0A 1RYHA 4P33A 4LJ5A 5CYOA 3NBXX 2VP4A 3FKQA 4TZ0A 1J8MF 5JZVA 1Z2AA 2I3BA 4OHXA 1XPRA 3OF5A 2DYKA 5FBVB 1E99A 1PLKA 4US0R 4HAZA 5IRCD 3NC0C 4JS0A 4EPRA 5TV2A 2ZQ5A 2CHQA 4CW7A 1G7SA 5KNBA 3NH9A 3CNOA 1OFTA 4MDEA 4ZDJA 4DLXA 1N3BA 1IM2A 1W0JD 4RFSA 4LSGA 3K9NA 1JXOA 4C0HA 4HDQB 2WJGA 2QU8A 3CPEA 1JEDA 2WAYA 4GZMA 1OH5A 3SNHA 1PVOA 1ZJ6A 3K53A 4OQMA 2AWOA 3NWJA 1N0VC 2FH5B 2GXQA 4AURA 1GRQA 3VNUA 3MJHA 1YRBA 2CK3D 2D2EA 2DFKB 4CF7A 4KAXA 4HAXA 2WPDD 5ANRB 4GSYA 4Q7LA 4D82A 5AUPB 4TLBA 5LB2A 5FOTA 1ZD1A 1SKYE 3R7WA 1QHHA 3AP2A 4CEJA 3HU2A 2O0HA 2ASEA 4POAA 5E7JA 1E2LA 2CVHA 1AZTA 2D3WA 4NONA 1BYUA 1GVNB 2Q9CA 2G0NA 3U2QA 2IYRA 3AGPA 2GEVA 1G3QA 3J81k 1KTVA 4FMDB 1OJLA 3IIMA 3TK1A 2AR7A 2EU8A 1TADA 2WWWA 5J4HA 1GZSA 3M6AA 3PENA 4A8JC 1XPUA 1VCNA 2V9PA 3CF0A 4PPNA 4PPQA 4B6EA 2YKGA 5HCIA 2E1RA 2Q6TA 2GBLA 3C4JA 2JLZA 3OFND 4PO1A 4ZCLA 1G8PA 1KJYA 4RD2A 3CX6A 1Z08A 3B1XA 1XCGB 1NIPA 1W4RA 2QAGC 4BECA 2V1UA 5EJEA 3THYA 3AVYA 2ZPTX 5CDFA 4DSTA 4EPWA 2IXGA 4JL6A 2OBMA 1XTSA 3BXZA 4LBZA 5FI0B 2PH1A 3PEVA 4PQFA 5GJWC 2XZOA 1Z6GA 1KMHA 1OW3B 1F2TB 2BCJQ 2XAUA 3B9QA 3GLIA 4BQSA 2P2LA 2GCPA 4RVCA 1SXJA 3TMKA 4BLQA 1XEFA 2GXUA 4M1OA 4E5UA 1DG3A 2WOJA 4JKYA 1TAGA 2FEMA 3HYTA 2HT6A 1XTRA 2OT3B 4OI4A 3PEUA 4CRWB 2NTYC 1MO4A 2WIBA 4N0EA 2R44A 4NCHA 1GAJA 1W0KA 1KKMA 4A0HA 3DVLA 3U61B 2VP5A 3EIEA 4US2R 1N5KA 5DN6A 2ZJZA 4ZV4A 3F8TA 4IFEA 4BZQA 3KQNA 3UATA 4G5QA 3TQFA 4PX9A 4PAQA 821PA 4CEHB 5J4VA 4BEBA 4TTQA 1KNQA 4D0NA 2FPKA 3DZDA 2HYDA 2OZEA
chains in the Genus database with same CATH superfamily
1NXSA 3PQ2A 4KK4A 4F72A 3BJZA 3LVBA 1TM2A 4JASB 3DE1X 1JA1A 4FS3A 2FPOA 4RKQA 5FO1A 1QFMA 5TR9A 3E2MA 3TSCA 5ICGA 5F9FA 1CKEA 4WJKB 1U7DA 3LYLA 3RIYA 3AJEA 5BSMA 1DTWB 1XK6A 4P84A 3UGJA 3AFGA 3THXA 2Z9BA 3MQ2A 4NCJA 3RAEC 3M2PA 4MKXA 16PKA 5BN4A 4CM6A 4J1NA 1GUAA 2CV0A 2HNKA 1RM3A 2REOA 4JBYA 2VDQB 1AQYA 1T15A 3HR4A 2E4ZA 1SGWA 3ED1A 3L84A 3PR3A 4UBOA 1LLFA 4CN8A 2CWWA 4U6QA 3UJBA 4HAOA 1UPBA 1DTWA 5G0UA 1TZJA 1WP4A 1AN0A 3NTUA 4HMQA 4D3SA 2Q1YA 4O4HA 5EKSA 3HSKA 4I08A 2Q5IA 2J6CA 3FJ1A 2A57A 4MB6A 5U4QA 3ZZMA 4B3DA 4EHNA 5E95A 2XYQA 3OT4A 5EWJA 1L5NA 2R97A 3IPLA 4ENSA 4IIHA 1KSFX 4KACA 3VTZA 1XP8A 4O4JB 4LJ4A 3KPYA 4BFCA 1G7CA 2Y1KA 3RJZA 4EO9A 1OGIA 1SBIA 3ZDZB 2VFAA 3S1SA 4PYLA 3K2BA 4B2YA 2CJPA 1VMIA 1N4DA 1I6WA 3K8ZA 1H0RA 2B25A 2D3TA 2NZUG 2VYVD 4PR3A 4YUXA 3GGCA 1Z6ZA 5E3IA 