2KEBA

Nmr solution structure of the n-terminal domain of the dna polymerase alpha p68 subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
MSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELIAFCTSTHKVGLTSEILNSFEHEFLSKRLSKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit alpha B
publication title Structure of a DNA polymerase alpha-primase domain that docks on the SV40 helicase and activates the viral primosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 19
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.530 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kebA00
2KEBA
chains in the Genus database with same CATH superfamily
4KT0F 1CUKA 1VG5A 2LTUA 1XXHB 3M0EA 1A5TA 5L8RF 3GQ4A 2FE8A 1GJTA 2CUZA 3C9PA 3H4MA 2G8LA 2DVWB 5ITTA 3J7AS 5GKNA 1D0LA 2AHMA 4DV0M 4I8OA 3U6MA 1E9RA 4LRSA 1YLAA 4IBJA 3TWKA 1NY6A 4GC9A 2LBCA 2FNAA 1OFIA 1L1ZA 1W5SA 1PJQA 5KPRA 3D8BA 3T15A 4LF6M 5EP4A 1OTRA 3HHYA 3PXGA 3SFZA 2F4VM 3EIHA 3PFIA 1IN8A 1OAIA 3GLHA 3SARA 4OX9M 1MX0A 4X66M 3FUVA 3H4JA 4GC5A 4LF8M 3KDSE 3GLIB 1FNNA 1QDRA 1E9SA 2LXEA 2CV2A 4P16A 2XEPA 3J27B 2RGHA 1XNRM 3KFUG 3K9OA 3K1JA 4LGMA 2JZ0A 3C3DA 4M9SA 4MM3B 1WIVA 2QQ8A 1TDHA 4KODA 2P5TA 1IQPA 3MMPA 4AG5A 1R6BX 3ZQJA 3FTEA 3U6PA 2EA0A 3U5ZA 1FJGM 3I4YA 1ZMVA 1XB2B 1IM2A 3K92A 1NHGC 1HNWM 3FTFA 3C58A 2VIIA 4FWDA 1DO0A 1SXJE 5JI2E 2GNOA 3VDUA 1Z5CA 4LJ5A 3HHXA 2LNHC 4XBOA 5IT9S 4M9ZA 3RE8A 4I4LA 2VF8A 4DR6M 4II7A 1DGHA 2L09A 4LFBM 2J7NA 2V1CA 2DWZB 2LVAA 2UUAM 1XWIA 1Z5BA 1E32A 2HAKA 2R46A 2Y20A 4DV5M 1Y8GA 3LMMA 3U61B 4B3MM 2DI0A 5EP2A 4DV3M 3AL0C 1ORYB 2DZOB 1IY2A 1WHCA 3HKPA 3HU3A 3NWLA 3Q8GA 4D82A 4JI4M 4JI1M 3FRHA 4I81A 1DV0A 1OKSA 4IJFA 1JR3D 2V6ZM 3U6CA 2QP9X 1NJGA 3M7GA 1Q02A 1IN4A 4L78A 2DENA 4G4QA 1TH2A 1PJTA 1NHWC 2MROB 3A45A 2VQEM 5F3WA 1F4IA 1EE8A 2LVQD 3QYBA 