2KEBA

Nmr solution structure of the n-terminal domain of the dna polymerase alpha p68 subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
MSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELIAFCTSTHKVGLTSEILNSFEHEFLSKRLSKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a DNA polymerase alpha-primase domain that docks on the SV40 helicase and activates the viral primosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA polymerase subunit alpha B
total genus 19
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.530 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kebA00
2KEBA
chains in the Genus database with same CATH superfamily
4W5WA 3B89A 3FRHA 1Q39A 2QNJA 4RF1A 4GC9A 5DYIA 3T15A 3VDPA 1ORYB 5KQDA 2K9DA 5EXXA 2UUAM 2Z4SA 2QQ8A 1QDRA 1G41A 3GLIA 1GVNA 5ITRA 1TH4A 3KSXA 2MROB 1DGGA 5EJCA 3WHKA 2CRUA 3GPPA 3TWMA 2LWXA 2C9CA 4LJ8A 1R5LA 4MH0E 1GO5A 1PRBA 2FFJA 1YE9A 2KNZA 2XZUA 1GJSA 2V1CA 2L4FA 1J09A 3J81S 3TE6A 1E94E 2KDLA 1OIZA 3L2AA 1D0LA 1RU3A 1FJGM 1HT1E 7CATA 4XBOA 3RE8A 4GRIA 3RGPA 3SAUA 3FKEA 3Q8XA 3SARA 2DKLA 3LCUA 5FLXS 1HNZM 3CF0A 4LJ4A 4OVZB 3U60B 3MMPA 1Q3CA 2DWZB 4IBDA 4JXJA 5EP3A 3SASA 3PXGA 1G4AE 2HKJA 2WSFF 4IBGA 2R6FA 2YFQA 5EQTA 5E26A 1GL7A 2MGWA 4AZFA 1XNRM 2JY6B 3I4VA 2KEBA 2LBCA 4M0DA 2KW0A 4QHTA 3R9XB 1Z5AA 2UU9M 2JZ0A 4LF6M 3SATA 3J7BA 4R71A 2KNVA 1PM5A 4AQYM 1XC8A 1TR8A 1NHGC 3J27B 1XMQM 3NBIA 3BBZA 1OJLA 2Z8YM 3GRVA 2QHOB 3TPZA 1T43A 1WGLA 2FS1A 3LQQA 1NO1A 5BPVA 5EXTA 4II7A 4G4NA 3FD9A 3U6CA 2J7NA 2Z7JA 4I5SA 4DR5M 1NJFA 3HU3A 4JI1M 4OX9M 1IY2A 5LMUM 2JY7A 1GABA 1V92A 2EA0A 1HR0M 2DWNA 2JP7A 2EUCA 3JAMS 2EKKA 3K92A 1YLAA 3SYKA 2Y0QA 4X62M 2DWMA 2OOAA 3HU1A 5FTNA 2DNAA 3FUXA 2X8AA 2ZAMA 1BVSA 2DENA 1NVMA 1IBKM 2EO2A 2V1UA 1VG5A 2V6ZM 4D82A 2R62A 4NL4H 4GKKM 2ZM6M 1PJSA 3ZQJA 2FH0A 2DHYA 2HL7A 3U6LA 4B3TM 3U6DA 4LJ5A 4DR4M 2LXEA 4LY6A 1E32A 4PD2A 3HY5A 1JR3D 5ITXE 1YUBA 5ITTA 4AI6A 1ZQ9A 1Y8GA 4M9SA 3T38A 3ZH9B 2QCUA 1N34M 2K6BA 3BOSA 1N77A 3IECA 3W67A 4AG6A 3VK8A 3J7AS 3F92A 1XXHE 2XEPA 5FTJA 2OQ4A 3A46A 2Q2EB 3SHFA 2DAKA 2C98A 1W5SA 3MHVC 4MM3B 1G71A 1OAIA 5FSWA 2J5YA 3D8LA 5FTKA 1QDTA 1SXJA 1QAOA 4F1IA 4LF5M 4LF9M 2DZOB 4FVMA 1H6UA 2KXEA 2P5TA 1IQPA 1F4IA 3CF2A 4DR3M 1Z5CA 2MR9A 4GEWA 2CHGA 3NWLA 4R3DA 1TDZA 1VEJA 1XXHB 3GPXA 2R4JA 2R45A 5GKNA 4HLQA 2R46A 2QPAA 4MB7A 3DFZA 2WSEF 4JI6M 4B3RM 3HX3A 1PJQA 3U6SA 3E21A 3U6OA 2WZJA 4JI3M 2QZ4A 4KT0F 4NC6A 3FUUA 4YY3M 4I81A 8CATA 1L2DA 4X65M 4AKGA 3H4MA 1KYIA 2VF8A 4ZPXA 4DR1M 1QUTA 4UN2B 2C96A 3KVWA 4Z6YA 1UFZA 1JR3A 1XNQM 1IN4A 2ZTDA 3LVWA 1QVRA 3VFDA 4LF8M 3U5ZA 2A5YB 1R2YA 2Y0TA 4L8RC 2JY8A 1NY5A 2RGHA 3PNVA 3FYCA 2F4VM 1WHCA 4NSRA 3FRIA 2KNAA 1XMOM 3MK6A 3TWKA 2FE8A 3GLGA 3KFUG 3KXEC 1SXJB 2LTUA 4DR6M 1G8PA 2F5PA 2C9OA 2BJWA 4FWGA 4IBCA 4X64M 4LGMA 5EXSA 4DR7M 2FNAA 2BWBA 2G3QA 2I7PA 2LH0A 2L09A 1N75A 2R4EA 3VK7A 4FD2A 4LCBA 1L2BA 3GLHE 3I04M 5IT9S 3LQRA 3IG5A 4IJEA 1LTMA 1VDLA 1DGHB 4FCVA 3FTFA 1DO0A 1OIPA 1PGYA 2J7OA 1IM2A 3VKHA 4F2LA 1K3WA 1XXHA 3DZDA 5C18A 3U61A 1KSFX 4LFAM 3GLIB 2ZANA 3KP0E 3LW5F 2Z3XA 2C5RA 1SG9A 1XHBA 3UJNA 3CF6E 4Z8XA 1LV7A 2VQEM 1HNWM 4OW0A 4CISA 3E46A 2ZBKB 3NBXX 1IY1A 5EP4A 4OU7A 3I4YA 1N36M 3HKPA 3AOEA 3UGJA 4XK8F 4IBEA 2CV0A 1E9SA 4D81A 2QP9X 4GC5A 3RFWA 1NSFA 3HZJA 4G6ZA 1MJGM 2L4EA 1HQYE 1JB0F 1QZMA 2L7HA 3QYBA 3SYLA 3GPYA 3ZCBB 4B7HA 3OTOM 4FWHA 4NXNM 3U5ZB 4OVZA 4JYAM 3AOGA 2CHQA 3HWSA 4JI4M 4M9ZA 3C3EA 3HHXA 3SMPA 3HHZA 1TH3A 3K9OA 4QOSA 2OPFA 1R7RA 1AIPC 3K9PA 4I8OA 3PFIA 3R8FA 2UXDM 1C1KA 3AJIB 4IBJA 