3W2HA 3RWBA 1QC5B 1P1JA 3M9XA 4BKPA 4YMHA 3CXRA 4D6XA 1ZA2A 2QW8A 4JZYA 4ND8B 3TLJA 1BMDA 1IN8A 1URPA 2FYTA 3CX3A 5DWQA 3F6BX 3P0JA 2BDEA 3WLQA 2YYZA 2IELA 4G36A 1HL3A 4N8EA 4NRDA 1SHLA 4JI5B 3JS5A 4MQ5A 4BLTA 4X3PA 9GPBA 3EIXA 4C3VA 4C7OA 5AVWA 3I6IA 4FR5A 4KSBA 2OHFA 3EGXA 4CLOA 3E0QA 1WB4A 2O8BB 1A7KA 3PHJA 4G9GA 3FTNA 4GRAA 4HVAA 5EYPA 1R16A 2PVCA 2Q3MA 1FDOA 1MT0A 3WK6A 3GP8A 3QVGB 2ZWVA 5AFSA 4GKBA 2VK8A 1FDWA 2P78A 1Z0AA 4E08A 3HLYA 1YUNA 1WZUA 3OQOA 1OXKB 1IIBA 4G0QA 4HH0A 3GG2A 3T9DA 3TQTA 1EUCA 2OV6A 2XCUA 4G9BA 2ODTX 2KHZA 4MHOA 3UK1A 2H5EA 1EAMA 2OBLA 2GRAA 5EUBA 3GRCA 2GN0A 1EUYA 1H2HA 1LJUA 2MU1A 3LDHA 5EXXA 3TOCA 4A2CA 3K6RA 1O94C 5COBA 3V48A 3U6KA 5IM4A 4HFMA 5A7FA 4Y1RA 3IP9A 5DOZA 2EL7A 1Z13A 4Y0NA 3WWDA 1ESNA 1JJAA 2BKVA 3CCFA 4X1OA 1G8YA 1CETA 2IITA 4I9HA 3S5UA 3TBFA 1IEWA 4D6PA 1ZISA 5GJBA 1T24A 4WXYB 2P2NA 4Q24A 1CUDA 1LH0A 3IT1A 4ODIA 5C5DA 3TTTA 3SU8A 3L0DA 4DMGA 3E3NA 3RIGA 1U0EA 4I55F 1G21B 2DJ5A 1QH8B 2NVBA 2WWFA 3I9JA 5KO2A 2O0LA 2Q2WA 2GK6A 4GYWA 1PV4A 2GM4A 2FK7A 2N42A 4FU0A 4HNAB 4D4MA 3RUIA 5DTEA 2AJTA 4P3OA 8GPBA 4QYIB 4A0SA 3PDHA 5I45A 3G7UA 4RA6A 5K0GA 3WA7A 1E7SA 2YQZA 2P35A 3GPDG 5ENDA 4O02B 2O8EB 3ANTA 1E3JA 1S96A 2AWNA 3AIMA 3MLAA 4G0ZA 2VWGA 3KRTA 4M4SA 4TQAA 2AQHA 3Q3JB 3IFSA 3QNMA 3OI7A 2IT1A 3HFGA 1GPYA 3NKLA 3GGDA 2IE0A 3C6YA 3CTMA 3FPJA 4KGDA 4MVJD 4EUKA 4AN4A 5A4JA 1XTPA 1DRUA 2FQQA 3UMJA 2IDZA 3IO5A 4KXYA 3GGGA 3PJRA 1F20A 3QHAA 4BVGA 1Y37A 5EE9A 1A27A 1UP6A 3DMYA 3V80A 1B3BA 1O58A 2XOKD 5KYKA 1AX9A 3O3CA 5E9QA 2A4KA 3E4DA 5B6JA 3DVRX 4HNGA 2WM8A 5H80A 4H9GA 4DJDC 5LNK1 3MJEA 1N92A 3EEQA 3JARB 4QBIA 4GOND 1NSFA 4KQJA 1A7JA 3ESDA 3FYTA 4W6QA 1N0UA 3F1KA 3C6MA 4H7KA 1GL9B 2R6CA 4HAUA 3OCCA 4HHEA 4KXXA 3OU7A 4R05A 4G1UC 1HZZC 2QJFA 3VO2A 3ZWPA 4DCNA 1JIIA 1GUZA 4MWCA 5DPMA 5LQKA 4HAYA 1OB5A 2ZI9A 4U39A 4UAUA 1G5PA 1Z37A 3N75A 4I8XA 4LJSA 1T6BY 4Z0PA 3UW1A 1EVZA 4RV4A 1ABFA 3LUJA 1RWVA 5LLTA 2BMVA 3K35A 4IPTA 3U6BA 1HK7A 3PGLA 4JR0A 1KOGA 3EVTA 4DSAA 1DEAA 2JFOA 1J22A 4UTOA 1MRNA 4DANA 2AC4A 2COUA 5HJEA 4WFQA 1GTRA 4BZXA 1BKDR 3MIIA 5AK3A 1IMJA 1RWQA 3K30A 3RJ5A 3QA9A 3IOYA 2BH2A 1PJ2A 2NU7B 1JYSA 4B4WA 4WVFA 5EMMA 2JLQA 4MW1A 5CYPA 5JMOA 4RQTA 2VTDA 4YAKA 5C80A 3W90A 1AGYA 1HNNA 1RHRA 4AKHA 1P73A 3O8OA 5DLDA 5FKJA 3ROTA 1II9A 1NXXA 2H2HA 2Q6KA 2W8BB 2X0KA 2DFDA 3PTAA 2GKSA 2OXEA 2BW0A 4QJ5A 2PGOA 2P75A 3WDSA 