2KEBA

Nmr solution structure of the n-terminal domain of the dna polymerase alpha p68 subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
MSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELIAFCTSTHKVGLTSEILNSFEHEFLSKRLSKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit alpha B
publication title Structure of a DNA polymerase alpha-primase domain that docks on the SV40 helicase and activates the viral primosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 19
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.530 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kebA00
2KEBA
chains in the Genus database with same CATH superfamily
3TWLA 1GKIA 3KSJA 4I5SA 2K6BA 4JI0M 2R45A 3IHPA 2ZTDA 4IBFA 1SXJC 2LVOC 1QZMA 1SXJD 1E32A 2CHGA 2G8LA 2GQFA 4NC6A 1D0MA 3CGWA 3PVSA 2UUBM 4M0WA 2UUCM 1TDHA 1J7KA 3VLFB 1JQJC 2R0IA 4GKKM 2ZBKB 4DV5M 1TTEA 1NO1A 1VQ1A 3IECA 4DV3M 3SYKA 3LCVB 2CHQA 3U6SA 4LF4M 2ZM6M 1MN3A 4IBGA 2XSZD 4LJAA 3E9SA 3HGIA 1L1ZA 5EXSA 1TH4A 1XXHA 2ZAOA 4RF0A 4Q7JA 3T6PA 1J5EM 2C9CA 3L26A 3I51A 3CF6E 3FRHA 2KZUA 3TL4X 3ZQJA 3MJ5A 4DR4M 5DNYA 2F4VM 4QOSA 5KPZA 2ZAMA 3LVWA 2DHRA 4NSRA 1JB0F 3GLHB 3HJ8A 2OO9A 4LRTA 4Y28F 3H4JA 3VDPA 1Z6TA 2XLJA 1IXRC 1WHCA 1Q3CA 2YR0A 4NRWA 4NL4H 1HT2E 2VF8A 3FYCA 4FD2A 4JN6A 1OTRA 5IREB 3J80S 1UM8A 4LJ5A 3T1HM 1WGLA 2CEAA 3E4RA 3NWLA 1OQYA 2Y0QA 4BB9A 1N32M 1OIZA 2J7NA 3EIHA 4AG5A 3HX3A 4LG2A 4DUZM 4NXMM 3U6CA 4B08A 1ZAEA 4JI3M 4L78A 4KODA 2ERCA 1HT1E 2CV2A 5JI2E 3LQRA 4P16A 2CP8A 3VFDA 4GRIA 5IWAM 2RGOA 1NJGA 3UJNA 3FTFA 3KP1E 1N36M 2XEPA 1XWIA 4GKJM 1G8PA 1WR1B 1YSYA 4G3OA 3Q8GA 4R7GA 3WHLA 1WXQA 1XNRM 4LJ4A 4FCTA 1J09A 1RU3A 4MGZE 1G41A 1HQYE 4DR5M 3U6EA 3HY5A 2O5RA 4D81A 3B7ZA 2E5LM 3LQQA 1R4GA 4B3RM 3GQ3A 5KPRA 2EJSA 2Q2EB 2DHYA 2QSFX 2UXBM 4I8OA 4GHLA 1R7RA 2YQZA 5KQDA 3B7NA 2LHGA 1TR8A 1EE8A 3PNYA 2KA6B 3KOYE 4HL4A 4AG6A 4MM3B 2JY5A 3VKHA 4OW0A 1SXJE 1NNJA 3RFWA 2F5SA 1LTMA 2F5NA 4JXJA 3L25A 2DWMA 1ZMUA 1KSFX 5FTMA 3SYLA 4F2LA 4M9SA 3OTOM 3U6PA 4FWGA 3T1YM 1QZEA 3SFZA 4GITA 1KYIA 1VDLA 4R71A 3W67A 3W0LB 1HNXM 2WZJA 2DNAA 2R4JA 3CTWB 4BLCA 2YNMD 1HNZM 4FWDA 3W68A 3FUVA 3GLFE 4JI2M 1ZMWA 1IXSA 3QAUA 3U61B 2R18A 4IBDA 4FW9A 2I7NA 2L2DA 3GLGA 1IY2A 3ZH9B 3EIEA 1AIPC 2HKJA 3W0FA 2WSFF 3SMSA 2QNJA 4G4OA 4LRSA 2CV1A 1X37A 3HHWA 4G4QA 3U5ZA 2HHHM 2CFOA 1QUTA 2L4FA 2Z7JA 2OOAA 5ITXA 1GABA 2O01F 4GMQA 3HHZA 2QCUA 4M9ZA 1TGUA 1R2ZA 4Z8XA 2LVQD 3B74A 3DA1A 4DV7M 2ZANA 4LF7M 1GJSA 2DAGA 4PT5A 1PJQA 3LW5F 2VQFM 2Y20A 1V34A 3B89A 4QHTA 1QVRA 2V6ZM 1IQPA 4KLNA 4RKUF 4WP2A 1TDZA 5ITRA 3UMMA 3SARA 2C99A 4JV5M 3GQ5A 4RNAA 3GLHA 5IZ7D 2KDLA 3I4VA 5E26A 1Y8GA 1IM2A 5L8RF 3SBJA 4FCVA 2X8AA 2LTUA 5ITUA 4YY3M 5JI3E 3PXGA 3KSXA 3SAUA 3VK8A 1N75A 1PJTA 3HU3A 3MK6A 1D0KA 3GLIA 1I4WA 4L4UA 2Z3XA 2G3QA 2DWNA 1EIJA 1Q39A 3BXWA 1FNNA 3PFIA 3GPPA 5EP2A 3J2PB 4LFAM 3GP1A 3GPXA 4DV6M 2Z8YM 3KFUG 2BNKA 4B3SM 2MH8A 1VEGA 2R4EA 1DO0A 4WURA 3L29A 5EJCA 3HHYA 2LBCA 1ZMVA 2DWZB 4S12A 3D8LA 4F1IA 4JI1M 2EUCA 1SXJB 2XFSA 3M7GA 1R5LA 4GIPA 4X66M 3V76A 3FUWA 1NV8A 2KHHA 5EXXA 2C98A 1JR3D 3J27B 3U60A 2BWEA 1OAIA 1WJ7A 3K92A 8CATA 4OVZB 2Z4RA 1D2NA 2O25A 3E21A 3L28A 3ZCBB 4PDIA 4M9XA 3RGPA 3VDUA 3DOAA 1QQWA 3CF0A 4X62M 4XBOA 4PCZA 4LF6M 4LF8M 3GLFB 2WSCF 7CATA 4IBEA 4IIWA 2LH0A 3A42A 5EP3A 2JUJA 2VQEM 1GLNA 3BOSA 2LXEA 4LGMA 3GPYA 2JWSA 1A5TA 2JZ1A 4QHSA 2J7OA 2EA0A 1MX0A 4LJ9A 3HZJA 2QZ4A 1PM5A 1Q02A 1DGHA 2DAEA 3IG8A 2HCBA 1D0LA 3HKPA 2VIIA 2F5PA 2N35A 3UGJA 4GHAA 2F5OA 4MGHA 4DR1M 5DYGA 5H37D 3NBXX 2OOBA 3SMPA 