4PD2A 1IN7A 1N75A 4G3OA 1VEJA 2CRUA 3KOZE 3KOYE 2XZUA 4L15A 1XMQM 1ZQ9A 2Z4RA 4REZA 2M60A 2WZJA 1L8QA 4LF9M 4KO8A 1LTMA 1YUBA 4LGYA 1J7KA 1H6UA 1IN6A 1R2YA 1L2BA 5DYIA 3EIEA 4GEWA 2MGWA 3I04M 3ZH9B 3U6OA 2LH0A 2KZSA 3PNVA 4M9XA 2KNAA 2OPFA 3GLGB 3GRRA 2B3TA 2DHYA 3GLFE 2HWJA 1WR1B 3MJ5A 3TWLA 2R4EA 1G41A 3FKEA 2D7HA 1HT1E 1D0KA 2C96A 2YQZA 2G3QA 4LF5M 3J80S 1R5LA 5EQTA 7CATA 2R18A 3IECA 2KHHA 1HJPA 3GP1A 1N33M 4IJEA 4B3SM 4NRVA 3UJNA 4LJ7A 8CATA 2XGNA 1XC8A 2XFTA 4ANRA 4LJ9A 4QOZC 1AUAA 1GABA 4WP2A 3HWSA 4W5WA 1PM5A 1SXJB 1L2CA 3SASA 3OTOM 1IFYA 4JN6A 1K82A 1VEGA 1Z5AA 1I94M 2X49A 3B9PA 2L4FA 2XSZD 3LCVB 4S12A 3CF6E 3IHPA 1G8PA 2R65A 4CGYB 1BVSA 2QENA 4IBBA 1QZMA 1R4GA 2L7IA 3I4VA 2OOAA 4KLNA 4LJ8A 4OVZA 3FRIA 3ZC7B 4PDIA 3FUWA 1E94E 3U60A 1K3WA 2HKJA 2QSFX 4LJAA 4R7GA 1J09A 3PVSA 2UXDM 2Y21A 1N78A 3MK6A 1R2ZA 1V92A 1DGHB 3VK8A 2LVNC 3SBJA 3BBZA 3AV0A 4HEOA 4MGZE 3SYKA 4JI7M 1TH4A 1WGNA 3K8ZA 2FOIC 3NBIA 2O5RA 3GO8A 1S3SA 4A3VB 2E5LM 4F2LA 3TWMA 4AKGA 4GHAA 3CF2A 1MJGM 5KPTA 3J2PB 2UUBM 4CJ6A 4CISA 4KHPM 4GITA 1WJ7A 4PCZA 3LQRA 1SXJD 3DZDA 2VQFM 4K0KM 4MGIE 4PDGA 2DAKA 1QVRA 5C18A 4JI6M 1DGFA 3VKGA 2Z3XA 2QHOB 3T38A 1UM8A 2UXBM 2BWBA 4L16A 2I7PA 2UXCM 3FTCA 4LJ4A 2EUCA 2XSZA 2UUCM 3GLFB 3K2LA 1T43A 3AOGA 3UGJA 4AKHA 5DFLA 1TTEA 2KEBA 2KNVA 2KRUA 1IY1A 2Y0QA 5C1BA 3GLHE 1PJJA 5FTNA 2I7NA 4GIPA 3HJ8A 1OAOC 3SAVA 3GPPA 2R62A 3RGPA 2C98A 4DR2M 4F1IA 4QOSA 3SATA 3U6DA 3FTDA 4FVMA 1ZV1A 1QZEA 1WXQA 2ERCA 4D81A 3ILKA 2DAIA 2O01F 2KZUA 3U6QA 1OJLA 3B7QA 2D7GA 4PT5A 4WW0A 2R0IA 2XH9A 3A46A 4DR7M 4L8RC 3LVVA 3AOEC 3W0FA 4WURA 5BPVA 5EXPA 3LCUA 5FTKA 1QAOA 1Q3CA 2EKKA 1HQCA 5DYGA 3TL4X 1QUSA 2QBYB 2KRKA 3E4RA 2J5YA 1AIPC 4XGIA 1SXJC 3K9PA 3KXEC 1QQWA 1DO2A 2XLJA 3GQ3A 1ZAEA 1LV7A 3NBXX 2JUJA 4RF0A 1IXSB 4B7GA 4FD2A 4Z6YA 4M0WA 1NY5A 2VDBB 4AKIA 