4PQGA 3P9CA 5JD6A 1MRZA 4YRBA 2EOAA 4NAUA 3DKKA 1TM3E 1VE7A 1UDBA 1SUCA 5CA1A 3ABSB 4P0QB 1WA5A 2WYVA 2C04A 3DTTA 2HWXA 4DDVA 4GC9A 3GFGA 3T1QA 3TD6A 2GVDC 5TQ0A 1V6SA 2H0AA 3C7CB 3LXXA 4EI7A 3RDPA 2Y3IA 3D8UA 1RI1A 2DC1A 3N74A 4RXTA 3R8CA 4N3GA 5A6SA 3QEAZ 4LJ9A 5F2NA 4FP9A 3UV7A 3QKRA 3ZGZA 3DP9A 4H3SA 4YRKA 3P32A 3S7ZA 4MVJF 2EF0A 3HCFA 4L9WA 1C3OB 3GYGA 1YB6A 2BEWB 1U4NA 3O7WA 5KSOA 3CX7A 1E9AA 1TRKA 4OD0A 1J6UA 1I2ZA 3ZW9A 4QLBA 4FEGA 4OQLA 2WTNA 3CH5A 4DIKA 4NCXA 2X2OA 3MTEA 3IOBA 1PUXA 2NT3A 3VZDA 1PT6A 5AVZA 5IF9A 4D9EA 1JJVA 1EU1A 4RGVA 3E7XA 3L7DA 7GPBA 1X9GA 1N0WA 1R9MA 2PUAA 5EE1A 2FP4A 2GZ2A 3M9LA 2W8ZA 5EKXA 3EXHC 4I50F 2NYRA 4UOQA 3M1LA 4GPBA 1N8TA 4BFVA 1ORDA 4ZU6X 4IJQA 721PA 1CU1A 4KI7A 4DR5B 2FVYA 2GFQA 1Z36A 4ZC8A 1BAPA 3GYBA 2IEBA 2OWDA 4OHRA 3EAGA 3IUJA 4LJLA 4BQFA 4OKNA 3U19A 2EYQA 2G82A 3OLYA 2IIBA 3GELA 4AJLA 5B2FA 2QTCA 3NEPX 4MGEA 3CUTA 4GU5A 4ENQA 3G9QA 5JCPA 5G1PA 4X7MA 1IWPB 1VYVA 2O2XA 5D7BA 4PYRA 1QH1B 3AR7A 3DT6A 3SHQA 3U4AA 2GZAA 4NABA 1I5OA 1T2UA 1T2NA 3FFWA 4G37A 3QTLA 1DJNA 3B3JA 4L16A 4YHBA 4F0JA 2RH4A 2MJLA 4JI2B 2CLCX 1GV0A 2P30A 3LUAA 3QYAA 3VGJA 1JWAB 3Q5DA 4EYOA 5HVNA 1CRWG 5K9ZA 1LK7A 4YMIA 2J0UB 3HM2A 3GLGB 5BXQC 1WLYA 3C39A 1U1FA 1Q19A 4QTTB 5EGNA 4E6PA 3KEGA 1Q1BA 1UJ5A 3DV2A 3GEEA 4ZOQI 1MB2A 2UUPA 3H6KA 3PQ8A 4JN6B 3AL0C 3EBOA 4IX9A 4URUR 2JAHA 2VXCA 1Z88A 2BC9A 1R0RE 1XZAA 2BHSA 4GMDA 3WSTA 1C0EA 4EX6A 2JFHA 5KTKA 4YMTA 3WSVA 3UK0A 2GAIA 4KL8S 3UH0A 2X6RA 1Q3KA 1ZMTA 2VDLB 4RE6A 3RS7A 5HKKA 2LP4Y 2FUKA 4MJ7A 3SE0A 3GCGA 1W0JA 3IMKA 4QPCA 1JKXA 3U0VA 3KYIB 2I3GA 2JI7A 4OYHA 5CHEA 2ZRGA 3RG2A 3WRXA 2XTZA 1RD4A 4J3FA 5KOJB 2QTHA 1FDTA 1KI7A 1L8OA 2ZI5A 3HKCA 3LSTA 2IS1A 4Z0NA 1Q0PA 2BR5A 3N0RA 1IVSA 1EWVA 4TXHA 4R2JA 2IXBA 5AXAA 4DDKA 3OZVA 5FPYA 3IMEA 4EHJA 5A04A 1HDRA 1GITA 1QGED 1RE0A 1XV5A 2Y99A 4IDDA 1RQRA 3R23A 4NF2A 5TGTA 3ADCA 1AHHA 1J39A 4OV6B 1JW9B 1TYEB 4A0RA 1NW4A 4L50A 2G71A 3X2FA 3IPYA 4EA9A 2IYXA 1A76A 1U04A 2N9UA 3HU1A 4OK5A 5EEGA 4MVJI 1QQTA 4G2NA 5JSZB 4POOA 4ID9A 4QL3A 1X14A 2AF4C 2EFYA 3F3MA 1XD2B 4BVLA 4GI5A 4RGYA 3EW7A 1U3DA 1OI7A 1CY7A 1YCDA 1Z39A 4J29A 3PE4A 3S2SA 3VPGA 4EY5A 3DO8A 3RH0A 4XIJA 2NXJA 4WEQA 1CUYA 4QQKA 1OUMA 4F2PA 1KP2A 3KSDO 4OGFA 1G8MA 3NFYA 2QRHA 1QIEA 3OPNA 3A4IA 3EGEA 4GWKA 4MZXA 2BWJA 1NR5A 4UEWA 4UJ5A 4X8LA 3C8HA 1WXFA 3D6UA 3MQFA 3PDCA 3GDOA 4CHGA 5MGNA 1E6MA 4I5DA 