5KO3A 2DAMA 3U61A 4IBKA 1N34M 4MB7A 3FD9A 1YE9A 3QYEA 4AKHA 3SAWA 4QNRA 2LNHC 3R9XB 2JY8A 4AZFA 3FUUA 2NQ8C 3TE6A 3IG5A 3SATA 3HWSA 2WSEF 2DXIA 3JR4A 1CUKA 5EP4A 1Z59A 4L15A 1XXHB 2JY7A 1AUAA 4FVMA 4B7GA 2CHVA 3HJQA 2Z4SA 2X49A 1FJGM 2UXCM 1QANA 1K82A 1DGGA 2FH0A 2K47A 4XGIA 4L6V6 2K9DA 1F4IA 2JZ0A 3I4YA 2YFQA 1Q3BA 2D7EA 2KXEA 3TQSA 5ITXE 5A2QS 4P17A 1IN5A 5FTJA 1WIVA 2B3TA 2KRKA 3KS4A 5BR8M 2DWLA 4K0KM 1ZQ9A 2MJ5B 4G6ZA 1XB2B 1OKSA 4DBGB 4L16A 4AQYM 2QBYB 2JA2A 4CISA 1VEKA 1IFYA 3DZDA 1NY6A 1WGNA 2I7PA 3J7BA 5E6JA 2FS1A 1DGFA 3JAMS 1W5SA 5EXTA 4GEWA 4B7HA 4ITQA 1NNUC 3AOGA 4Z6YA 1E9RA 1GL7A 2APLA 3FE3A 2M60A 2OQ4A 3UZUA 4UN2B 1IN8A 4NSOB 1JR3E 3T15A 5C18A 4DR3M 1IN6A 1UFZA 1C7YA 3KVWA 3ZC7B 3THGA 2H5XA 3GRRA 4CGYB 1G71A 3RGSA 4G4NA 3SAVA 1HR0M 4JI7M 2DZOB 3L2AA 2FE8A 3FUTA 3LVVA 4MGKE 4JI8M 2RGHA 1GL6A 3HU2A 2Y21A 2MR9A 4KO8A 5FTLA 2DZNB 4HEOA 1ORYB 4EIWA 1V33A 1SXJA 5IT9S 2JP7A 1EFUB 2M5ZA 1NHWC 1BVSA 1OFHA 2EKFA 2H1RA 2P5TA 2QQ8A 4KHPM 3QYBA 2EO2A 2XZFA 3CF2A 3U6LA 1ZV1A 3F92A 4GC5A 2UU9M 2DENA 2LWXA 3A98B 4DV4M 1KFVA 2R65A 1YLAA 2RKOA 1XXHE 3FTEA 2GNOA 4DV0M 1NVMA 1QUSA 2XSZA 2JNHA 3JR5A 1R2YA 2CE7A 4GH9A 5EP1A 2UUAM 4IBIA 4DR2M 1Z5AA 1NV9A 2LVAA 4CIZA 4D82A 2BJWA 3A45A 4L8RC 1IN4A 4JI6M 2OPFA 2A5YB 3AKZA 1L8QA 1V92A 2KNZA 4AI6A 2G5GX 1IXSB 4RF1A 4XK8F 5KQ8A 3ILKA 2UXDM 1YUBA 3SHGB 3GLGB 4NXNM 1Z5CA 1XMOM 4I4LA 3KOXE 2DKLA 2XH9A 4MGYE 2DAIA 2L7HA 1I94M 4CHTB 3HHXA 4B7FA 3A46A 1P3QQ 1E9SA 1VDDA 5LMUM 3U5ZB 2QP9X 2CWBA 3LCUA 3MMPA 4IJEA 4X65M 1DV0A 2KNVA 3GRUA 2BWBA 2R44A 3H4MA 1R6BX 2XGNA 4TUWA 3T38A 4GC9A 1NY5A 4IBCA 1OAOC 3KP0E 5GKNA 3U6DA 3PNVA 1SG9A 2J5YA 4LJ7A 4LGYA 1XMQM 3KOZE 3K9PA 2C5RA 4JI5M 1QAQA 1VEJA 5EQTA 2MGWA 1TH2A 4LY6A 4W5WA 1VG5A 1OFIA 5FTNA 1OIPA 3FKEA 3SHFA 5DFLA 3U6MA 4AW4A 4OX9M 1IY0A 4ANRA 1IBLM 4REZA 1PJSA 4FWHA 3SASA 2XZUA 2QBYA 4LZJA 2Y0TA 3AJIB 4X64M 3L27A 1K3XA 3J7AS 1T43A 1MJGM 1QYRA 4HLQA 1QAMA 3B7QA 3DFZA 1IBKM 3TWKA 2QPAA 4DR7M 3GLIB 1IBMM 3QWLA 1NJFA 1QDTA 4BBAA 4MGIE 2KNAA 4NOOB 4II7A 3WHKA 3GO8A 3C58A 2QHOB 2HWJA 3KS8A 1DGBA 4WW0A 1T3TA 2X4AA 3HU1A 1PRBA 3AFHA 4M0DA 2V1UA 4B3TM 1N33M 4DV1M 3FRIA 3FUXA 4LJ8A 1Z5BA 4A3VB 3AL0C 5C1BA 3GLGE 3FYDA 2CUZA 1NHGC 1QDRA 3B9PA 3HJSA 3KDSE 4FCWA 2VDBB 5ITTA 1XNQM 1HQCA 1OJLA 5EXPA 4R3DA 3SC3A 4DUYM 2LVNC 4JYAM 2HL7A 3VKGA 2BJVA 1TH3A 1XHBA 3U60B 2LHCA 3GPUA 4YHHM 2FOIC 3C3EA 5ITQA 5LMNM 2K0BX 4IBBA 1G59A 2D7GA 4DR6M 3K1JA 1E94E 4KT0F 4ZPXA 4AKGA 2KRUA 3GRVA 2JY6B 3TPZA 2HAKA 4D80A 3K8ZA 3FTDA 4LZZA 3AV0A 5DYIA 5F3WA 1PJJA 1N78A 4G4RA 3MHVC 3I04M 4AKIA 4PDGA 1GO5A 2L4EA 4LCBA 3GQ4A 4NRVA 4MH0E 1L2CA 3BBZA 4LJ6A 4JI4M 2ZTCA 1QAOA 3E46A 3M6AA 1C1KA 1PGYA 4DV2M 3GRYA 2XFTA 2L6OA 1DGHB 2R62A 1L2DA 3C9PA 1IXZA 3GLHE 3Q8XA 4IBJA 3RE8A 1L1TA 3TWMA 2MROB 2DAKA 5ITYA 1K3WA 1L2BA 1T6OA 1NSFA 2FNAA 2AHMA 3AOEA 4PD2A 3FTCA 4LF9M 2VF7A 2LVPC 4B3MM 5FTKA 4LFCM 3KW6A 1S3SA 1GJTA 3KOWE 4IJFA 3GLIE 1DO2A 2CV0A 3K9OA 2RRUA 3J81S 1XC8A 1PJIA 1N77A 1GVNA 2W82A 2R46A 5KPTA 1G3IA 1G4AE 2KZSA 2QENA 3C3DA 1MU5A 1LV7A 1W5TA 3NBIA 3U6QA 3VK7A 4OVZA 3R8FA 5FSWA 2CRUA 2DZLA 4LF5M 2XF3A 1IY1A 2KW0A 2JXNA 4I81A 1H6UA 1IN7A 3U6OA 2V1CA 3GLFA 3D8BA 2F5QA 2C9OA 5BPVA 3UK6A 2EKKA 4LFBM 1HJPA 2FFJA 2C96A 3KXEC 3LMMA 2D7HA 2DI0A 2KEBA 2L7IA 2DVWB 3M0EA 3AOEC 3K2LA 5FLXS 2L09A 4OU7A 3I01M 4QNMA 2R6FA 4QOZC 1TF0B 1HNWM 1JR3A 4CJ6A
chains in the Genus database with same CATH topology