4WW0A 4JI2M 3Q8GA 3JR5A 1D2NA 3MJ5A 4AKIA 1HQCA 3BXWA 2F5SA 3L26A 4LRTA 3M7GA 4LJAA 2JA2A 4EIWA 5C1BA 2XFTA 2VQFM 3L25A 1J5EM 3FTEA 3KP1E 2DI0A 3T1YM 2DAMA 1Q3BA 1GL6A 3KS8A 1IY0A 2DZLA 1TGUA 2CUZA 2KZSA 4KO8A 2QENA 1GJTA 3A98B 1NJGA 4DV5M 3J2PB 2APLA 1D0KA 4JN6A 4NRWA 1PJJA 4B08A 3D8BA 1SXJD 1QQWA 1NNJA 5ITXA 2H1RA 1QAQA 4M0WA 3FUTA 1K82A 2YNMD 3TL4X 2M5ZA 1OAOC 1MX0A 2FOIC 5L8RF 3FTDA 1D0MA 4JI8M 1VQ1A 1IBMM 1ZMVA 4LJ7A 3L27A 2O25A 1ZMUA 2DAEA 5ITYA 3U60A 3VKGA 1I4WA 3C3DA 1AUAA 2XLJA 3HGIA 2R0IA 3KDSE 1JQJC 3KS4A 1E9RA 3VDUA 4LJ9A 2LVOC 1I94M 2G5GX 4XGIA 1NV9A 2O01F 4IBBA 2BWEA 4A3VB 3GP1A 3GLFA 2UUCM 4BB9A 3KSJA 3B7ZA 2F5NA 1ZMWA 3KOXE 3SC3A 2OOBA 2XSZD 2K47A 3A42A 1IXSB 4DV1M 3B7NA 3THGA 2N35A 2LVQD 3SHGB 4DUZM 4DV3M 3W68A 4MGYE 3J80S 3QYEA 2JUJA 4LF7M 4G3OA 4JV5M 4L78A 1EIJA 1EE8A 4L15A 4MGZE 3DA1A 4WURA 4DV0M 1OFIA 2I7NA 2H5XA 2XH9A 1EFUB 3W0LB 1L8QA 4HEOA 4LFBM 3LVVA 4I4LA 4LRSA 4IJFA 1NHWC 2VF7A 2R65A 4FCTA 3GLFE 2LHCA 2XGNA 1L2CA 1DGFA 2HCBA 4M9XA 2D7HA 3QWLA 3PVSA 1GLNA 1QZEA 2YR0A 2WSCF 4MGKE 2ZTCA 2JY5A 1IBLM 2DXIA 4IBKA 2K0BX 2XFSA 4RKUF 3GQ4A 2MJ5B 2KZUA 3SFZA 2BNKA 3U6MA 3AOEC 4PCZA 5IREB 3TWLA 3GO8A 4JI5M 2X49A 3WHLA 2CV1A 3FTCA 4LZJA 3EIEA 3I01M 1QANA 3GQ3A 1L1ZA 4B7GA 1NNUC 2R18A 4X66M 5A2QS 2XZFA 4GHAA 1J7KA 3GRYA 3B74A 5IWAM 3GLIE 3SBJA 2RRUA 3KOZE 5F3WA 4NXMM 1TH2A 3LCVB 2GNOA 5KPZA 1G59A 1GKIA 1WR1B 2D7EA 3E9SA 3LMMA 4AW4A 4NRVA 3GLGB 4DR2M 1R2ZA 4BLCA 5JI2E 5KPRA 3HJQA 3L28A 1WIVA 1IXRC 3GLHB 3C58A 2JXNA 1IXSA 1IFYA 2HAKA 2X4AA 3HHYA 3JR4A 2L2DA 3K8ZA 2LVAA 4LJ6A 4DBGB 4PDIA 2UXBM 1TF0B 1N33M 3B9PA 3EIHA 3GQ5A 3FUVA 2D7GA 4LZZA 4GH9A 3GPUA 2OO9A 3UK6A 1DO2A 4QNMA 4K0KM 3M0EA 1WGNA 3AL0C 4R7GA 2YQZA 5KQ8A 4WP2A 5LMNM 1IXZA 2HWJA 2XF3A 3U6PA 2JWSA 3GLGE 2KHHA 3UZUA 4NOOB 2AHMA 1FNNA 1WJ7A 3HU2A 1MN3A 3ZC7B 2LNHC 1Z5BA 3HJ8A 3KOYE 4AG5A 2O5RA 1V33A 4HL4A 5BR8M 4DV4M 1WXQA 2RGOA 3H4JA 4PT5A 3CTWB 5FTLA 4LGYA 2HHHM 2ERCA 3FUWA 1DV0A 1XWIA 4L4UA 1JR3E 4REZA 2VIIA 3PNYA 2DAIA 2UUBM 3SMSA 4S12A 1K3XA 4B3SM 1QUSA 2BJVA 4CJ6A 3A45A 4PDGA 2E5LM 3L29A 1R4GA 3KW6A 4D80A 2QBYB 4QNRA 3T1HM 1P3QQ 4IBFA 1VEKA 2CHVA 4AKHA 1OQYA 3GLFB 5KO3A 4BBAA 1SXJC 4RF0A 1NV8A 4G4RA 2JNHA 2R44A 4FWDA 2L6OA 1IN7A 4P16A 3K1JA 4L16A 3RGSA 3AV0A 4GIPA 3V76A 4B3MM 5DFLA 3GLHA 4KODA 4RNAA 4GHLA 2Y20A 1QAMA 1HT2E 4DV7M 3TQSA 3KOWE 1OTRA 1QYRA 3K2LA 1S3SA 4ANRA 2DZNB 1HJPA 3IG8A 1C7YA 3C9PA 5E6JA 3VLFB 1R6BX 3GRRA 3DOAA 5H37D 1DGBA 2QSFX 2CP8A 3QAUA 5EP2A 2NQ8C 3CGWA 4DUYM 1TTEA 1VDDA 1A5TA 1V34A 1ZAEA 4L6V6 5ITQA 2MH8A 4KHPM 1IN8A 3B7QA 4YHHM 1NY6A 2G8LA 4DV6M 4IIWA 2DHRA 4G4OA 2VDBB 3IHPA 2Y21A 5FTMA 3U6QA 1ZV1A 4G4QA 4B7FA 2CFOA 1YSYA 2GQFA 2LVNC 3AFHA 3GRUA 3FYDA 4Q7JA 5EXPA 1N78A 4DV2M 2KA6B 3FE3A 1W5TA 4MGIE 2ZAOA 3U61B 1IN5A 2CWBA 3I51A 1G3IA 2JZ1A 2QBYA 2Z4RA 3ILKA 3U6EA 2CE7A 4LF4M 2C99A 2XSZA 2CV2A 2KRKA 1T3TA 4Y28F 1PJTA 1Z6TA 2F5QA 4QHSA 1IN6A 1T6OA 4MGHA 1TDHA 1VEGA 3HJSA 4GKJM 3UMMA 1OKSA 2EJSA 4TUWA 1KFVA 3M6AA 2F5OA 2M60A 1XB2B 5DYGA 2DWLA 3T6PA 2LVPC 5KPTA 1Q02A 2DAGA 5JI3E 1UM8A 3HHWA 1Z59A 5DNYA 2KRUA 2RKOA 4LG2A 1MU5A 2UXCM 2DVWB 4JI0M 4CGYB 2CEAA 4FCWA 2B3TA 4FW9A 4JI7M 4GMQA 1L1TA 1OFHA 5IZ7D 4LFCM 3SAWA 4CHTB 2W82A 3E4RA 3AKZA 4GITA 1HNXM 4P17A 4KLNA 4QOZC 1DGHA 1SXJE 1PJIA 2L7IA 2LHGA 1X37A 1CUKA 4CIZA 3W0FA 5EP1A 4IBIA 4ITQA 4NSOB 2EKFA 1N32M 3SAVA 5ITUA
chains in the Genus database with same CATH topology