4G0VA 5CB0A 4PV7A 4KREA 4W7HA 1RHUA 2ZRMA 1XMJA 1VPEA 1OZFA 4F3CA 3Q7QA 2IXFA 2P3SA 2Q3EA 3VKGA 4LE2A 5CFNA 4MXDA 3ZS9A 2AK2A 3GRFA 3O21A 2NV0A 4EDFA 5IHXA 1L7VC 1U0OC 1XVIA 4FQ5A 1E1QA 3R0IA 4OXRA 1HMYA 4HL6A 4PZZA 4D0RA 2CN1A 1JIVA 4J03A 5HGJA 4LYFA 3TWOA 2UXDB 2XUPA 2FOXA 3D2CA 2E18A 1XZPA 1JL3A 5DF1A 1D2RA 2DPMA 4C21A 1ZIDA 4L74A 2OZVA 4CM7A 2WVAA 2JA2A 2EAUA 2WDZA 5DX8A 1ZN7A 3LU1A 2VOEA 1L5SA 1LK0A 5HS4A 1CY8A 3GA7A 4RH3A 3RVOA 1L3IA 1BX3A 1F6BA 2Y9PB 1IOVA 1YXMA 5DVZA 4CNQA 3R5TA 3U40A 2ORWA 2ZJ1A 5JY1A 1MAAA 4I36A 2O23A 4J16C 4ND1A 2A1IA 1B8NA 4PSVA 5DM0A 1XNJA 3ZYCA 1Q7BA 2XHEA 2RE8A 3G0HA 1FX1A 1H1LA 3GWZA 2FWMX 2O3QA 3DOIA 1DFIA 2GRJA 1X7WB 4TSFA 2XQJA 3DEFA 3RAJA 1JDTA 4C4TA 3WLJA 1MHPA 1UF9A 3JRXA 5CYGA 3DZJA 5ALXA 4RHFA 4XGNA 5A4AA 5L3QB 2ONCA 4B48A 2ZUVA 1P0FA 1V9CA 2PRYA 4GH5A 4X44A 4UZEA 5TX7A 3CG4A 1PNVA 4TLDA 1V3VA 1R88A 1HDZA 1GN9A 1GCUA 1OBOA 3MPUA 4FZ3A 3Q3GE 4KIUA 4XIYA 5CVCA 4YWHA 4BMNA 2QZ9A 2NU7A 4HLUA 4UHCA 2PMDA 1A8PA 1RIIA 2HF9A 2GX6A 4DE5A 2QPLA 5JYBA 1M54A 4QRHA 1Z4QA 4GR5A 5A1TA 5A5GA 5K3FA 1E20A 1O6GA 5E6SA 3ORHA 1EWKA 1YZUA 3ZCPA 4D9CA 4ENRA 4ZCRA 1LTQA 4AMGA 1Y4SA 2V7EA 1E64A 3FOZA 2O8FA 2ZRDA 2TMKA 3KLMX 4NWIA 3BSWA 2HHJA 1I7LA 4C4YA 4WKGA 1DCTA 3IOMA 9ATCA 3HSYA 3M70A 2D00A 4ETWA 4IQ4A 4NKRA 3E4CA 4K9OA 1R9NA 5HZMA 5K0CA 1RHJA 2XYGA 3V7FA 3TXXA 4P38A 3QVXA 4G5SA 3K4QA 4OH7A 4EHBA 3V32A 1XA3A 4YP5A 2VF2A 5F7JA 5IK2D 5TQ2A 3EFBA 1Y3BE 5FWYB 1LFDB 3OZRA 3X1MA 4QYMA 3WLTA 2WJPA 4EB8A 4JUAA 3IMCA 1Y8ZA 3EEBA 4ZVOA 3DKPA 4IBOA 1DBIA 2XA1A 1FU7A 2OILA 4UBNA 2X8JA 1WHTB 4DSUA 3DZFA 3M6IA 5F2OA 2LR0A 3IXQA 2UZAA 3TZEA 7YASA 1W93A 2C2ZA 1T8YA 1NP6A 2QX4A 1GYQA 4NBKA 1E32A 2QNRA 1ZS9A 3QEKA 4QO7A 3G82C 2O3TA 4EJFA 1K27A 4MUJA 4Q4JA 4F8EA 4FJ0A 5BUCA 4BLPA 1NN5A 1BHSA 5FCDA 1GPWB 1T36B 2J5QA 3U7RA 4EMBA 1Y9EA 2M1ZA 3ES9A 1BE6A 4OMCA 5K8JB 1W19A 3BILA 4OLAA 3I9NA 5L3VA 1J99A 3DW1X 4EG6A 2VK1A 1AA9A 4TTRA 5F64A 5I7HA 1HQKA 5C1DA 5I7UA 4GPAA 3S8MA 2PGDA 3MJRA 2QTAA 4AULA 4C0KA 1MH1A 4CV1A 4YVFA 2OAQ1 3KUUA 4NV1A 3JQ7B 4FFOA 3UJ3X 3OM8A 3DKVA 1DAFA 1CYEA 4TV9A 2CLEB 5ER6A 2GPWA 1PX0A 1QH8A 2JAQA 2WUVA 2DECA 4MRVA 3P0EA 4OSOA 2QLTA 1ZCJA 3NJ4A 4DWJA 1SQGA 4HWRA 3N0VA 4XYLA 4AO7A 4WKBA 4HNAA 1L4EA 1QZUA 4ARUA 5CCXA 3RU7A 3S2EA 4O4JF 2HUPA 3F7MA 2MINA 1H8ED 2B4TO 2OAP1 5CH5A 5J63A 3K72B 3F9CA 1E1RD 3O7MA 1G21A 2FWIA 3UUEA 4QGSA 2A78A 