3TWLA 1GKIA 3KSJA 4I5SA 4JI0M 2R45A 4IBFA 1SXJC 1QZMA 1SXJD 1E32A 2CHGA 2G8LA 3PVSA 2UUBM 4M0WA 2UUCM 1TDHA 1J7KA 3VLFB 1JQJC 4GKKM 2ZBKB 4DV5M 4DV3M 3SYKA 2CHQA 3U6SA 4LF4M 2ZM6M 4IBGA 2XSZD 4LJAA 3E9SA 3HGIA 1L1ZA 5EXSA 1TH4A 1XXHA 2ZAOA 4RF0A 1J5EM 2C9CA 3L26A 3I51A 3CF6E 3TL4X 2KZUA 3MJ5A 4DR4M 5DNYA 2F4VM 4QOSA 5KPZA 2ZAMA 3LVWA 2DHRA 4NSRA 3GLHB 3HJ8A 4LRTA 3VDPA 1Z6TA 2XLJA 1IXRC 1Q3CA 2YR0A 4NRWA 4NL4H 1HT2E 4FD2A 3FYCA 4JN6A 5IREB 3J80S 1UM8A 4LJ5A 3T1HM 2CEAA 3E4RA 3NWLA 4BB9A 1N32M 2Y0QA 2J7NA 3EIHA 4AG5A 4LG2A 4DUZM 4NXMM 3U6CA 4B08A 1ZAEA 4JI3M 4L78A 4KODA 2ERCA 1HT1E 5JI2E 3LQRA 4P16A 3VFDA 4GRIA 5IWAM 2RGOA 1NJGA 3UJNA 3FTFA 3KP1E 1N36M 2XEPA 1XWIA 4GKJM 1G8PA 3WHLA 1YSYA 1XNRM 4R7GA 1WXQA 4LJ4A 4FCTA 1J09A 4MGZE 4DR5M 1G41A 1HQYE 3U6EA 2O5RA 4D81A 2E5LM 3LQQA 4B3RM 3GQ3A 5KPRA 2Q2EB 2UXBM 4I8OA 4GHLA 1R7RA 2YQZA 5KQDA 1EE8A 3PNYA 2KA6B 3KOYE 4HL4A 4AG6A 4MM3B 3VKHA 4OW0A 1SXJE 1NNJA 3RFWA 2F5SA 2F5NA 4JXJA 3L25A 2DWMA 1KSFX 5FTMA 3SYLA 3OTOM 4M9SA 3U6PA 4FWGA 3T1YM 3SFZA 4GITA 1KYIA 3W0LB 1HNXM 2R4JA 3CTWB 4BLCA 2YNMD 1HNZM 4FWDA 3FUVA 4JI2M 3QAUA 3U61B 2R18A 4IBDA 4FW9A 2I7NA 3GLGA 1IY2A 3ZH9B 3EIEA 2HKJA 3W0FA 3SMSA 4G4OA 4LRSA 2CV1A 1X37A 3HHWA 4G4QA 3U5ZA 2HHHM 2CFOA 5ITXA 2Z7JA 4GMQA 3HHZA 2QCUA 4M9ZA 1TGUA 1R2ZA 4Z8XA 3DA1A 4LF7M 4DV7M 2ZANA 4PT5A 2VQFM 2Y20A 4QHTA 1QVRA 2V6ZM 1IQPA 4KLNA 1TDZA 5ITRA 3UMMA 3SARA 2C99A 4JV5M 3GQ5A 4RNAA 3GLHA 5IZ7D 3I4VA 5E26A 1IM2A 3SBJA 4FCVA 2X8AA 5ITUA 4YY3M 5JI3E 3PXGA 3KSXA 3SAUA 3VK8A 1N75A 3HU3A 3MK6A 3GLIA 1I4WA 4L4UA 2Z3XA 2DWNA 1Q39A 1FNNA 3PFIA 3GPPA 5EP2A 3J2PB 4LFAM 3GP1A 3GPXA 4DV6M 3KFUG 2BNKA 4B3SM 2R4EA 1DO0A 4WURA 3L29A 5EJCA 3HHYA 2DWZB 4S12A 3D8LA 4JI1M 2EUCA 1SXJB 2XFSA 3M7GA 4GIPA 4X66M 3FUWA 5EXXA 2C98A 1JR3D 3J27B 3U60A 3K92A 8CATA 4OVZB 2Z4RA 1D2NA 4PDIA 3L28A 3ZCBB 4M9XA 3RGPA 3VDUA 3DOAA 1QQWA 3CF0A 4X62M 4XBOA 4PCZA 4LF6M 4LF8M 3GLFB 7CATA 4IBEA 4IIWA 2LH0A 3A42A 5EP3A 2VQEM 1GLNA 3BOSA 2LXEA 4LGMA 3GPYA 4QHSA 2EA0A 2J7OA 1MX0A 4LJ9A 2QZ4A 1PM5A 1DGHA 3IG8A 2HCBA 3HKPA 2VIIA 2F5PA 3UGJA 4GHAA 2F5OA 4MGHA 4DR1M 5DYGA 5H37D 3SMPA 5KO3A 3U61A 4IBKA 1N34M 4MB7A 3FD9A 1YE9A 4AKHA 3SAWA 4QNRA 2LNHC 3R9XB 4AZFA 3FUUA 2NQ8C 3TE6A 3IG5A 3SATA 3HWSA 2DXIA 3JR4A 5EP4A 1Z59A 4L15A 1XXHB 4FVMA 4B7GA 2CHVA 3HJQA 2Z4SA 2X49A 1FJGM 2UXCM 1QANA 1K82A 1DGGA 2K47A 4XGIA 3I4YA 2YFQA 1Q3BA 2D7EA 2KXEA 3TQSA 5ITXE 5A2QS 1IN5A 5FTJA 4K0KM 5BR8M 2KRKA 3KS4A 2DWLA 1ZQ9A 4G6ZA 2QBYB 4AQYM 4L16A 4CISA 2JA2A 3DZDA 1NY6A 3J7BA 2I7PA 5E6JA 1DGFA 3JAMS 1W5SA 5EXTA 4B7HA 4ITQA 1NNUC 3AOGA 4Z6YA 1E9RA 1GL7A 2M60A 2OQ4A 3UZUA 1IN8A 4NSOB 3T15A 5C18A 4DR3M 1IN6A 3KVWA 3ZC7B 3THGA 4G4NA 3GRRA 4CGYB 3RGSA 3SAVA 1HR0M 4JI7M 2DZOB 3L2AA 2FE8A 3FUTA 3LVVA 4MGKE 4JI8M 2RGHA 1GL6A 3HU2A 2Y21A 4KO8A 5FTLA 2DZNB 1ORYB 4EIWA 1SXJA 5IT9S 2M5ZA 1NHWC 2H1RA 1OFHA 2P5TA 4KHPM 2EO2A 2XZFA 3CF2A 3U6LA 4GC5A 2UU9M 3A98B 2LWXA 4DV4M 1KFVA 2R65A 2RKOA 3FTEA 4DV0M 1NVMA 2XSZA 3JR5A 1R2YA 2CE7A 4GH9A 5EP1A 2UUAM 4IBIA 4DR2M 1Z5AA 4D82A 2BJWA 3A45A 4L8RC 1IN4A 4JI6M 2OPFA 2A5YB 3AKZA 1L8QA 4AI6A 2G5GX 1IXSB 4RF1A 5KQ8A 3ILKA 2UXDM 1YUBA 3SHGB 3GLGB 4NXNM 1Z5CA 1XMOM 4I4LA 3KOXE 2XH9A 4MGYE 2L7HA 1I94M 4CHTB 3HHXA 4B7FA 3A46A 5LMUM 1E9SA 1VDDA 3U5ZB 2QP9X 4IJEA 4X65M 3GRUA 3H4MA 1R6BX 2XGNA 4TUWA 3T38A 4GC9A 1NY5A 4IBCA 5GKNA 3KP0E 3U6DA 3PNVA 4LJ7A 4LGYA 1XMQM 3KOZE 2C5RA 4JI5M 1QAQA 5EQTA 1TH2A 4LY6A 4W5WA 1OFIA 5FTNA 3FKEA 3SHFA 3U6MA 4AW4A 4OX9M 1IY0A 1IBLM 4REZA 4FWHA 3SASA 2XZUA 2QBYA 4LZJA 2Y0TA 3AJIB 4X64M 3L27A 1K3XA 3J7AS 4HLQA 1QYRA 1QAMA 3DFZA 1IBKM 3TWKA 2QPAA 4DR7M 3GLIB 1IBMM 3QWLA 1NJFA 4BBAA 4MGIE 4NOOB 4II7A 