3HGIA 3HJSA 4QHTA 2DWMA 2R45A 4X62M 3W67A 2BJWA 1TR8A 2FFJA 2KDLA 1XHBA 4BB9A 2EKFA 3HJQA 3GRVA 2L6OA 3KP1E 1GLNA 1PGYA 2Z7JA 3RFWA 2XF3A 2BNKA 3GLGA 2JNHA 1XXHA 5E6JA 4LF7M 4RF1A 3D8LA 4NSRA 3JR4A 1HR0M 2CHGA 1C7YA 1V34A 2L7HA 1C1KA 2K0BX 2QCUA 3LW5F 3SYLA 2ZAOA 2RRUA 5KPZA 1PJIA 1IBMM 1HT2E 2H1RA 1P3QQ 2ZANA 5KQDA 3E9SA 3FYDA 4FCWA 4DV7M 3KS4A 2L2DA 3L27A 3SMSA 3HU2A 5KQ8A 4GKJM 2CHQA 5FTMA 3TE6A 2LVOC 1L2DA 3U6EA 2OOBA 1HNZM 1EIJA 5ITUA 4YHHM 1G4AE 1OFHA 1GL7A 4EIWA 3AKZA 1K3XA 1Z59A 5ITXA 1KFVA 3W0LB 3GRYA 3UK6A 2F5OA 1I4WA 4DR1M 2FS1A 5EXTA 4GH9A 1ZMWA 2HCBA 3LQQA 2LWXA 3GLIA 3SAWA 3BOSA 3KW6A 4NL4H 3GLHB 5ITQA 2MJ5B 2D7EA 2ZAMA 4CIZA 1JR3A 2V1UA 2JY7A 2XFSA 4OW0A 1HNXM 4NSOB 4LF4M 2QZ4A 2DZLA 2WSEF 4QHSA 4BLCA 3JR5A 1GKIA 4JV5M 2KA6B 4MH0E 4R3DA 1UFZA 4AW4A 1NVMA 2Q2EB 3DFZA 2ZTCA 2C5RA 2CV0A 1N32M 2EJSA 2R44A 4NOOB 2KNZA 5LMUM 4TUWA 3U5ZB 1R7RA 3GPYA 1QAMA 4NC6A 4Y28F 2G5GX 3IG5A 3TPZA 4CHTB 2F5NA 3FUXA 3R8FA 4IBEA 1VDLA 4RNAA 2LHCA 4YY3M 1XMOM 4LG2A 1TH3A 3AFHA 1GVNA 3FYCA 4IBIA 1T3TA 4JXJA 3U61A 4G6ZA 4NXNM 1WGLA 4AI6A 1RU3A 1T6OA 3FUTA 4DV6M 3HHZA 4Z8XA 2UU9M 2DKLA 4DV4M 2DAGA 5E26A 3T6PA 3I01M 4UN2B 1V33A 3GRUA 1IN5A 1TGUA 1KYIA 4IBGA 1G71A 4P17A 5EJCA 5EXSA 3THGA 1IBKM 1OIZA 1PJSA 2VF7A 3WHKA 2DXIA 2R4JA 1L1TA 3SMPA 4JYAM 4HL4A 5FSWA 1NV9A 3L26A 1JQJC 1KSFX 5IZ7D 4G4RA 4LZZA 1NV8A 5DNYA 1ZMUA 4L4UA 3QWLA 4FW9A 1MU5A 1QUTA 2K47A 3KSXA 1G59A 1JB0F 4LZJA 4DUZM 3A42A 4B7HA 5ITRA 1TDZA 3DA1A 4L6V6 1J5EM 2KXEA 4IBCA 5FTJA 2JZ1A 2JY5A 3C3EA 4JI8M 3QYEA 2CP8A 2F5SA 3B74A 4LY6A 2CE7A 2JP7A 4B7FA 4RKUF 5EXXA 4DR3M 4GRIA 3VDPA 5A2QS 3KVWA 2XZFA 2Z8YM 1N34M 4DUYM 3HZJA 1NNUC 4MGHA 4AG6A 1X37A 1YSYA 2DWLA 2BJVA 3AOEA 2ZTDA 5BR8M 5IREB 5IWAM 4GHLA 1Z6TA 5EP1A 5KO3A 4ITQA 2YFQA 3WHLA 3CTWB 3KP0E 2ZBKB 4G4NA 2HL7A 3IG8A 4FCVA 3KOWE 4IBFA 