2RAUA 2ZREA 3L18A 4V0NA 2G80A 1ADYA 1P3Y1 2X8WA 1X94A 4LMPA 1KYQA 3IC5A 1ZJZA 4OU4A 4RSMA 5J23A 4I4IA 2XVXA 3UHJA 1KI4A 4I1UA 1Z18A 5JNRA 5JS7A 1JPVA 5K0BA 5D6OA 3BAFA 2WABA 3VTKA 2Q62A 3NRJA 3DKRA 3OBBA 4R8RA 1SBYA 3MS7A 4B47A 1AKWA 5FUBA 2QL5A 2QTZA 2C57A 2YHIA 2OECA 3AEQB 2PLRA 2Z6AA 4OBEA 3I73A 1EGVB 3UJCA 1XYYA 3PC7A 4BNIA 5FJJA 4P93A 2DLNA 2FDXA 4PANA 2PX5A 3LFTA 1PL8A 5DO9A 2QRVA 1F2UB 3GAZA 2ZIVB 3KOWA 4PAOA 1TC1A 3RIMA 2H1FA 1VIYA 3MCWA 5K6AC 5EZYA 2OHGA 4QNMA 1ZIOA 5L7YA 3UWMA 4Q15A 1Q74A 2CXSA 4R3NA 1U6KA 1ZOPA 2GTHA 4ZICA 3IV7A 4Y6LA 1VZ2A 5GINE 3KQKA 1J0BA 1YVDA 3L04A 3EODA 4JLVA 4GGOA 2PJZA 3H87A 2D4HA 3B1WA 3SBXA 3R3WA 2OP1A 4DIMA 2JARA 5IXYA 2UV8A 2JW5A 3FVRA 4U7HA 4DVGA 1QSGA 1XP5A 4C7OB 2HTEA 4MUXA 2JDID 1SWWA 2L82A 1YMUA 2NACA 3DLCA 1JBQA 3OPYB 4KQXA 4ARZA 3G5UA 4CR6A 5EE5B 1M6NA 1N5OX 1TUIA 1NBHA 3FNRA 3JWIA 4X8HA 1XFAA 2SCUA 2NUTA 2C92A 2VRCD 1M0TA 3ZC3A 3IGFA 3KM0A 1JBKA 1DMSA 2QTLA 2B5WA 2V4MA 4LDAA 3A06A 1O8BA 4G0UA 4LGYA 4BQPA 1KKUA 4L08A 2R1ZA 1NVWQ 5CA0B 1HO3A 3F49S 1CULC 3DHNA 2DH6A 3MMNA 4I9NA 5BSTA 2HO4A 3SG0A 1XQVA 2E4AA 4MS4A 2ZJ6A 2AI1A 2ZGVA 3RT1A 4B6QA 4HQNA 3VDQA 2XWSA 3UA3A 5GIOE 1AGNA 1ZM2A 1GSAA 2FMUA 4PW0A 4YB8A 3CR8A 2DTEA 1ULSA 2H00A 4MWBA 4UVHA 1GSHA 4FHEA 2HBQA 1I8TA 1E79D 4N03A 3Q8MA 2IV3A 4B7ZA 3A4YA 5DNCA 1XO1A 2Z5GA 4OP2A 1FS4A 5JHGB 5CJJA 1ZI6A 2O2EA 5IKMA 4Q4CA 4NZNA 1ORRA 1HSOA 1W5SA 1JALA 3DFUA 1VECA 1WLSA 1CF2O 2W2KA 3ESXA 1M5RA 2CNBA 1K6JA 3L49A 2G7MC 4RESA 1ESMA 3IXLA 2FWRA 2ZIWB 4HVTA 2H57A 3PHLA 1F4VA 4JV5B 5AUNB 1WXQA 3LUBA 1O0BA 1VJDA 1E1RA 3ZDDA 4CF6A 5KHAA 4EG7A 3ICEA 1NUUA 3CLKA 2W6JD 3PUVA 4JLJA 3ZEIA 3WQRA 2GN9A 3CH4B 4EQ6B 2VJQA 3BGWA 4Z9YA 3W8NA 4RCYA 2BMEA 2VOJA 4RZUA 2YWJA 2WZBA 4DLKA 4JXXA 3STHA 4KQFA 4ERXA 1AIPA 5B3KA 1WZ2A 4PQRA 1TDJA 1WOYA 2F9FA 4NFYA 4TLEA 4CDGA 1LXCA 3PFBA 2ZKLA 4HAIA 2V7XA 5C9ZA 2AZ4A 4WN9B 4LWQA 5FWXB 3JALB 3FIJA 4H3HB 5JHHB 5ECDA 3VR5D 2QR5A 4DCMA 2FW9A 2QTTA 3DE2X 1C7IA 3U26A 2JJ2A 2IEDA 4DG5A 1VLMA 4QAQA 1S02A 1F0YA 1IEXA 3IURA 4G8CA 5AHWA 5AJXA 1G5HA 5M2QA 5B58C 2PEYA 2NZJA 4MJLA 2ZIUB 2IYZA 3L2OB 4L8LA 3RJMA 1SXIA 1Z5GA 3AXTA 4M8IA 3ZHSA 4BMZA 2A92A 2HEGA 1EQAA 1ULTA 1Y1SA 3O4FA 3LWBA 3OE1A 1UQRA 4DV0B 2BFFA 2YJZA 1AJEA 4B33A 2Z5VA 2DX7A 1HDXA 4LQ4A 4A2PA 2AVNA 1WKVA 3O94A 4X1YB 1XQ1A 4JB3A 4Y2HA 4IMPA 4QFMA 2CDNA 3DVAB 4TRMA 3UPUA 2XYRA 1O5OA 3UBTA 4U3JA 2G63A 