3WHKA 3GO8A 3C58A 3KS8A 1DGBA 4WW0A 1T3TA 2X4AA 3HU1A 4B3TM 3AFHA 4M0DA 2V1UA 1N33M 4DV1M 3FUXA 4LJ8A 4A3VB 1Z5BA 3AL0C 5C1BA 3FYDA 2CUZA 1NHGC 3HJSA 3B9PA 3KDSE 4FCWA 5ITTA 1XNQM 1HQCA 1OJLA 5EXPA 4R3DA 3SC3A 4DUYM 3VKGA 4JYAM 2HL7A 2BJVA 1TH3A 1XHBA 3U60B 3GPUA 4YHHM 2FOIC 5ITQA 5LMNM 4IBBA 1G59A 2D7GA 4DR6M 3K1JA 1E94E 4ZPXA 4AKGA 2KRUA 3GRVA 3TPZA 1PJJA 4D80A 3K8ZA 3FTDA 4LZZA 3AV0A 5DYIA 5F3WA 1N78A 4G4RA 3MHVC 4AKIA 4PDGA 4LCBA 3GQ4A 4NRVA 4MH0E 1L2CA 4LJ6A 4JI4M 3M6AA 1QAOA 4DV2M 1C1KA 3GRYA 2XFTA 2L6OA 1DGHB 2R62A 1L2DA 1L1TA 1IXZA 3Q8XA 4IBJA 3RE8A 3TWMA 5ITYA 1K3WA 1L2BA 1NSFA 2FNAA 2AHMA 3AOEA 4PD2A 3FTCA 4LF9M 4B3MM 5FTKA 4LFCM 3KW6A 1S3SA 3KOWE 4IJFA 1DO2A 2CV0A 3J81S 1XC8A 1PJIA 1N77A 1GVNA 2W82A 2R46A 5KPTA 1G3IA 1G4AE 2KZSA 2QENA 1MU5A 1LV7A 1W5TA 3NBIA 3U6QA 3VK7A 4OVZA 3R8FA 5FSWA 4LF5M 2XF3A 1IY1A 2KW0A 4I81A 1H6UA 1IN7A 3U6OA 2V1CA 3GLFA 3D8BA 2F5QA 2C9OA 5BPVA 3UK6A 4LFBM 2FFJA 2C96A 3KXEC 3LMMA 2D7HA 2KEBA 2L7IA 2DVWB 3M0EA 3AOEC 3K2LA 5FLXS 2L09A 4OU7A 4QNMA 4QOZC 1HNWM 1JR3A 2CV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEB A; 
#chains in the Genus database with same CATH topology
 3TWL A;  1GKI A;  3KSJ A;  4I5S A;  2K6B A;  4JI0 M;  2R45 A;  3IHP A;  2ZTD A;  4IBF A;  1SXJ C;  2LVO C;  1QZM A;  1SXJ D;  1E32 A;  2CHG A;  2G8L A;  2GQF A;  4NC6 A;  1D0M A;  3CGW A;  3PVS A;  2UUB M;  4M0W A;  2UUC M;  1TDH A;  1J7K A;  3VLF B;  1JQJ C;  2R0I A;  4GKK M;  2ZBK B;  4DV5 M;  1TTE A;  1NO1 A;  1VQ1 A;  3IEC A;  4DV3 M;  3SYK A;  3LCV B;  2CHQ A;  3U6S A;  4LF4 M;  2ZM6 M;  1MN3 A;  4IBG A;  2XSZ D;  4LJA A;  3E9S A;  3HGI A;  1L1Z A;  5EXS A;  1TH4 A;  1XXH A;  2ZAO A;  4RF0 A;  4Q7J A;  3T6P A;  1J5E M;  2C9C A;  3L26 A;  3I51 A;  3CF6 E;  3FRH A;  2KZU A;  3TL4 X;  3ZQJ A;  3MJ5 A;  4DR4 M;  5DNY A;  2F4V M;  4QOS A;  5KPZ A;  2ZAM A;  3LVW A;  2DHR A;  4NSR A;  1JB0 F;  3GLH B;  3HJ8 A;  2OO9 A;  4LRT A;  4Y28 F;  3H4J A;  3VDP A;  1Z6T A;  2XLJ A;  1IXR C;  1WHC A;  1Q3C A;  2YR0 A;  4NRW A;  4NL4 H;  1HT2 E;  2VF8 A;  3FYC A;  4FD2 A;  4JN6 A;  1OTR A;  5IRE B;  3J80 S;  1UM8 A;  4LJ5 A;  3T1H M;  1WGL A;  2CEA A;  3E4R A;  3NWL A;  1OQY A;  2Y0Q A;  4BB9 A;  1N32 M;  1OIZ A;  2J7N A;  3EIH A;  4AG5 A;  3HX3 A;  4LG2 A;  4DUZ M;  4NXM M;  3U6C A;  4B08 A;  1ZAE A;  4JI3 M;  4L78 A;  4KOD A;  2ERC A;  1HT1 E;  2CV2 A;  5JI2 E;  3LQR A;  4P16 A;  2CP8 A;  3VFD A;  4GRI A;  5IWA M;  2RGO A;  1NJG A;  3UJN A;  3FTF A;  3KP1 E;  1N36 M;  2XEP A;  1XWI A;  4GKJ M;  1G8P A;  1WR1 B;  1YSY A;  4G3O A;  3Q8G A;  4R7G A;  3WHL A;  1WXQ A;  1XNR M;  4LJ4 A;  4FCT A;  1J09 A;  1RU3 A;  4MGZ E;  1G41 A;  1HQY E;  4DR5 M;  3U6E A;  3HY5 A;  2O5R A;  4D81 A;  3B7Z A;  2E5L M;  3LQQ A;  1R4G A;  4B3R M;  3GQ3 A;  5KPR A;  2EJS A;  2Q2E B;  2DHY A;  2QSF X;  2UXB M;  4I8O A;  4GHL A;  1R7R A;  2YQZ A;  5KQD A;  3B7N A;  2LHG A;  1TR8 A;  1EE8 A;  3PNY A;  2KA6 B;  3KOY E;  4HL4 A;  4AG6 A;  4MM3 B;  2JY5 A;  3VKH A;  4OW0 A;  1SXJ E;  1NNJ A;  3RFW A;  2F5S A;  1LTM A;  2F5N A;  4JXJ A;  3L25 A;  2DWM A;  1ZMU A;  1KSF X;  5FTM A;  3SYL A;  4F2L A;  4M9S A;  3OTO M;  3U6P A;  4FWG A;  3T1Y M;  1QZE A;  3SFZ A;  4GIT A;  1KYI A;  1VDL A;  4R71 A;  3W67 A;  3W0L B;  1HNX M;  2WZJ A;  2DNA A;  2R4J A;  3CTW B;  4BLC A;  2YNM D;  1HNZ M;  4FWD A;  3W68 A;  3FUV A;  3GLF E;  4JI2 M;  1ZMW A;  1IXS A;  3QAU A;  3U61 B;  2R18 A;  4IBD A;  4FW9 A;  2I7N A;  2L2D A;  3GLG A;  1IY2 A;  3ZH9 B;  3EIE A;  1AIP C;  2HKJ A;  