4W5WA 3VDPA 1Q39A 4RF1A 4GC9A 5DYIA 3T15A 1ORYB 5KQDA 5EXXA 2UUAM 2Z4SA 1G41A 3GLIA 1GVNA 5ITRA 1TH4A 3KSXA 1DGGA 5EJCA 3WHKA 3GPPA 3TWMA 2LWXA 2C9CA 4LJ8A 4MH0E 2FFJA 1YE9A 2XZUA 2V1CA 1J09A 3J81S 3TE6A 1E94E 3L2AA 1FJGM 1HT1E 7CATA 4XBOA 3RE8A 4GRIA 3RGPA 3SAUA 3FKEA 3Q8XA 3SARA 5FLXS 1HNZM 3CF0A 4LJ4A 4OVZB 3U60B 1Q3CA 2DWZB 4IBDA 4JXJA 5EP3A 3SASA 3PXGA 1G4AE 2HKJA 4IBGA 4AZFA 2YFQA 5EQTA 5E26A 1GL7A 1XNRM 4M0DA 3I4VA 2KEBA 2KW0A 4QHTA 3R9XB 1Z5AA 2UU9M 4LF6M 3SATA 3J7BA 1PM5A 4AQYM 1XC8A 1NHGC 3J27B 1XMQM 3NBIA 1OJLA 3GRVA 3TPZA 3LQQA 5BPVA 5EXTA 4II7A 4G4NA 3FD9A 3U6CA 2J7NA 2Z7JA 4I5SA 4DR5M 1NJFA 3HU3A 4JI1M 4OX9M 1IY2A 5LMUM 2EA0A 1HR0M 2DWNA 3JAMS 2EUCA 3K92A 3SYKA 2Y0QA 4X62M 2DWMA 3HU1A 5FTNA 3FUXA 2X8AA 2ZAMA 1NVMA 1IBKM 2EO2A 2V1UA 2V6ZM 4D82A 4GKKM 2R62A 4NL4H 2ZM6M 2HL7A 3U6LA 4B3TM 3U6DA 4LJ5A 4DR4M 2LXEA 4LY6A 1E32A 4PD2A 1JR3D 5ITXE 1YUBA 5ITTA 4AI6A 1ZQ9A 4M9SA 3T38A 3ZH9B 2QCUA 1N34M 3BOSA 1N77A 4AG6A 3VK8A 3J7AS 2OQ4A 2XEPA 5FTJA 3A46A 2Q2EB 3SHFA 2C98A 1W5SA 3MHVC 4MM3B 5FSWA 3D8LA 5FTKA 4LF9M 1SXJA 1QAOA 4LF5M 2DZOB 4FVMA 1H6UA 2KXEA 2P5TA 1IQPA 3CF2A 4DR3M 1Z5CA 2CHGA 3NWLA 4R3DA 1TDZA 1XXHB 3GPXA 2R4JA 2R45A 5GKNA 4HLQA 2R46A 2QPAA 4MB7A 3DFZA 4JI6M 4B3RM 3U6SA 3U6OA 4JI3M 2QZ4A 4YY3M 3FUUA 4I81A 8CATA 1L2DA 4X65M 4AKGA 3H4MA 1KYIA 4ZPXA 4DR1M 4Z6YA 2C96A 3KVWA 1XNQM 1JR3A 1IN4A 3LVWA 1QVRA 3VFDA 4LF8M 3U5ZA 2A5YB 1R2YA 2Y0TA 4L8RC 1NY5A 2RGHA 3PNVA 3FYCA 2F4VM 4NSRA 1XMOM 3MK6A 3TWKA 2FE8A 3GLGA 3KFUG 3KXEC 1SXJB 4DR6M 1G8PA 2F5PA 2C9OA 2BJWA 4FWGA 4IBCA 4X64M 4LGMA 5EXSA 4DR7M 2FNAA 2LH0A 2I7PA 2L09A 1N75A 2R4EA 3VK7A 4FD2A 4LCBA 1L2BA 5IT9S 3LQRA 3IG5A 4IJEA 3FTFA 4FCVA 1DGHB 1DO0A 2J7OA 1IM2A 3VKHA 1K3WA 1XXHA 3DZDA 5C18A 3U61A 1KSFX 4LFAM 3GLIB 2ZANA 3KP0E 2Z3XA 2C5RA 1XHBA 3UJNA 3CF6E 4Z8XA 1LV7A 2VQEM 1HNWM 4OW0A 4CISA 2ZBKB 1IY1A 5EP4A 4OU7A 3I4YA 1N36M 3HKPA 3AOEA 3UGJA 2CV0A 4IBEA 1E9SA 4D81A 2QP9X 4GC5A 3RFWA 1NSFA 4G6ZA 3GPYA 1HQYE 1QZMA 2L7HA 3SYLA 3ZCBB 4B7HA 3OTOM 4FWHA 4NXNM 3U5ZB 4OVZA 4JYAM 3AOGA 2CHQA 3HWSA 4JI4M 4M9ZA 3HHXA 2UXDM 3SMPA 3HHZA 1TH3A 4QOSA 2OPFA 1R7RA 3R8FA 4I8OA 3PFIA 1C1KA 3AJIB 4IBJA 4WW0A 4JI2M 3JR5A 1D2NA 3MJ5A 4AKIA 1HQCA 2F5SA 3L26A 4LRTA 3M7GA 4LJAA 2JA2A 4EIWA 5C1BA 2XFTA 2VQFM 3L25A 1J5EM 3FTEA 3KP1E 3T1YM 1Q3BA 1GL6A 3KS8A 1IY0A 1TGUA 2CUZA 2KZSA 4KO8A 2QENA 3A98B 1NJGA 3J2PB 4JN6A 4NRWA 1PJJA 4B08A 3D8BA 1SXJD 1QQWA 1NNJA 5ITXA 2H1RA 1QAQA 4M0WA 3FUTA 1K82A 2YNMD 3TL4X 2M5ZA 1MX0A 2FOIC 3FTDA 4JI8M 1IBMM 4LJ7A 3L27A 5ITYA 3U60A 3VKGA 1I4WA 2XLJA 3HGIA 3KDSE 1JQJC 3KS4A 1E9RA 3VDUA 4LJ9A 1I94M 2G5GX 4XGIA 4IBBA 4A3VB 3GP1A 3GLFA 2UUCM 4BB9A 3KSJA 2F5NA 3KOXE 3SC3A 2XSZD 2K47A 3A42A 1IXSB 4DV1M 3THGA 4DV3M 3SHGB 4DUZM 4MGYE 3J80S 4LF7M 4JV5M 4L78A 1EE8A 4L15A 4MGZE 3DA1A 4WURA 4DV0M 1OFIA 2I7NA 2XH9A 3W0LB 1L8QA 4LFBM 3LVVA 4I4LA 4LRSA 4IJFA 1NHWC 2R65A 4FCTA 2XGNA 1L2CA 1DGFA 2HCBA 4M9XA 2D7HA 3QWLA 3PVSA 1GLNA 2YR0A 4MGKE 1IBLM 2DXIA 4IBKA 2XFSA 2KZUA 3SFZA 2BNKA 3U6MA 3AOEC 4PCZA 5IREB 3TWLA 3GO8A 4JI5M 2X49A 3WHLA 2CV1A 3FTCA 4LZJA 3EIEA 1QANA 3GQ3A 1L1ZA 4B7GA 1NNUC 2R18A 4X66M 5A2QS 2XZFA 4GHAA 1J7KA 3GRYA 5IWAM 3SBJA 5F3WA 3KOZE 4NXMM 1TH2A 5KPZA 1G59A 1GKIA 3E9SA 2D7EA 3LMMA 4AW4A 3GLGB 4NRVA 4DR2M 1R2ZA 4BLCA 5JI2E 5KPRA 3HJQA 3L28A 3C58A 1IXRC 3GLHB 2X4AA 3HHYA 3JR4A 3K8ZA 4LJ6A 4PDIA 2UXBM 1N33M 3B9PA 3EIHA 3GQ5A 3FUVA 2D7GA 4LZZA 4GH9A 3GPUA 3UK6A 1DO2A 4QNMA 4K0KM 3M0EA 3AL0C 4R7GA 2YQZA 5KQ8A 5LMNM 1IXZA 2XF3A 3U6PA 3UZUA 4NOOB 2AHMA 1FNNA 3HU2A 3ZC7B 2LNHC 1Z5BA 3HJ8A 3KOYE 4AG5A 2O5RA 5BR8M 4HL4A 3GQ4A 4DV4M 1WXQA 2RGOA 4PT5A 3CTWB 5FTLA 4LGYA 2HHHM 2ERCA 3FUWA 1XWIA 