1G20B 4O33A 4HCJA 4WFKA 2C5EA 1VJCA 5AK0A 5FD8A 5JXGA 3CSDA 4NEHB 3AUJB 4QDJA 2OK8A 4RK4A 1LRLA 1CUUA 1Q6ZA 1U65A 2R84A 1XZHA 2HZ7A 3DDWA 5TSDA 4AS2A 3ZDRA 1ZGBA 2YHSA 1KAHA 2GVZC 3MSCA 4R1SA 3CVVA 4OIMA 1JQJC 2JL1A 1WS6A 4YRZA 1PFVA 1M83A 1NVUQ 3GOQA 4AXXA 4LCEA 4D0SA 4BRWA 1Y42X 1YHNA 2V74B 4YCAA 4BLOA 4WOCA 4OQEA 3JD2A 4JFRA 3KP1A 3IE1A 3WGMA 1KY2A 2AB0A 3P7MA 4RWZA 4RZSA 3GWGA 2RCNA 3L4SO 4QBHA 2PZAA 4K03A 3SQDA 1JU3A 4OJQA 4RVGA 2E87A 2W4QA 2UYQA 5AW1A 1HT2E 2FRVA 1Q5PA 1XTKA 3LUCA 2W8BA 3AUXA 3J7TA 4HDSA 1XR3A 3ABZA 4QYWA 1JILA 5ALWA 4R2KA 1I1OA 5TT1A 3NS7A 1MA3A 1Z8DA 2P9JA 1XK7A 2GESA 2HPVA 3UANA 1MQ8B 3BDVA 2ZTUA 4PSKA 3H19A 4D25A 1IMOA 4ZVQA 3W06A 1C8VB 3ETLA 3HKBA 3BWBA 2O0JA 3HH8A 3HQ4O 3IHTA 4RVOA 3MINB 5EUQB 3SI7A 5KWVA 5CFPA 4CFZA 4MGYR 4QVKA 1XJCA 3SVZA 1N0IA 5KX5F 4RLFA 2J3JA 3EFOB 1S4QA 4IRXA 1THGA 2Y1LA 4G1MB 4MMZB 3UEOA 2H51A 4IIVA 1XWWA 3LMKA 1E94E 2HA3A 1JFRA 1PBNA 1RLMA 2RAVA 3GJYA 4D74A 2R47A 4J6EA 4U2BA 3FI0A 2WYOA 1QG4A 4U2DA 3VRHA 4FOOA 5FLYA 3W1WA 5CNKA 5L3SB 1UQTA 4Q48A 4BKQA 1ZPDA 3CLVA 3F46A 4G81A 2X8LA 1QO7A 1VIAA 2B4KA 2FUCA 3FFXA 4LHWA 4Q66C 5HF6A 4TZTA 3D5EA 5JS2A 4F7DA 1EIWA 2E55A 4W9NA 1ECBA 5AI5A 1JKMA 4BAGA 4CDRA 1LSUA 5HMLA 2WVJA 4AF6A 4BHTA 1E92A 1TZMA 2JAOA 4MVJA 3EA0A 1VFPA 4EF6A 2ACWA 1GVHA 2UVPB 3E23A 3EZ6A 4U9HS 4UDNA 2NVUB 3WWEA 2VP9A 4AX4A 1ADFA 1O94D 3RVMA 2JASA 2IPLA 2CJFA 3RR2A 3DMGA 2XT6A 1VKHA 2NG1A 4CTMA 1DE0A 2WU0A 2HXGA 1P60A 4E88A 3ZVMA 4OVKA 1EE2A 1M34E 4IDQA 1YKFA 2WJHA 2YY6A 1G3IA 1XMSA 1GAWA 2O8VA 3F5MA 3HKCB 4PGHA 2GPBA 3RS2A 4JNCA 4F9GA 4G4SO 5B12A 2O3JA 3PV0A 3DEHA 3MBIA 4OQ4A 3LBYA 3QVKA 3DMFA 4QOJA 4S1WA 1DMRA 4XVRA 3DTYA 2X5JO 1NXWA 4FN4A 4EHKA 2ZIXA 4PG7A 2NW6A 5TEWA 5AVUA 4F04A 1XCPA 3G2OA 2O20A 4QT0A 3RADC 2J8ZA 2HLHA 3NOXA 3PIRA 5K09A 1E9FA 4LOAA 1XBTA 1ZMRA 3TZHA 4IIFA 5T6BA 5ESWA 1RXYA 2XDYA 5LSAA 1VG0B 4RENA 1B23P 1QOZA 3TLYA 3VHRA 5T7BA 3JQ6A 4CZ2A 2A59A 3K73O 3ZHQA 1YI1A 3GLFA 3BPSA 5DN9A 4HLCA 5C7IO 5I9LA 2XHZA 3G0BA 1C80A 1E0AA 3LQKA 3DLTA 1OX4A 4Q4AA 5ALHA 3REQA 4BFYA 1OYOA 5IMBA 3RYFA 2Y05A 2ORVA 3N5KA 1M7HA 1YVUA 1B0PA 2CXNA 1IPHA 1KDZA 1JKIA 5J5CA 3FUVA 1R6AA 3TZCA 5HIAA 4RXUA 4MLDA 4FB5A 4RTJA 1PJ3A 2KI5A 1TAQA 4ALLA 1RPNA 4QPDA 3UK6A 1CUBA 2OVBA 4DIDA 4GDFA 1MGOA 2JGFA 3HJCA 5HK9A 2DCUA 4M0CA 3G6WA 4XVQA 4EL0A 1FUIA 2C1XA 4OOEA 3ETGA 2ZZMA 2BBOA 4IDNA 4Q7JB 4KR0A 2VHWA 4KDRA 