3W0F A;  2WSF F;  3SMS A;  2QNJ A;  4G4O A;  4LRS A;  2CV1 A;  1X37 A;  3HHW A;  4G4Q A;  3U5Z A;  2HHH M;  2CFO A;  1QUT A;  2L4F A;  2Z7J A;  2OOA A;  5ITX A;  1GAB A;  2O01 F;  4GMQ A;  3HHZ A;  2QCU A;  4M9Z A;  1TGU A;  1R2Z A;  4Z8X A;  2LVQ D;  3B74 A;  3DA1 A;  4DV7 M;  2ZAN A;  4LF7 M;  1GJS A;  2DAG A;  4PT5 A;  1PJQ A;  3LW5 F;  2VQF M;  2Y20 A;  1V34 A;  3B89 A;  4QHT A;  1QVR A;  2V6Z M;  1IQP A;  4KLN A;  4RKU F;  4WP2 A;  1TDZ A;  5ITR A;  3UMM A;  3SAR A;  2C99 A;  4JV5 M;  3GQ5 A;  4RNA A;  3GLH A;  5IZ7 D;  2KDL A;  3I4V A;  5E26 A;  1Y8G A;  1IM2 A;  5L8R F;  3SBJ A;  4FCV A;  2X8A A;  2LTU A;  5ITU A;  4YY3 M;  5JI3 E;  3PXG A;  3KSX A;  3SAU A;  3VK8 A;  1N75 A;  1PJT A;  3HU3 A;  3MK6 A;  1D0K A;  3GLI A;  1I4W A;  4L4U A;  2Z3X A;  2G3Q A;  2DWN A;  1EIJ A;  1Q39 A;  3BXW A;  1FNN A;  3PFI A;  3GPP A;  5EP2 A;  3J2P B;  4LFA M;  3GP1 A;  3GPX A;  4DV6 M;  2Z8Y M;  3KFU G;  2BNK A;  4B3S M;  2MH8 A;  1VEG A;  2R4E A;  1DO0 A;  4WUR A;  3L29 A;  5EJC A;  3HHY A;  2LBC A;  1ZMV A;  2DWZ B;  4S12 A;  3D8L A;  4F1I A;  4JI1 M;  2EUC A;  1SXJ B;  2XFS A;  3M7G A;  1R5L A;  4GIP A;  4X66 M;  3V76 A;  3FUW A;  1NV8 A;  2KHH A;  5EXX A;  2C98 A;  1JR3 D;  3J27 B;  3U60 A;  2BWE A;  1OAI A;  1WJ7 A;  3K92 A;  8CAT A;  4OVZ B;  2Z4R A;  1D2N A;  2O25 A;  3E21 A;  3L28 A;  3ZCB B;  4PDI A;  4M9X A;  3RGP A;  3VDU A;  3DOA A;  1QQW A;  3CF0 A;  4X62 M;  4XBO A;  4PCZ A;  4LF6 M;  4LF8 M;  3GLF B;  2WSC F;  7CAT A;  4IBE A;  4IIW A;  2LH0 A;  3A42 A;  5EP3 A;  2JUJ A;  2VQE M;  1GLN A;  3BOS A;  2LXE A;  4LGM A;  3GPY A;  2JWS A;  1A5T A;  2JZ1 A;  4QHS A;  2J7O A;  2EA0 A;  1MX0 A;  4LJ9 A;  3HZJ A;  2QZ4 A;  1PM5 A;  1Q02 A;  1DGH A;  2DAE A;  3IG8 A;  2HCB A;  1D0L A;  3HKP A;  2VII A;  2F5P A;  2N35 A;  3UGJ A;  4GHA A;  2F5O A;  4MGH A;  4DR1 M;  5DYG A;  5H37 D;  3NBX X;  2OOB A;  3SMP A;  5KO3 A;  2DAM A;  3U61 A;  4IBK A;  1N34 M;  4MB7 A;  3FD9 A;  1YE9 A;  3QYE A;  4AKH A;  3SAW A;  4QNR A;  2LNH C;  3R9X B;  2JY8 A;  4AZF A;  3FUU A;  2NQ8 C;  3TE6 A;  3IG5 A;  3SAT A;  3HWS A;  2WSE F;  2DXI A;  3JR4 A;  1CUK A;  5EP4 A;  1Z59 A;  4L15 A;  1XXH B;  2JY7 A;  1AUA A;  4FVM A;  4B7G A;  2CHV A;  3HJQ A;  2Z4S A;  2X49 A;  1FJG M;  2UXC M;  1QAN A;  1K82 A;  1DGG A;  2FH0 A;  2K47 A;  4XGI A;  4L6V 6;  2K9D A;  1F4I A;  2JZ0 A;  3I4Y A;  2YFQ A;  1Q3B A;  2D7E A;  2KXE A;  3TQS A;  5ITX E;  5A2Q S;  4P17 A;  1IN5 A;  5FTJ A;  1WIV A;  2B3T A;  2KRK A;  3KS4 A;  5BR8 M;  2DWL A;  4K0K M;  1ZQ9 A;  2MJ5 B;  4G6Z A;  1XB2 B;  1OKS A;  4DBG B;  4L16 A;  4AQY M;  2QBY B;  2JA2 A;  4CIS A;  1VEK A;  1IFY A;  3DZD A;  1NY6 A;  1WGN A;  2I7P A;  3J7B A;  5E6J A;  2FS1 A;  1DGF A;  3JAM S;  1W5S A;  5EXT A;  4GEW A;  4B7H A;  4ITQ A;  1NNU C;  3AOG A;  4Z6Y A;  1E9R A;  1GL7 A;  2APL A;  3FE3 A;  2M60 A;  2OQ4 A;  3UZU A;  4UN2 B;  1IN8 A;  4NSO B;  1JR3 E;  3T15 A;  5C18 A;  4DR3 M;  1IN6 A;  1UFZ A;  1C7Y A;  3KVW A;  3ZC7 B;  3THG A;  2H5X A;  3GRR A;  4CGY B;  1G71 A;  3RGS A;  4G4N A;  3SAV A;  1HR0 M;  4JI7 M;  2DZO B;  3L2A A;  2FE8 A;  3FUT A;  3LVV A;  4MGK E;  4JI8 M;  2RGH A;  1GL6 A;  3HU2 A;  2Y21 A;  2MR9 A;  4KO8 A;  5FTL A;  2DZN B;  4HEO A;  1ORY B;  4EIW A;  1V33 A;  1SXJ A;  5IT9 S;  2JP7 A;  1EFU B;  2M5Z A;  1NHW C;  1BVS A;  1OFH A;  2EKF A;  2H1R A;  2P5T A;  2QQ8 A;  4KHP M;  3QYB A;  2EO2 A;  2XZF A;  3CF2 A;  3U6L A;  1ZV1 A;  3F92 A;  4GC5 A;  2UU9 M;  2DEN A;  2LWX A;  3A98 B;  4DV4 M;  1KFV A;  2R65 