4L4UA 4REZA 2VIIA 3PNYA 2UUBM 3SMSA 4S12A 1K3XA 4B3SM 2BJVA 3A45A 4PDGA 2E5LM 3L29A 4D80A 3KW6A 2QBYB 4QNRA 3T1HM 4IBFA 2CHVA 4AKHA 3GLFB 5KO3A 4BBAA 1SXJC 4RF0A 4G4RA 4FWDA 2L6OA 1IN7A 4P16A 3K1JA 4L16A 3RGSA 3AV0A 4GIPA 4B3MM 3GLHA 4KODA 4RNAA 4GHLA 2Y20A 1QAMA 1HT2E 4DV7M 3TQSA 3KOWE 1QYRA 3K2LA 1S3SA 2DZNB 3IG8A 5E6JA 3VLFB 1R6BX 3GRRA 3DOAA 5H37D 1DGBA 4DUYM 3QAUA 5EP2A 2NQ8C 1VDDA 5ITQA 1ZAEA 4KHPM 1IN8A 4YHHM 1NY6A 2G8LA 4DV6M 4IIWA 2DHRA 4G4OA 5FTMA 2Y21A 3U6QA 4G4QA 4B7FA 2CFOA 1YSYA 3AFHA 3GRUA 3FYDA 1N78A 5EXPA 4DV2M 2KA6B 1W5TA 4MGIE 2ZAOA 3U61B 1IN5A 3I51A 1G3IA 2QBYA 2Z4RA 3ILKA 3U6EA 2CE7A 4LF4M 2C99A 2XSZA 2CV2A 2KRKA 1T3TA 1Z6TA 2F5QA 4QHSA 1IN6A 4MGHA 1TDHA 3HJSA 4GKJM 3UMMA 4TUWA 1KFVA 3M6AA 2F5OA 2M60A 5DYGA 2DWLA 5KPTA 5JI3E 1UM8A 3HHWA 1Z59A 5DNYA 2KRUA 2RKOA 4LG2A 1MU5A 2UXCM 2DVWB 4JI0M 4CGYB 2CEAA 4FCWA 4FW9A 4JI7M 4GMQA 1L1TA 1OFHA 5IZ7D 4LFCM 3SAWA 4CHTB 2W82A 3E4RA 3AKZA 4GITA 1HNXM 4QOZC 4KLNA 1DGHA 1SXJE 1PJIA 2L7IA 1X37A 3W0FA 5EP1A 4IBIA 4ITQA 4NSOB 4DV5M 1N32M 3SAVA 5ITUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEB A; 
#chains in the Genus database with same CATH topology
 4W5W A;  3B89 A;  3FRH A;  1Q39 A;  2QNJ A;  4RF1 A;  4GC9 A;  5DYI A;  3T15 A;  3VDP A;  1ORY B;  5KQD A;  2K9D A;  5EXX A;  2UUA M;  2Z4S A;  2QQ8 A;  1QDR A;  1G41 A;  3GLI A;  1GVN A;  5ITR A;  1TH4 A;  3KSX A;  2MRO B;  1DGG A;  5EJC A;  3WHK A;  2CRU A;  3GPP A;  3TWM A;  2LWX A;  2C9C A;  4LJ8 A;  1R5L A;  4MH0 E;  1GO5 A;  1PRB A;  2FFJ A;  1YE9 A;  2KNZ A;  2XZU A;  1GJS A;  2V1C A;  2L4F A;  1J09 A;  3J81 S;  3TE6 A;  1E94 E;  2KDL A;  1OIZ A;  3L2A A;  1D0L A;  1RU3 A;  1FJG M;  1HT1 E;  7CAT A;  4XBO A;  3RE8 A;  4GRI A;  3RGP A;  3SAU A;  3FKE A;  3Q8X A;  3SAR A;  2DKL A;  3LCU A;  5FLX S;  1HNZ M;  3CF0 A;  4LJ4 A;  4OVZ B;  3U60 B;  3MMP A;  1Q3C A;  2DWZ B;  4IBD A;  4JXJ A;  5EP3 A;  3SAS A;  3PXG A;  1G4A E;  2HKJ A;  2WSF F;  4IBG A;  2R6F A;  2YFQ A;  5EQT A;  5E26 A;  1GL7 A;  2MGW A;  4AZF A;  1XNR M;  2JY6 B;  3I4V A;  2KEB A;  2LBC A;  4M0D A;  2KW0 A;  4QHT A;  3R9X B;  1Z5A A;  2UU9 M;  2JZ0 A;  4LF6 M;  3SAT A;  3J7B A;  4R71 A;  2KNV A;  1PM5 A;  4AQY M;  1XC8 A;  1TR8 A;  1NHG C;  3J27 B;  1XMQ M;  3NBI A;  3BBZ A;  1OJL A;  2Z8Y M;  3GRV A;  2QHO B;  3TPZ A;  1T43 A;  1WGL A;  2FS1 A;  3LQQ A;  1NO1 A;  5BPV A;  5EXT A;  4II7 A;  4G4N A;  3FD9 A;  3U6C A;  2J7N A;  2Z7J A;  4I5S A;  4DR5 M;  1NJF A;  3HU3 A;  4JI1 M;  4OX9 M;  1IY2 A;  5LMU M;  2JY7 A;  1GAB A;  1V92 A;  2EA0 A;  1HR0 M;  2DWN A;  2JP7 A;  2EUC A;  3JAM S;  2EKK A;  3K92 A;  1YLA A;  3SYK A;  2Y0Q A;  4X62 M;  2DWM A;  2OOA A;  3HU1 A;  5FTN A;  2DNA A;  3FUX A;  2X8A A;  2ZAM A;  1BVS A;  2DEN A;  1NVM A;  1IBK M;  2EO2 A;  2V1U A;  1VG5 A;  2V6Z M;  4D82 A;  2R62 A;  4NL4 H;  4GKK M;  2ZM6 M;  1PJS A;  3ZQJ A;  2FH0 A;  2DHY A;  2HL7 A;  3U6L A;  4B3T M;  3U6D A;  4LJ5 A;  4DR4 M;  2LXE A;  4LY6 A;  1E32 A;  4PD2 A;  3HY5 A;  1JR3 D;  5ITX E;  1YUB A;  5ITT A;  4AI6 A;  1ZQ9 A;  1Y8G A;  4M9S A;  3T38 A;  3ZH9 B;  2QCU A;  1N34 M;  2K6B A;  3BOS A;  1N77 A;  3IEC A;  3W67 A;  4AG6 A;  3VK8 A;  3J7A S;  3F92 A;  1XXH E;  2XEP A;  5FTJ A;  2OQ4 A;  3A46 A;  2Q2E B;  3SHF A;  2DAK A;  2C98 A;  1W5S A;  3MHV C;  4MM3 B;  1G71 A;  1OAI A;  5FSW A;  2J5Y A;  3D8L A;  5FTK A;  1QDT A;  1SXJ A;  1QAO A;  4F1I A;  4LF5 M;  4LF9 M;  2DZO B;  4FVM A;  1H6U A;  2KXE A;  2P5T A;  1IQP A;  1F4I A;  3CF2 A;  4DR3 M;  1Z5C A;  2MR9 A;  4GEW