2HK6A 2XH8A 5ED0A 4F5ZA 1W49A 2P9FA 3SEFA 1AXEA 2EX1A 2VCYA 3DL2A 3FMGA 1JLRA 1NPTO 3O1HB 5HGXA 1ESZA 2NIPA 4K3VA 4BLWA 4KR7A 4RMNA 3BMXA 1XZIA 3UT5A 2RFLA 3K8QA 1T3TA 4HB3A 4R16A 1PHRA 1M8JA 1EB9A 3KKPA 4TX1A 2OFFA 4HDNB 1E5DA 4J7CA 1WABA 2WY2D 2VSQA 4XTRA 1CRPA 1Q1AA 3T4PA 4IDPA 4BBAA 1E1QD 3UJ6A 2J33A 4G5FA 4BEJA 4W8HA 4H1WA 3PD0A 1Z26A 3E9RA 1JLLA 3JRWA 5IJZA 2I7VA 2GNPA 3QOFA 2HO5A 3LRTA 3RODA 1F7VA 1Y3AA 2ACKA 3K9FC 2D5CA 2B4QA 2D1YA 3PTLA 1ZBQA 3D4OA 4C07A 1NN0A 1W85A 4IQFA 4MHSA 2PT7A 5F77A 4DM3A 5LN1A 2E3JA 1P4RA 2BM0A 3ITKA 4IEEA 4JIGA 4LZWA 1KFBB 1Q1ZA 4REMA 4GKKB 1EGHA 4L7QA 3SBEA 5CVTA 1XJ0A 1XJ5A 4EGAA 4M98A 3AB3A 1G17A 2HA2A 4MQ4A 5E4YA 1WPRA 2V98A 4JK3A 2ZZNA 3RU2A 1WPXA 5TQVA 4JJ4A 3BGDA 4S0ZA 5HTKA 2Z9DA 2W2NA 5JNSA 1QYCA 4NBNA 3IVAA 1E6LA 3WAKA 3ENVA 2C5AA 2P5UA 3WGGA 4CMBA 1P4HA 4FHCA 1T9AA 1EJ0A 2NQ2C 5A6SB 3IHKA 2A5DA 2J6IA 4GLLA 2JI9A 2I6QA 2PUTA 3GVIA 3HRHA 3LWDA 3ME5A 4W7SA 4NNPA 1YS9A 1AXRA 1ZC3A 5HRCA 1D6JA 2GH1A 1G6Q1 1UDRA 2P3LA 1OWOA 2XXJA 4M22A 4ARBA 4CIDA 5YASA 2O5VA 2TMYA 4FGZA 1TVEA 3LJKA 2WKQA 1NJ8A 4L28A 2YCBA 4DZRA 4BO6A 5K0TA 3H2GA 2QSUA 3T3MB 4RGBA 2JFUA 3I1FA 1FLDA 2FPGA 2I62A 4FNMA 4Z4GA 1P6QA 4OLBA 1Z7EA 3DOOA 3ZBPA 4IGAA 1ZVVA 2P0EA 2ZBPA 4IDAA 1DBVO 4RKFA 5GWXA 2H1WA 2XKKA 3SCZA 2B35A 1I3KA 4YPOA 2XLBA 4V38A 1M1YE 1QFZA 3TL2A 3V1KA 4DY6A 3T9FA 2ZQZA 1UKBA 1H5QA 2WT9A 1KBQA 2VF7A 4D96A 1MBZA 2C0QA 4P58A 5JXHA 2V7GA 3C14C 3CKKA 4KH0A 5E6SB 1VJ0A 2EJUA 2QJOA 3N8KA 4U7GA 5I7WA 5KJ6A 1PWYE 2EBFX 2OBBA 5KI6A 2FSUA 4PLZA 4D8YA 4PZ0A 1BCSA 1U28C 1U2SA 4URYR 3H0KA 4F2DA 3S70A 2Z8ZA 4GZ6A 2WTBA 3JQPA 3MC1A 3TJZA 3U3XA 3HPQA 1ECLA 2O2HA 2Q4TA 2G9ZA 2B0JA 1SCAA 2VNIA 3FB1A 4MRSA 4PYJA 1G9SA 5A2GA 5GPBA 4HYTA 1N5IA 1DUVG 1LDBA 1U6JA 4BIIA 2A67A 2DKOA 4UBJA 3JTEA 4D1YA 9LDTA 2N47A 1TK3A 3SC6A 3KU1A 4LC1A 4TRJA 4YX9A 4Q7QA 5JY6A 2O5CA 1P4GA 2VAVA 5H70A 4TRRA 2CFSA 2GLXA 1YT5A 1KZGB 1BXGA 3AF5A 2RMKA 3FNBA 1D2MA 3QF4A 4GNKA 1MV8A 2J6HA 5TDHA 3B5IA 3L1VA 1AQIA 3PQ7A 4FW8A 4F56A 1L5RA 3GQBA 1DT5A 2QUIA 4PBRA 4LE0A 3SOPA 4NY1A 3W6UA 1UPCA 4BMXA 4EW6A 1BEUB 1IN6A 1GNQA 1GFZA 2JFGA 4Z86A 1T4GA 4KMSA 2NUBA 1HA3A 3UJDA 3O92A 4K6FA 2QVYX 2XW6A 4TMFA 5TPZD 4GWLA 2DKFA 1CJUC 5AJTA 5EY5B 4DAOA 1S89A 2ZYHA 3B85A 2AOXA 2FZ5A 3HBJA 4D4IA 3AFOA 2GCGA 2GF9A 2OHOA 4IOKA 1I4EB 2ZRLA 5HJ7A 2EBUA 2RGCA 5K7SA 1V45E 3R6DA 3LQYA 2JS7A 2IHYA 1CVIA 