A;  1YLA A;  2RKO A;  1XXH E;  3FTE A;  2GNO A;  4DV0 M;  1NVM A;  1QUS A;  2XSZ A;  2JNH A;  3JR5 A;  1R2Y A;  2CE7 A;  4GH9 A;  5EP1 A;  2UUA M;  4IBI A;  4DR2 M;  1Z5A A;  1NV9 A;  2LVA A;  4CIZ A;  4D82 A;  2BJW A;  3A45 A;  4L8R C;  1IN4 A;  4JI6 M;  2OPF A;  2A5Y B;  3AKZ A;  1L8Q A;  1V92 A;  2KNZ A;  4AI6 A;  2G5G X;  1IXS B;  4RF1 A;  4XK8 F;  5KQ8 A;  3ILK A;  2UXD M;  1YUB A;  3SHG B;  3GLG B;  4NXN M;  1Z5C A;  1XMO M;  4I4L A;  3KOX E;  2DKL A;  2XH9 A;  4MGY E;  2DAI A;  2L7H A;  1I94 M;  4CHT B;  3HHX A;  4B7F A;  3A46 A;  1P3Q Q;  1E9S A;  1VDD A;  5LMU M;  3U5Z B;  2QP9 X;  2CWB A;  3LCU A;  3MMP A;  4IJE A;  4X65 M;  1DV0 A;  2KNV A;  3GRU A;  2BWB A;  2R44 A;  3H4M A;  1R6B X;  2XGN A;  4TUW A;  3T38 A;  4GC9 A;  1NY5 A;  4IBC A;  1OAO C;  3KP0 E;  5GKN A;  3U6D A;  3PNV A;  1SG9 A;  2J5Y A;  4LJ7 A;  4LGY A;  1XMQ M;  3KOZ E;  3K9P A;  2C5R A;  4JI5 M;  1QAQ A;  1VEJ A;  5EQT A;  2MGW A;  1TH2 A;  4LY6 A;  4W5W A;  1VG5 A;  1OFI A;  5FTN A;  1OIP A;  3FKE A;  3SHF A;  5DFL A;  3U6M A;  4AW4 A;  4OX9 M;  1IY0 A;  4ANR A;  1IBL M;  4REZ A;  1PJS A;  4FWH A;  3SAS A;  2XZU A;  2QBY A;  4LZJ A;  2Y0T A;  3AJI B;  4X64 M;  3L27 A;  1K3X A;  3J7A S;  1T43 A;  1MJG M;  1QYR A;  4HLQ A;  1QAM A;  3B7Q A;  3DFZ A;  1IBK M;  3TWK A;  2QPA A;  4DR7 M;  3GLI B;  1IBM M;  3QWL A;  1NJF A;  1QDT A;  4BBA A;  4MGI E;  2KNA A;  4NOO B;  4II7 A;  3WHK A;  3GO8 A;  3C58 A;  2QHO B;  2HWJ A;  3KS8 A;  1DGB A;  4WW0 A;  1T3T A;  2X4A A;  3HU1 A;  1PRB A;  3AFH A;  4M0D A;  2V1U A;  4B3T M;  1N33 M;  4DV1 M;  3FRI A;  3FUX A;  4LJ8 A;  1Z5B A;  4A3V B;  3AL0 C;  5C1B A;  3GLG E;  3FYD A;  2CUZ A;  1NHG C;  1QDR A;  3B9P A;  3HJS A;  3KDS E;  4FCW A;  2VDB B;  5ITT A;  1XNQ M;  1HQC A;  1OJL A;  5EXP A;  4R3D A;  3SC3 A;  4DUY M;  2LVN C;  4JYA M;  2HL7 A;  3VKG A;  2BJV A;  1TH3 A;  1XHB A;  3U60 B;  2LHC A;  3GPU A;  4YHH M;  2FOI C;  3C3E A;  5ITQ A;  5LMN M;  2K0B X;  4IBB A;  1G59 A;  2D7G A;  4DR6 M;  3K1J A;  1E94 E;  4KT0 F;  4ZPX A;  4AKG A;  2KRU A;  3GRV A;  2JY6 B;  3TPZ A;  2HAK A;  4D80 A;  3K8Z A;  3FTD A;  4LZZ A;  3AV0 A;  5DYI A;  5F3W A;  1PJJ A;  1N78 A;  4G4R A;  3MHV C;  3I04 M;  4AKI A;  4PDG A;  1GO5 A;  2L4E A;  4LCB A;  3GQ4 A;  4NRV A;  4MH0 E;  1L2C A;  3BBZ A;  4LJ6 A;  4JI4 M;  2ZTC A;  1QAO A;  3E46 A;  3M6A A;  1C1K A;  1PGY A;  4DV2 M;  3GRY A;  2XFT A;  2L6O A;  1DGH B;  2R62 A;  1L2D A;  3C9P A;  1IXZ A;  3GLH E;  3Q8X A;  4IBJ A;  3RE8 A;  1L1T A;  3TWM A;  2MRO B;  2DAK A;  5ITY A;  1K3W A;  1L2B A;  1T6O A;  1NSF A;  2FNA A;  2AHM A;  3AOE A;  4PD2 A;  3FTC A;  4LF9 M;  2VF7 A;  2LVP C;  4B3M M;  5FTK A;  4LFC M;  3KW6 A;  1S3S A;  1GJT A;  3KOW E;  4IJF A;  3GLI E;  1DO2 A;  2CV0 A;  3K9O A;  2RRU A;  3J81 S;  1XC8 A;  1PJI A;  1N77 A;  1GVN A;  2W82 A;  2R46 A;  5KPT A;  1G3I A;  1G4A E;  2KZS A;  2QEN A;  3C3D A;  1MU5 A;  1LV7 A;  1W5T A;  3NBI A;  3U6Q A;  3VK7 A;  4OVZ A;  3R8F A;  5FSW A;  2CRU A;  2DZL A;  4LF5 M;  2XF3 A;  1IY1 A;  2KW0 A;  2JXN A;  4I81 A;  1H6U A;  1IN7 A;  3U6O A;  2V1C A;  3GLF A;  3D8B A;  2F5Q A;  2C9O A;  5BPV A;  3UK6 A;  2EKK A;  4LFB M;  1HJP A;  2FFJ A;  2C96 A;  3KXE C;  3LMM A;  2D7H A;  2DI0 A;  2KEB A;  2L7I A;  2DVW B;  3M0E A;  3AOE C;  3K2L A;  5FLX S;  2L09 A;  4OU7 A;  3I01 M;  4QNM A;  2R6F A;  4QOZ C;  1TF0 B;  1HNW M;  1JR3 A;  4CJ6 A; 
#chains in the Genus database with same CATH homology