A;  2CHG A;  3NWL A;  4R3D A;  1TDZ A;  1VEJ A;  1XXH B;  3GPX A;  2R4J A;  2R45 A;  5GKN A;  4HLQ A;  2R46 A;  2QPA A;  4MB7 A;  3DFZ A;  2WSE F;  4JI6 M;  4B3R M;  3HX3 A;  1PJQ A;  3U6S A;  3E21 A;  3U6O A;  2WZJ A;  4JI3 M;  2QZ4 A;  4KT0 F;  4NC6 A;  3FUU A;  4YY3 M;  4I81 A;  8CAT A;  1L2D A;  4X65 M;  4AKG A;  3H4M A;  1KYI A;  2VF8 A;  4ZPX A;  4DR1 M;  1QUT A;  4UN2 B;  2C96 A;  3KVW A;  4Z6Y A;  1UFZ A;  1JR3 A;  1XNQ M;  1IN4 A;  2ZTD A;  3LVW A;  1QVR A;  3VFD A;  4LF8 M;  3U5Z A;  2A5Y B;  1R2Y A;  2Y0T A;  4L8R C;  2JY8 A;  1NY5 A;  2RGH A;  3PNV A;  3FYC A;  2F4V M;  1WHC A;  4NSR A;  3FRI A;  2KNA A;  1XMO M;  3MK6 A;  3TWK A;  2FE8 A;  3GLG A;  3KFU G;  3KXE C;  1SXJ B;  2LTU A;  4DR6 M;  1G8P A;  2F5P A;  2C9O A;  2BJW A;  4FWG A;  4IBC A;  4X64 M;  4LGM A;  5EXS A;  4DR7 M;  2FNA A;  2BWB A;  2G3Q A;  2I7P A;  2LH0 A;  2L09 A;  1N75 A;  2R4E A;  3VK7 A;  4FD2 A;  4LCB A;  1L2B A;  3GLH E;  3I04 M;  5IT9 S;  3LQR A;  3IG5 A;  4IJE A;  1LTM A;  1VDL A;  1DGH B;  4FCV A;  3FTF A;  1DO0 A;  1OIP A;  1PGY A;  2J7O A;  1IM2 A;  3VKH A;  4F2L A;  1K3W A;  1XXH A;  3DZD A;  5C18 A;  3U61 A;  1KSF X;  4LFA M;  3GLI B;  2ZAN A;  3KP0 E;  3LW5 F;  2Z3X A;  2C5R A;  1SG9 A;  1XHB A;  3UJN A;  3CF6 E;  4Z8X A;  1LV7 A;  2VQE M;  1HNW M;  4OW0 A;  4CIS A;  3E46 A;  2ZBK B;  3NBX X;  1IY1 A;  5EP4 A;  4OU7 A;  3I4Y A;  1N36 M;  3HKP A;  3AOE A;  3UGJ A;  4XK8 F;  4IBE A;  2CV0 A;  1E9S A;  4D81 A;  2QP9 X;  4GC5 A;  3RFW A;  1NSF A;  3HZJ A;  4G6Z A;  1MJG M;  2L4E A;  1HQY E;  1JB0 F;  1QZM A;  2L7H A;  3QYB A;  3SYL A;  3GPY A;  3ZCB B;  4B7H A;  3OTO M;  4FWH A;  4NXN M;  3U5Z B;  4OVZ A;  4JYA M;  3AOG A;  2CHQ A;  3HWS A;  4JI4 M;  4M9Z A;  3C3E A;  3HHX A;  3SMP A;  3HHZ A;  1TH3 A;  3K9O A;  4QOS A;  2OPF A;  1R7R A;  1AIP C;  3K9P A;  4I8O A;  3PFI A;  3R8F A;  2UXD M;  1C1K A;  3AJI B;  4IBJ A;  4WW0 A;  4JI2 M;  3Q8G A;  3JR5 A;  1D2N A;  3MJ5 A;  4AKI A;  1HQC A;  3BXW A;  2F5S A;  3L26 A;  4LRT A;  3M7G A;  4LJA A;  2JA2 A;  4EIW A;  5C1B A;  2XFT A;  2VQF M;  3L25 A;  1J5E M;  3FTE A;  3KP1 E;  2DI0 A;  3T1Y M;  2DAM A;  1Q3B A;  1GL6 A;  3KS8 A;  1IY0 A;  2DZL A;  1TGU A;  2CUZ A;  2KZS A;  4KO8 A;  2QEN A;  1GJT A;  3A98 B;  1NJG A;  4DV5 M;  3J2P B;  2APL A;  1D0K A;  4JN6 A;  4NRW A;  1PJJ A;  4B08 A;  3D8B A;  1SXJ D;  1QQW A;  1NNJ A;  5ITX A;  2H1R A;  1QAQ A;  4M0W A;  3FUT A;  1K82 A;  2YNM D;  3TL4 X;  2M5Z A;  1OAO C;  1MX0 A;  2FOI C;  5L8R F;  3FTD A;  1D0M A;  4JI8 M;  1VQ1 A;  1IBM M;  1ZMV A;  4LJ7 A;  3L27 A;  2O25 A;  1ZMU A;  2DAE A;  5ITY A;  3U60 A;  3VKG A;  1I4W A;  3C3D A;  1AUA A;  2XLJ A;  3HGI A;  2R0I A;  3KDS E;  1JQJ C;  3KS4 A;  1E9R A;  3VDU A;  4LJ9 A;  2LVO C;  1I94 M;  2G5G X;  4XGI A;  1NV9 A;  2O01 F;  4IBB A;  2BWE A;  4A3V B;  3GP1 A;  3GLF A;  2UUC M;  4BB9 A;  3KSJ A;  3B7Z A;  2F5N A;  1ZMW A;  3KOX E;  3SC3 A;  2OOB A;  2XSZ D;  2K47 A;  3A42 A;  1IXS B;  4DV1 M;  3B7N A;  3THG A;  2N35 A;  2LVQ D;  3SHG B;  4DUZ M;  4DV3 M;  3W68 A;  4MGY E;  3J80 S;  3QYE A;  2JUJ A;  4LF7 M;  4G3O A;  4JV5 M;  4L78 A;  1EIJ A;  1EE8 A;  4L15 A;  4MGZ E;  3DA1 A;  4WUR A;  4DV0 M;  1OFI A;  2I7N A;  2H5X A;  2XH9 A;  1EFU B;  3W0L B;  1L8Q A;  4HEO A;  4LFB M;  3LVV A;  4I4L A;  4LRS A;  4IJF A;  1NHW C;  2VF7 A;  2R65 A;  4FCT A;  3GLF E;  2LHC A;  2XGN A;  1L2C A;  1DGF A;  2HCB A;  4M9X A;  2D7H A;  3QWL A;  3PVS A;  1GLN A;  1QZE A;  2YR0 A;  2WSC F;  4MGK E;  2ZTC A;  2JY5 A;  1IBL