3CF4A 4FHZA 2X4LA 4GGPA 4Y9RA 1J42A 1DTSA 2GR9A 3HDVA 4JT8A 3B70A 4ZA2A 3R7LA 4C20A 2QM3A 4MMXB 3D1VA 2XMBA 3UGTA 1QR2A 2ANBA 4NU0A 2RHOA 2JJ2D 4E7PA 2PU7A 3R3SA 3EVFA 1GCAA 1NURA 2A0YA 3A1EA 2RGBA 1JAYA 3C87A 3VUEA 5A62A 3GJ0A 4YRFA 3BD9A 2WC1A 3OBIA 5ER9A 5IARA 1PCXA 3ZR4B 2X0JA 4DQVA 5AW0A 3UT6A 4L0QA 5CM9C 1XZMA 5KQPA 2JLWA 4C0BA 1K9SA 2QVGA 3VNAA 3ZWBA 1C2YA 1AA6A 3F74A 4JSRA 1KEVA 1YONA 4WW0A 4E32A 2AKEA 4UPVA 4IDBA 2Z2YA 2W2QA 1KOFA 3QU5A 1XB2A 4A15A 1S8NA 5TPWA 10MHA 1IXRC 3IUYA 1MX9A 2VI5A 1TGYA 3BDAA 3DAHA 4MIEA 5FDFA 1SXJB 1FMCA 3C1AA 3U39A 3WJ1A 2PWZA 2LCQA 1X7GA 1I36A 4TUYA 3GLQA 4IWYA 1RJWA 1GJRA 2ENWA 2PSJA 1PS9A 3LKZA 4OATA 3JALA 1LC3A 4ZYTA 3CB4A 3G8BA 4CKXA 1IAQA 1M0EA 5CVVA 4Z0HO 1H1DA 3W5UA 4B32A 5D5PA 3ZIUA 2AN1A 1X8XA 3VHXA 2FLVA 4UM5A 2QT9A 3AZOA 3K4HA 2BJWA 1Y48E 3KX2A 3N8DA 4TS9A 3G79A 1BWPA 1AY0A 2BRUA 1CZLA 2FA9A 2VNSA 3WRVA 4R41A 4MUAA 3H84A 4NJEB 5EHNA 4CM3A 1HLDA 2H0RA 2H1RA 2BFEA 3GLHE 4ER3A 1X1CA 2JDIA 4GIBA 4O4JA 4K88A 4HT3B 1CY1A 1FMLA 4JI1B 1I0ZA 5DYTA 1E5VA 2C9ZA 3FWKA 1JDNA 1F3LA 4K9MA 4L4RA 4QOHA 3WB0A 1C0LA 3ABQB 4S05A 5DZSA 3PNOA 8OHMA 1NA5A 4KU4A 1FVFA 4PTLA 3GAAA 4G01B 1O03A 1A4UA 4ZQEA 3ND5A 3H5NA 1U2PA 2HJHA 2A9QA 3KB6A 3CUSA 3NM5A 1MFZA 1UM8A 3SX2A 1LS1A 2GAFA 2QB5A 3KQOA 5B6IA 3HFRA 4MS4B 4CETA 1O4VA 4MP8A 2XA2A 5DHRA 3JTMA 3IEKA 3GD7A 1JR6A 1NWCA 3VO8A 4CMHA 4KAJA 1FXWF 4QOGA 3V46A 1TX4B 3PVCA 5L3SA 5LP6F 3ETJA 3IP1A 2NVWA 3EGVA 3EUAA 4MVJH 2BISA 4NK4A 4ZJUA 1J9EA 1PP4A 4DA8A 1NLUA 4BBZA 1KYVA 1QH1A 5ECYA 1CR4A 1NQAO 4DMFA 1PQPA 4EATA 1VPWA 1K5PA 3K70B 1M8KA 2H4HA 3TNDA 3PFIA 1ACJA 3B2NA 4DF3A 3Q2KA 4UXHA 2B4AA 5EP4A 1P1IA 3EE6A 3H6HA 1N6RA 1EHYA 4FYVA 5IVIA 3DTVB 3LCVB 3PUYA 4PX3A 5D6NA 1AS3A 3ZZNA 4AJNA 4XKJA 1YZTA 1RPAA 1LDGA 3BD6A 3D4NA 4YH1A 1ZI8A 3F6SA 4JELA 4ZGBA 1Z7GA 1NW5A 3GUHA 2QMEA 2F1JA 4IHQA 3IEMA 2BRUC 1KQFA 4QGHA 4II3A 1TUEA 5F5LA 2XUDA 4LMBA 4C3OB 2AI3A 3PUHA 4FFRA 3NBUA 1TEVA 4NLLA 4R8SA 1NL3A 5T4HA 4AN1A 4XVCA 3A8TA 3ESYA 3OMXA 3ICQB 4CKCB 3BICA 4OEHA 3D64A 3IAUA 3LYHA 5BSUA 3PSHA 3ZN2A 3ZQJA 1SEPA 1B2RA 1KK1A 1W94A 3OWOA 5LOVB 2H18A 2WHPA 1P9NA 3LC0A 3QV1A 4PYMA 1ND6A 3RVRA 2R6R1 5A3JA 4IRUB 3U17A 3HPRA 3HKBB 4CLEA 4YCLA 5ED4A 2UUBB 3T4EA 2A9KA 4XDHA 2FGKA 1PZFA 3HJUA 2J4CA 4DB4A 2XBMA 3H7AA 1SVWA 3S44A 5KS2A 2X9QA 3IE0A 3FETA 3PJEA 1Z4NA 2DB3A 1CRLA 3PDIA 1KQOA 3AJAA 4BNMA 1GZ3A 5GVRA 4I1IA