 3TWL A;  1GKI A;  3KSJ A;  4I5S A;  4JI0 M;  2R45 A;  4IBF A;  1SXJ C;  1QZM A;  1SXJ D;  1E32 A;  2CHG A;  2G8L A;  3PVS A;  2UUB M;  4M0W A;  2UUC M;  1TDH A;  1J7K A;  3VLF B;  1JQJ C;  4GKK M;  2ZBK B;  4DV5 M;  4DV3 M;  3SYK A;  2CHQ A;  3U6S A;  4LF4 M;  2ZM6 M;  4IBG A;  2XSZ D;  4LJA A;  3E9S A;  3HGI A;  1L1Z A;  5EXS A;  1TH4 A;  1XXH A;  2ZAO A;  4RF0 A;  1J5E M;  2C9C A;  3L26 A;  3I51 A;  3CF6 E;  3TL4 X;  2KZU A;  3MJ5 A;  4DR4 M;  5DNY A;  2F4V M;  4QOS A;  5KPZ A;  2ZAM A;  3LVW A;  2DHR A;  4NSR A;  3GLH B;  3HJ8 A;  4LRT A;  3VDP A;  1Z6T A;  2XLJ A;  1IXR C;  1Q3C A;  2YR0 A;  4NRW A;  4NL4 H;  1HT2 E;  4FD2 A;  3FYC A;  4JN6 A;  5IRE B;  3J80 S;  1UM8 A;  4LJ5 A;  3T1H M;  2CEA A;  3E4R A;  3NWL A;  4BB9 A;  1N32 M;  2Y0Q A;  2J7N A;  3EIH A;  4AG5 A;  4LG2 A;  4DUZ M;  4NXM M;  3U6C A;  4B08 A;  1ZAE A;  4JI3 M;  4L78 A;  4KOD A;  2ERC A;  1HT1 E;  5JI2 E;  3LQR A;  4P16 A;  3VFD A;  4GRI A;  5IWA M;  2RGO A;  1NJG A;  3UJN A;  3FTF A;  3KP1 E;  1N36 M;  2XEP A;  1XWI A;  4GKJ M;  1G8P A;  3WHL A;  1YSY A;  1XNR M;  4R7G A;  1WXQ A;  4LJ4 A;  4FCT A;  1J09 A;  4MGZ E;  4DR5 M;  1G41 A;  1HQY E;  3U6E A;  2O5R A;  4D81 A;  2E5L M;  3LQQ A;  4B3R M;  3GQ3 A;  5KPR A;  2Q2E B;  2UXB M;  4I8O A;  4GHL A;  1R7R A;  2YQZ A;  5KQD A;  1EE8 A;  3PNY A;  2KA6 B;  3KOY E;  4HL4 A;  4AG6 A;  4MM3 B;  3VKH A;  4OW0 A;  1SXJ E;  1NNJ A;  3RFW A;  2F5S A;  2F5N A;  4JXJ A;  3L25 A;  2DWM A;  1KSF X;  5FTM A;  3SYL A;  3OTO M;  4M9S A;  3U6P A;  4FWG A;  3T1Y M;  3SFZ A;  4GIT A;  1KYI A;  3W0L B;  1HNX M;  2R4J A;  3CTW B;  4BLC A;  2YNM D;  1HNZ M;  4FWD A;  3FUV A;  4JI2 M;  3QAU A;  3U61 B;  2R18 A;  4IBD A;  4FW9 A;  2I7N A;  3GLG A;  1IY2 A;  3ZH9 B;  3EIE A;  2HKJ A;  3W0F A;  3SMS A;  4G4O A;  4LRS A;  2CV1 A;  1X37 A;  3HHW A;  4G4Q A;  3U5Z A;  2HHH M;  2CFO A;  5ITX A;  2Z7J A;  4GMQ A;  3HHZ A;  2QCU A;  4M9Z A;  1TGU A;  1R2Z A;  4Z8X A;  3DA1 A;  4LF7 M;  4DV7 M;  2ZAN A;  4PT5 A;  2VQF M;  2Y20 A;  4QHT A;  1QVR A;  2V6Z M;  1IQP A;  4KLN A;  1TDZ A;  5ITR A;  3UMM A;  3SAR A;  2C99 A;  4JV5 M;  3GQ5 A;  4RNA A;  3GLH A;  5IZ7 D;  3I4V A;  5E26 A;  1IM2 A;  3SBJ A;  4FCV A;  2X8A A;  5ITU A;  4YY3 M;  5JI3 E;  3PXG A;  3KSX A;  3SAU A;  3VK8 A;  1N75 A;  3HU3 A;  3MK6 A;  3GLI A;  1I4W A;  4L4U A;  2Z3X A;  2DWN A;  1Q39 A;  1FNN A;  3PFI A;  3GPP A;  5EP2 A;  3J2P B;  4LFA M;  3GP1 A;  3GPX A;  4DV6 M;  3KFU G;  2BNK A;  4B3S M;  2R4E A;  1DO0 A;  4WUR A;  3L29 A;  5EJC A;  3HHY A;  2DWZ B;  4S12 A;  3D8L A;  4JI1 M;  2EUC A;  1SXJ B;  2XFS A;  3M7G A;  4GIP A;  4X66 M;  3FUW A;  5EXX A;  2C98 A;  1JR3 D;  3J27 B;  3U60 A;  3K92 A;  8CAT A;  4OVZ B;  2Z4R A;  1D2N A;  4PDI A;  3L28 A;  3ZCB B;  4M9X A;  3RGP A;  3VDU A;  3DOA A;  1QQW A;  3CF0 A;  4X62 M;  4XBO A;  4PCZ A;  4LF6 M;  4LF8 M;  3GLF B;  7CAT A;  4IBE A;  4IIW A;  2LH0 A;  3A42 A;  5EP3 A;  2VQE M;  1GLN A;  3BOS A;  2LXE A;  4LGM A;  3GPY A;  4QHS A;  2EA0 A;  2J7O A;  1MX0 A;  4LJ9 A;  2QZ4 A;  1PM5 A;  1DGH A;  3IG8 A;  2HCB A;  3HKP A;  2VII A;  2F5P A;  3UGJ A;  4GHA A;  2F5O A;  4MGH A;  4DR1 M;  5DYG A;  5H37 D;  3SMP A;  5KO3 A;  3U61 A;  4IBK A;  1N34 M;  4MB7 A;  3FD9 A;  1YE9 A;  4AKH A;  3SAW A;  4QNR A;  2LNH C;  3R9X B;  4AZF A;  3FUU A;  2NQ8 C;  3TE6 A;  3IG5 A;  3SAT A;  3HWS A;  2DXI A;  3JR4 A;  5EP4 A;  1Z59 A;  4L15 A;  1XXH B;  4FVM A;  4B7G A;  2CHV A;  3HJQ A;  2Z4S A;  2X49 A;  1FJG M;  2UXC M;  1QAN A;  1K82 A;  1DGG A;  2K47 A;  4XGI A;  3I4Y A;  2YFQ A;  1Q3B A;  2D7E A;  2KXE A;  