M;  2DXI A;  4IBK A;  2K0B X;  2XFS A;  4RKU F;  3GQ4 A;  2MJ5 B;  2KZU A;  3SFZ A;  2BNK A;  3U6M A;  3AOE C;  4PCZ A;  5IRE B;  3TWL A;  3GO8 A;  4JI5 M;  2X49 A;  3WHL A;  2CV1 A;  3FTC A;  4LZJ A;  3EIE A;  3I01 M;  1QAN A;  3GQ3 A;  1L1Z A;  4B7G A;  1NNU C;  2R18 A;  4X66 M;  5A2Q S;  2XZF A;  4GHA A;  1J7K A;  3GRY A;  3B74 A;  5IWA M;  3GLI E;  3SBJ A;  2RRU A;  3KOZ E;  5F3W A;  4NXM M;  1TH2 A;  3LCV B;  2GNO A;  5KPZ A;  1G59 A;  1GKI A;  1WR1 B;  2D7E A;  3E9S A;  3LMM A;  4AW4 A;  4NRV A;  3GLG B;  4DR2 M;  1R2Z A;  4BLC A;  5JI2 E;  5KPR A;  3HJQ A;  3L28 A;  1WIV A;  1IXR C;  3GLH B;  3C58 A;  2JXN A;  1IXS A;  1IFY A;  2HAK A;  2X4A A;  3HHY A;  3JR4 A;  2L2D A;  3K8Z A;  2LVA A;  4LJ6 A;  4DBG B;  4PDI A;  2UXB M;  1TF0 B;  1N33 M;  3B9P A;  3EIH A;  3GQ5 A;  3FUV A;  2D7G A;  4LZZ A;  4GH9 A;  3GPU A;  2OO9 A;  3UK6 A;  1DO2 A;  4QNM A;  4K0K M;  3M0E A;  1WGN A;  3AL0 C;  4R7G A;  2YQZ A;  5KQ8 A;  4WP2 A;  5LMN M;  1IXZ A;  2HWJ A;  2XF3 A;  3U6P A;  2JWS A;  3GLG E;  2KHH A;  3UZU A;  4NOO B;  2AHM A;  1FNN A;  1WJ7 A;  3HU2 A;  1MN3 A;  3ZC7 B;  2LNH C;  1Z5B A;  3HJ8 A;  3KOY E;  4AG5 A;  2O5R A;  1V33 A;  4HL4 A;  5BR8 M;  4DV4 M;  1WXQ A;  2RGO A;  3H4J A;  4PT5 A;  3CTW B;  5FTL A;  4LGY A;  2HHH M;  2ERC A;  3FUW A;  1DV0 A;  1XWI A;  4L4U A;  1JR3 E;  4REZ A;  2VII A;  3PNY A;  2DAI A;  2UUB M;  3SMS A;  4S12 A;  1K3X A;  4B3S M;  1QUS A;  2BJV A;  4CJ6 A;  3A45 A;  4PDG A;  2E5L M;  3L29 A;  1R4G A;  3KW6 A;  4D80 A;  2QBY B;  4QNR A;  3T1H M;  1P3Q Q;  4IBF A;  1VEK A;  2CHV A;  4AKH A;  1OQY A;  3GLF B;  5KO3 A;  4BBA A;  1SXJ C;  4RF0 A;  1NV8 A;  4G4R A;  2JNH A;  2R44 A;  4FWD A;  2L6O A;  1IN7 A;  4P16 A;  3K1J A;  4L16 A;  3RGS A;  3AV0 A;  4GIP A;  3V76 A;  4B3M M;  5DFL A;  3GLH A;  4KOD A;  4RNA A;  4GHL A;  2Y20 A;  1QAM A;  1HT2 E;  4DV7 M;  3TQS A;  3KOW E;  1OTR A;  1QYR A;  3K2L A;  1S3S A;  4ANR A;  2DZN B;  1HJP A;  3IG8 A;  1C7Y A;  3C9P A;  5E6J A;  3VLF B;  1R6B X;  3GRR A;  3DOA A;  5H37 D;  1DGB A;  2QSF X;  2CP8 A;  3QAU A;  5EP2 A;  2NQ8 C;  3CGW A;  4DUY M;  1TTE A;  1VDD A;  1A5T A;  1V34 A;  1ZAE A;  4L6V 6;  5ITQ A;  2MH8 A;  4KHP M;  1IN8 A;  3B7Q A;  4YHH M;  1NY6 A;  2G8L A;  4DV6 M;  4IIW A;  2DHR A;  4G4O A;  2VDB B;  3IHP A;  2Y21 A;  5FTM A;  3U6Q A;  1ZV1 A;  4G4Q A;  4B7F A;  2CFO A;  1YSY A;  2GQF A;  2LVN C;  3AFH A;  3GRU A;  3FYD A;  4Q7J A;  5EXP A;  1N78 A;  4DV2 M;  2KA6 B;  3FE3 A;  1W5T A;  4MGI E;  2ZAO A;  3U61 B;  1IN5 A;  2CWB A;  3I51 A;  1G3I A;  2JZ1 A;  2QBY A;  2Z4R A;  3ILK A;  3U6E A;  2CE7 A;  4LF4 M;  2C99 A;  2XSZ A;  2CV2 A;  2KRK A;  1T3T A;  4Y28 F;  1PJT A;  1Z6T A;  2F5Q A;  4QHS A;  1IN6 A;  1T6O A;  4MGH A;  1TDH A;  1VEG A;  3HJS A;  4GKJ M;  3UMM A;  1OKS A;  2EJS A;  4TUW A;  1KFV A;  3M6A A;  2F5O A;  2M60 A;  1XB2 B;  5DYG A;  2DWL A;  3T6P A;  2LVP C;  5KPT A;  1Q02 A;  2DAG A;  5JI3 E;  1UM8 A;  3HHW A;  1Z59 A;  5DNY A;  2KRU A;  2RKO A;  4LG2 A;  1MU5 A;  2UXC M;  2DVW B;  4JI0 M;  4CGY B;  2CEA A;  4FCW A;  2B3T A;  4FW9 A;  4JI7 M;  4GMQ A;  1L1T A;  1OFH A;  5IZ7 D;  4LFC M;  3SAW A;  4CHT B;  2W82 A;  3E4R A;  3AKZ A;  4GIT A;  1HNX M;  4P17 A;  4KLN A;  4QOZ C;  1DGH A;  1SXJ E;  1PJI A;  2L7I A;  2LHG A;  1X37 A;  1CUK A;  4CIZ A;  3W0F A;  5EP1 A;  4IBI A;  4ITQ A;  4NSO B;  2EKF A;  1N32 M;  3SAV A;  5ITU A; 
#chains in the Genus database with same CATH homology