1SXJA 4G4OA 3GQ5A 3DOAA 3VKHA 2X4AA 2ZM6M 3FD9A 1Q3BA 1TF0B 3VFDA 3B7NA 3KS8A 4MGKE 3M6AA 1GO5A 4FWHA 2RGOA 4B3TM 4LCBA 3U6SA 1D0MA 1N77A 1SG9A 2DNAA 3T1HM 3R9XB 2JWSA 5H37D 1NSFA 2L4EA 2WSFF 4OVZB 2W82A 1IXRC 1OIPA 4QNMA 1PRBA 1NO1A 3U60B 2OQ4A 3E46A 2J7OA 2C9OA 4JI2M 1QYRA 3HY5A 1OQYA 2OO9A 1MN3A 1IBLM 2DAEA 2A5YB 3J7BA 3T1YM 4B3RM 4JI5M 1NNJA 5FTLA 2K9DA 4NXMM 4JI3M 3RGSA 5ITYA 2DAMA 2FH0A 1DGGA 1QAQA 3GLGE 1GJSA 3HU1A 3V76A 2JY8A 4BBAA 5FLXS 1XXHE 1VDDA 1N36M 4AZFA 2DHRA 1W5TA 3SC3A 2C99A 2CFOA 1NJFA 3KSJA 2Z4SA 2YNMD 4LJ6A 2CHVA 2DZNB 2F5QA 4IIWA 5JI3E 2O25A 3LVWA 3W68A 4NRWA 3SHGB 4R71A 3L28A 1VQ1A 2X8AA 1YE9A 3UMMA 4AQYM 4IBDA 1QDTA 4HLQA 3GLFA 2DWNA 2GQFA 4QNRA 4XK8F 4ZPXA 3ZCBB 4IBKA 1HQYE 3L2AA 1VEKA 1IY0A 3HX3A 3I51A 5ITXE 3J81S 3JAMS 4MGYE 2F5PA 2N35A 2NQ8C 4GMQA 2K6BA 2JY6B 3E21A 3L29A 3VLFB 3GLIE 4D80A 4DV1M 2M5ZA 3B7ZA 2LVPC 2CWBA 2CV1A 3KOXE 1JR3E 3F92A 3PNYA 2WSCF 4X65M 4X64M 4Q7JA 1DGBA 4DR4M 4I5SA 3FUUA 3GPUA 4FCTA 2KW0A 2H5XA 1IXZA 3Q8XA 2BWEA 5LMNM 5EP3A 2MR9A 4FWGA 4DV2M 2YR0A 4LRTA 2JXNA 4DR5M 2CEAA 4GKKM 2APLA 4MB7A 1XNQM 3SAUA 3L25A 2JA2A 1D2NA 2C9CA 1EFUB 2RKOA 2QBYA 1QANA 3MHVC 2QNJA 3B89A 3HHWA 3A98B 4OU7A 4M0DA 3TQSA 2EO2A 2QPAA 3BXWA 1IXSA 2MH8A 3U6LA 3FE3A 2HHHM 2R6FA 4LFCM 4B08A 3SHFA 4DBGB 3UZUA 3AJIB 3CF0A 2LHGA 4LFAM 1GL6A 3VK7A 1Q39A 3CGWA 3GPXA 1G3IA 4JI0M 3QAUA 2Y0TA
chains in the Genus database with same CATH topology
1XXHB 3M0EA 3GQ4A 2FE8A 2CUZA 3H4MA 2G8LA 2DVWB 5ITTA 3J7AS 5GKNA 2AHMA 4DV0M 4I8OA 3U6MA 1E9RA 4LRSA 4IBJA 3TWKA 1NY6A 4GC9A 2FNAA 1OFIA 1L1ZA 1W5SA 5KPRA 3D8BA 3T15A 4LF6M 5EP4A 3PXGA 3HHYA 3SFZA 2F4VM 3EIHA 3PFIA 1IN8A 3GLHA 3SARA 4OX9M 1MX0A 4X66M 3FUVA 4GC5A 4LF8M 3KDSE 3GLIB 1FNNA 1E9SA 2LXEA 2CV2A 4P16A 2XEPA 3J27B 2RGHA 1XNRM 3KFUG 3K1JA 4LGMA 4MM3B 4M9SA 1TDHA 4KODA 2P5TA 1IQPA 