3TQS A;  5ITX E;  5A2Q S;  1IN5 A;  5FTJ A;  4K0K M;  5BR8 M;  2KRK A;  3KS4 A;  2DWL A;  1ZQ9 A;  4G6Z A;  2QBY B;  4AQY M;  4L16 A;  4CIS A;  2JA2 A;  3DZD A;  1NY6 A;  3J7B A;  2I7P A;  5E6J A;  1DGF A;  3JAM S;  1W5S A;  5EXT A;  4B7H A;  4ITQ A;  1NNU C;  3AOG A;  4Z6Y A;  1E9R A;  1GL7 A;  2M60 A;  2OQ4 A;  3UZU A;  1IN8 A;  4NSO B;  3T15 A;  5C18 A;  4DR3 M;  1IN6 A;  3KVW A;  3ZC7 B;  3THG A;  4G4N A;  3GRR A;  4CGY B;  3RGS A;  3SAV A;  1HR0 M;  4JI7 M;  2DZO B;  3L2A A;  2FE8 A;  3FUT A;  3LVV A;  4MGK E;  4JI8 M;  2RGH A;  1GL6 A;  3HU2 A;  2Y21 A;  4KO8 A;  5FTL A;  2DZN B;  1ORY B;  4EIW A;  1SXJ A;  5IT9 S;  2M5Z A;  1NHW C;  2H1R A;  1OFH A;  2P5T A;  4KHP M;  2EO2 A;  2XZF A;  3CF2 A;  3U6L A;  4GC5 A;  2UU9 M;  3A98 B;  2LWX A;  4DV4 M;  1KFV A;  2R65 A;  2RKO A;  3FTE A;  4DV0 M;  1NVM A;  2XSZ A;  3JR5 A;  1R2Y A;  2CE7 A;  4GH9 A;  5EP1 A;  2UUA M;  4IBI A;  4DR2 M;  1Z5A A;  4D82 A;  2BJW A;  3A45 A;  4L8R C;  1IN4 A;  4JI6 M;  2OPF A;  2A5Y B;  3AKZ A;  1L8Q A;  4AI6 A;  2G5G X;  1IXS B;  4RF1 A;  5KQ8 A;  3ILK A;  2UXD M;  1YUB A;  3SHG B;  3GLG B;  4NXN M;  1Z5C A;  1XMO M;  4I4L A;  3KOX E;  2XH9 A;  4MGY E;  2L7H A;  1I94 M;  4CHT B;  3HHX A;  4B7F A;  3A46 A;  5LMU M;  1E9S A;  1VDD A;  3U5Z B;  2QP9 X;  4IJE A;  4X65 M;  3GRU A;  3H4M A;  1R6B X;  2XGN A;  4TUW A;  3T38 A;  4GC9 A;  1NY5 A;  4IBC A;  5GKN A;  3KP0 E;  3U6D A;  3PNV A;  4LJ7 A;  4LGY A;  1XMQ M;  3KOZ E;  2C5R A;  4JI5 M;  1QAQ A;  5EQT A;  1TH2 A;  4LY6 A;  4W5W A;  1OFI A;  5FTN A;  3FKE A;  3SHF A;  3U6M A;  4AW4 A;  4OX9 M;  1IY0 A;  1IBL M;  4REZ A;  4FWH A;  3SAS A;  2XZU A;  2QBY A;  4LZJ A;  2Y0T A;  3AJI B;  4X64 M;  3L27 A;  1K3X A;  3J7A S;  4HLQ A;  1QYR A;  1QAM A;  3DFZ A;  1IBK M;  3TWK A;  2QPA A;  4DR7 M;  3GLI B;  1IBM M;  3QWL A;  1NJF A;  4BBA A;  4MGI E;  4NOO B;  4II7 A;  3WHK A;  3GO8 A;  3C58 A;  3KS8 A;  1DGB A;  4WW0 A;  1T3T A;  2X4A A;  3HU1 A;  4B3T M;  3AFH A;  4M0D A;  2V1U A;  1N33 M;  4DV1 M;  3FUX A;  4LJ8 A;  4A3V B;  1Z5B A;  3AL0 C;  5C1B A;  3FYD A;  2CUZ A;  1NHG C;  3HJS A;  3B9P A;  3KDS E;  4FCW A;  5ITT A;  1XNQ M;  1HQC A;  1OJL A;  5EXP A;  4R3D A;  3SC3 A;  4DUY M;  3VKG A;  4JYA M;  2HL7 A;  2BJV A;  1TH3 A;  1XHB A;  3U60 B;  3GPU A;  4YHH M;  2FOI C;  5ITQ A;  5LMN M;  4IBB A;  1G59 A;  2D7G A;  4DR6 M;  3K1J A;  1E94 E;  4ZPX A;  4AKG A;  2KRU A;  3GRV A;  3TPZ A;  1PJJ A;  4D80 A;  3K8Z A;  3FTD A;  4LZZ A;  3AV0 A;  5DYI A;  5F3W A;  1N78 A;  4G4R A;  3MHV C;  4AKI A;  4PDG A;  4LCB A;  3GQ4 A;  4NRV A;  4MH0 E;  1L2C A;  4LJ6 A;  4JI4 M;  3M6A A;  1QAO A;  4DV2 M;  1C1K A;  3GRY A;  2XFT A;  2L6O A;  1DGH B;  2R62 A;  1L2D A;  1L1T A;  1IXZ A;  3Q8X A;  4IBJ A;  3RE8 A;  3TWM A;  5ITY A;  1K3W A;  1L2B A;  1NSF A;  2FNA A;  2AHM A;  3AOE A;  4PD2 A;  3FTC A;  4LF9 M;  4B3M M;  5FTK A;  4LFC M;  3KW6 A;  1S3S A;  3KOW E;  4IJF A;  1DO2 A;  2CV0 A;  3J81 S;  1XC8 A;  1PJI A;  1N77 A;  1GVN A;  2W82 A;  2R46 A;  5KPT A;  1G3I A;  1G4A E;  2KZS A;  2QEN A;  1MU5 A;  1LV7 A;  1W5T A;  3NBI A;  3U6Q A;  3VK7 A;  4OVZ A;  3R8F A;  5FSW A;  4LF5 M;  2XF3 A;  1IY1 A;  2KW0 A;  4I81 A;  1H6U A;  1IN7 A;  3U6O A;  2V1C A;  3GLF A;  3D8B A;  2F5Q A;  2C9O A;  5BPV A;  3UK6 A;  4LFB M;  2FFJ A;  2C96 A;  3KXE C;  3LMM A;  2D7H A;  2KEB A;  2L7I A;  2DVW B;  3M0E A;  3AOE C;  3K2L A;  5FLX S;  2L09 A;  4OU7 A;  4QNM A;  4QOZ C;  1HNW M;  1JR3 A;  2CV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...