 4W5W A;  3VDP A;  1Q39 A;  4RF1 A;  4GC9 A;  5DYI A;  3T15 A;  1ORY B;  5KQD A;  5EXX A;  2UUA M;  2Z4S A;  1G41 A;  3GLI A;  1GVN A;  5ITR A;  1TH4 A;  3KSX A;  1DGG A;  5EJC A;  3WHK A;  3GPP A;  3TWM A;  2LWX A;  2C9C A;  4LJ8 A;  4MH0 E;  2FFJ A;  1YE9 A;  2XZU A;  2V1C A;  1J09 A;  3J81 S;  3TE6 A;  1E94 E;  3L2A A;  1FJG M;  1HT1 E;  7CAT A;  4XBO A;  3RE8 A;  4GRI A;  3RGP A;  3SAU A;  3FKE A;  3Q8X A;  3SAR A;  5FLX S;  1HNZ M;  3CF0 A;  4LJ4 A;  4OVZ B;  3U60 B;  1Q3C A;  2DWZ B;  4IBD A;  4JXJ A;  5EP3 A;  3SAS A;  3PXG A;  1G4A E;  2HKJ A;  4IBG A;  4AZF A;  2YFQ A;  5EQT A;  5E26 A;  1GL7 A;  1XNR M;  4M0D A;  3I4V A;  2KEB A;  2KW0 A;  4QHT A;  3R9X B;  1Z5A A;  2UU9 M;  4LF6 M;  3SAT A;  3J7B A;  1PM5 A;  4AQY M;  1XC8 A;  1NHG C;  3J27 B;  1XMQ M;  3NBI A;  1OJL A;  3GRV A;  3TPZ A;  3LQQ A;  5BPV A;  5EXT A;  4II7 A;  4G4N A;  3FD9 A;  3U6C A;  2J7N A;  2Z7J A;  4I5S A;  4DR5 M;  1NJF A;  3HU3 A;  4JI1 M;  4OX9 M;  1IY2 A;  5LMU M;  2EA0 A;  1HR0 M;  2DWN A;  3JAM S;  2EUC A;  3K92 A;  3SYK A;  2Y0Q A;  4X62 M;  2DWM A;  3HU1 A;  5FTN A;  3FUX A;  2X8A A;  2ZAM A;  1NVM A;  1IBK M;  2EO2 A;  2V1U A;  2V6Z M;  4D82 A;  4GKK M;  2R62 A;  4NL4 H;  2ZM6 M;  2HL7 A;  3U6L A;  4B3T M;  3U6D A;  4LJ5 A;  4DR4 M;  2LXE A;  4LY6 A;  1E32 A;  4PD2 A;  1JR3 D;  5ITX E;  1YUB A;  5ITT A;  4AI6 A;  1ZQ9 A;  4M9S A;  3T38 A;  3ZH9 B;  2QCU A;  1N34 M;  3BOS A;  1N77 A;  4AG6 A;  3VK8 A;  3J7A S;  2OQ4 A;  2XEP A;  5FTJ A;  3A46 A;  2Q2E B;  3SHF A;  2C98 A;  1W5S A;  3MHV C;  4MM3 B;  5FSW A;  3D8L A;  5FTK A;  4LF9 M;  1SXJ A;  1QAO A;  4LF5 M;  2DZO B;  4FVM A;  1H6U A;  2KXE A;  2P5T A;  1IQP A;  3CF2 A;  4DR3 M;  1Z5C A;  2CHG A;  3NWL A;  4R3D A;  1TDZ A;  1XXH B;  3GPX A;  2R4J A;  2R45 A;  5GKN A;  4HLQ A;  2R46 A;  2QPA A;  4MB7 A;  3DFZ A;  4JI6 M;  4B3R M;  3U6S A;  3U6O A;  4JI3 M;  2QZ4 A;  4YY3 M;  3FUU A;  4I81 A;  8CAT A;  1L2D A;  4X65 M;  4AKG A;  3H4M A;  1KYI A;  4ZPX A;  4DR1 M;  4Z6Y A;  2C96 A;  3KVW A;  1XNQ M;  1JR3 A;  1IN4 A;  3LVW A;  1QVR A;  3VFD A;  4LF8 M;  3U5Z A;  2A5Y B;  1R2Y A;  2Y0T A;  4L8R C;  1NY5 A;  2RGH A;  3PNV A;  3FYC A;  2F4V M;  4NSR A;  1XMO M;  3MK6 A;  3TWK A;  2FE8 A;  3GLG A;  3KFU G;  3KXE C;  1SXJ B;  4DR6 M;  1G8P A;  2F5P A;  2C9O A;  2BJW A;  4FWG A;  4IBC A;  4X64 M;  4LGM A;  5EXS A;  4DR7 M;  2FNA A;  2LH0 A;  2I7P A;  2L09 A;  1N75 A;  2R4E A;  3VK7 A;  4FD2 A;  4LCB A;  1L2B A;  5IT9 S;  3LQR A;  3IG5 A;  4IJE A;  3FTF A;  4FCV A;  1DGH B;  1DO0 A;  2J7O A;  1IM2 A;  3VKH A;  1K3W A;  1XXH A;  3DZD A;  5C18 A;  3U61 A;  1KSF X;  4LFA M;  3GLI B;  2ZAN A;  3KP0 E;  2Z3X A;  2C5R A;  1XHB A;  3UJN A;  3CF6 E;  4Z8X A;  1LV7 A;  2VQE M;  1HNW M;  4OW0 A;  4CIS A;  2ZBK B;  1IY1 A;  5EP4 A;  4OU7 A;  3I4Y A;  1N36 M;  3HKP A;  3AOE A;  3UGJ A;  2CV0 A;  4IBE A;  1E9S A;  4D81 A;  2QP9 X;  4GC5 A;  3RFW A;  1NSF A;  4G6Z A;  3GPY A;  1HQY E;  1QZM A;  2L7H A;  3SYL A;  3ZCB B;  4B7H A;  3OTO M;  4FWH A;  4NXN M;  3U5Z B;  4OVZ A;  4JYA M;  3AOG A;  2CHQ A;  3HWS A;  4JI4 M;  4M9Z A;  3HHX A;  2UXD M;  3SMP A;  3HHZ A;  1TH3 A;  4QOS A;  2OPF A;  1R7R A;  3R8F A;  4I8O A;  3PFI A;  1C1K A;  3AJI B;  4IBJ A;  4WW0 A;  4JI2 M;  3JR5 A;  1D2N A;  3MJ5 A;  4AKI A;  1HQC A;  2F5S A;  3L26 A;  4LRT A;  3M7G A;  4LJA A;  2JA2 A;  4EIW A;  5C1B A;  2XFT A;  2VQF M;  3L25 A;  1J5E M;  3FTE A;  3KP1 E;  3T1Y M;  1Q3B A;  1GL6 A;  3KS8 A;  1IY0 A;  1TGU A;  2CUZ A;  2KZS A;  4KO8 A;  2QEN A;  3A98 B;  1NJG A;  3J2P B;  4JN6 A;  4NRW A;  1PJJ A;  4B08 A;  3D8B A;  1SXJ D;  1QQW A;  1NNJ A;  5ITX A;  2H1R A;  1QAQ A;  4M0W A;  3FUT A;  1K82 A;  2YNM D;  3TL4 X;  2M5Z A;  1MX0 A;  2FOI C;  3FTD A;  4JI8 M;  1IBM M;  4LJ7 A;  3L27 A;  5ITY A;  3U60 A;  3VKG A;  1I4W A;  2XLJ A;  3HGI A;  3KDS E;  1JQJ C;  3KS4 A;  1E9R A;  3VDU A;  4LJ9 A;  1I94 M;  2G5G X;  4XGI A;  4IBB A;  4A3V B;  3GP1 A;  3GLF A;  2UUC M;  4BB9 A;  3KSJ A;  2F5N A;  3KOX E;  3SC3 A;  2XSZ D;  2K47 A;  3A42 A;  1IXS B;  4DV1 M;  3THG A;  4DV3 M;  3SHG B;  4DUZ M;  4MGY E;  3J80 S;  4LF7 M;  4JV5 M;  4L78 A;  1EE8 A;  4L15 A;  4MGZ E;  3DA1 A;  4WUR A;  4DV0 M;  1OFI A;  2I7N A;  2XH9 A;  3W0L B;  1L8Q A;  4LFB M;  3LVV A;  4I4L A;  4LRS A;  4IJF A;  1NHW C;  2R65 A;  4FCT A;  2XGN A;  1L2C A;  1DGF A;  2HCB A;  4M9X A;  2D7H A;  3QWL A;  3PVS A;  1GLN A;  2YR0 A;  4MGK E;  1IBL M;  2DXI A;  4IBK A;  2XFS A;  2KZU A;  3SFZ A;  2BNK A;  3U6M A;  3AOE C;  4PCZ A;  5IRE B;  3TWL A;  3GO8 A;  4JI5 M;  2X49 A;  3WHL A;  2CV1 A;  3FTC A;  4LZJ A;  3EIE A;  1QAN A;  3GQ3 A;  1L1Z A;  4B7G A;  1NNU C;  2R18 A;  4X66 M;  5A2Q S;  2XZF A;  4GHA A;  1J7K A;  3GRY A;  5IWA M;  3SBJ A;  5F3W A;  3KOZ E;  4NXM M;  1TH2 A;  5KPZ A;  1G59 A;  1GKI A;  3E9S A;  2D7E A;  3LMM A;  4AW4 A;  3GLG B;  4NRV A;  4DR2 M;  1R2Z A;  4BLC A;  5JI2 E;  5KPR A;  3HJQ A;  3L28 A;  3C58 A;  1IXR C;  3GLH B;  2X4A A;  3HHY A;  3JR4 A;  3K8Z A;  4LJ6 A;  4PDI A;  2UXB M;  1N33 M;  3B9P A;  3EIH A;  3GQ5 A;  3FUV A;  2D7G A;  4LZZ A;  4GH9 A;  3GPU A;  3UK6 A;  1DO2 A;  4QNM A;  4K0K M;  3M0E A;  3AL0 C;  4R7G A;  2YQZ A;  5KQ8 A;  5LMN M;  1IXZ A;  2XF3 A;  3U6P A;  3UZU A;  4NOO B;  2AHM A;  1FNN A;  3HU2 A;  3ZC7 B;  2LNH C;  1Z5B A;  3HJ8 A;  3KOY E;  4AG5 A;  2O5R A;  5BR8 M;  4HL4 A;  3GQ4 A;  4DV4 M;  1WXQ A;  2RGO A;  4PT5 A;  3CTW B;  5FTL A;  4LGY A;  2HHH M;  2ERC A;  3FUW A;  1XWI A;  4L4U A;  4REZ A;  2VII A;  3PNY A;  2UUB M;  3SMS A;  4S12 A;  1K3X A;  4B3S M;  2BJV A;  3A45 A;  4PDG A;  2E5L M;  3L29 A;  4D80 A;  3KW6 A;  2QBY B;  4QNR A;  3T1H M;  4IBF A;  2CHV A;  4AKH A;  3GLF B;  5KO3 A;  4BBA A;  1SXJ C;  4RF0 A;  4G4R A;  4FWD A;  2L6O A;  1IN7 A;  4P16 A;  3K1J A;  4L16 A;  3RGS A;  3AV0 A;  4GIP A;  4B3M M;  3GLH A;  4KOD A;  4RNA A;  4GHL A;  2Y20 A;  1QAM A;  1HT2 E;  4DV7 M;  3TQS A;  3KOW E;  1QYR A;  3K2L A;  1S3S A;  2DZN B;  3IG8 A;  5E6J A;  3VLF B;  1R6B X;  3GRR A;  3DOA A;  5H37 D;  1DGB A;  4DUY M;  3QAU A;  5EP2 A;  2NQ8 C;  1VDD A;  5ITQ A;  1ZAE A;  4KHP M;  1IN8 A;  4YHH M;  1NY6 A;  2G8L A;  4DV6 M;  4IIW A;  2DHR A;  4G4O A;  5FTM A;  2Y21 A;  3U6Q A;  4G4Q A;  4B7F A;  2CFO A;  1YSY A;  3AFH A;  3GRU A;  3FYD A;  1N78 A;  5EXP A;  4DV2 M;  2KA6 B;  1W5T A;  4MGI E;  2ZAO A;  3U61 B;  1IN5 A;  3I51 A;  1G3I A;  2QBY A;  2Z4R A;  3ILK A;  3U6E A;  2CE7 A;  4LF4 M;  2C99 A;  2XSZ A;  2CV2 A;  2KRK A;  1T3T A;  1Z6T A;  2F5Q A;  4QHS A;  1IN6 A;  4MGH A;  1TDH A;  3HJS A;  4GKJ M;  3UMM A;  4TUW A;  1KFV A;  3M6A A;  2F5O A;  2M60 A;  5DYG A;  2DWL A;  5KPT A;  5JI3 E;  1UM8 A;  3HHW A;  1Z59 A;  5DNY A;  2KRU A;  2RKO A;  4LG2 A;  1MU5 A;  2UXC M;  2DVW B;  4JI0 M;  4CGY B;  2CEA A;  4FCW A;  4FW9 A;  4JI7 M;  4GMQ A;  1L1T A;  1OFH A;  5IZ7 D;  4LFC M;  3SAW A;  4CHT B;  2W82 A;  3E4R A;  3AKZ A;  4GIT A;  1HNX M;  4QOZ C;  4KLN A;  1DGH A;  1SXJ E;  1PJI A;  2L7I A;  1X37 A;  3W0F A;  5EP1 A;  4IBI A;  4ITQ A;  4NSO B;  4DV5 M;  1N32 M;  3SAV A;  5ITU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...