4AG5A 1R6BX 3FTEA 3U6PA 2EA0A 3U5ZA 1FJGM 3I4YA 1IM2A 3K92A 1NHGC 1HNWM 3FTFA 3C58A 2VIIA 4FWDA 1DO0A 1SXJE 5JI2E 3VDUA 1Z5CA 4LJ5A 3HHXA 2LNHC 4XBOA 5IT9S 4M9ZA 3RE8A 4I4LA 4DR6M 4II7A 1DGHA 2L09A 4LFBM 2J7NA 2V1CA 2DWZB 2UUAM 1XWIA 1Z5BA 1E32A 2R46A 2Y20A 4DV5M 3LMMA 4B3MM 3U61B 4DV3M 3AL0C 1ORYB 2DZOB 1IY2A 3HKPA 3HU3A 4JI4M 3NWLA 4JI1M 4D82A 4I81A 4IJFA 1JR3D 2V6ZM 3U6CA 2QP9X 1NJGA 3M7GA 1IN4A 4L78A 4G4QA 1TH2A 1NHWC 2VQEM 3A45A 5F3WA 1EE8A 4PD2A 1IN7A 1N75A 3KOZE 2XZUA 3KOYE 4L15A 1XMQM 1ZQ9A 2Z4RA 4REZA 2M60A 1L8QA 4LF9M 4KO8A 1YUBA 4LGYA 1J7KA 1H6UA 1IN6A 1R2YA 1L2BA 5DYIA 3EIEA 3ZH9B 3U6OA 2KZSA 2LH0A 3PNVA 4M9XA 2OPFA 3GLGB 3GRRA 3MJ5A 3TWLA 2R4EA 1G41A 3FKEA 2D7HA 1HT1E 2C96A 2YQZA 4LF5M 3J80S 5EQTA 7CATA 2R18A 3GP1A 1N33M 4IJEA 4B3SM 4NRVA 3UJNA 4LJ7A 8CATA 2XGNA 1XC8A 2XFTA 4LJ9A 4QOZC 3HWSA 4W5WA 1PM5A 1SXJB 1L2CA 3SASA 3OTOM 4JN6A 1K82A 1Z5AA 1I94M 2X49A 3B9PA 2XSZD 4S12A 4CGYB 3CF6E 1G8PA 2R65A 2QENA 4IBBA 5EP2A 1QZMA 2L7IA 3I4VA 4LJ8A 4OVZA 4KLNA 3ZC7B 4PDIA 3FUWA 1E94E 3U60A 1K3WA 2HKJA 4LJAA 4R7GA 1J09A 3PVSA 2UXDM 2Y21A 1N78A 3MK6A 1R2ZA 1DGHB 3VK8A 3SBJA 3AV0A 4MGZE 3SYKA 4JI7M 1TH4A 3K8ZA 2FOIC 3NBIA 2O5RA 3GO8A 1S3SA 4A3VB 2E5LM 3TWMA 4AKGA 4GHAA 3CF2A 5KPTA 3J2PB 2UUBM 4CISA 4KHPM 4GITA 4PCZA 3LQRA 1SXJD 3DZDA 2VQFM 4K0KM 4MGIE 4PDGA 1QVRA 5C18A 4JI6M 1DGFA 3VKGA 2Z3XA 3T38A 1UM8A 2UXBM 4L16A 2I7PA 2UXCM 3FTCA 4LJ4A 2EUCA 2XSZA 2UUCM 3GLFB 3K2LA 3AOGA 3UGJA 4AKHA 2KEBA 2KRUA 1IY1A 2Y0QA 5C1BA 1PJJA 5FTNA 2I7NA 4GIPA 3HJ8A 3SAVA 3GPPA 2R62A 3RGPA 2C98A 4DR2M 4QOSA 3SATA 3U6DA 3FTDA 4FVMA 1WXQA 2ERCA 4D81A 3ILKA 2KZUA 3U6QA 1OJLA 4PT5A 2D7GA 4WW0A 3A46A 2XH9A 4DR7M 4L8RC 3LVVA 3AOEC 3W0FA 4WURA 5BPVA 5EXPA 5FTKA 1QAOA 1Q3CA 1HQCA 5DYGA 3TL4X 2QBYB 2KRKA 3E4RA 4XGIA 1SXJC 3KXEC 2XLJA 1QQWA 1DO2A 3GQ3A 1ZAEA 1LV7A 4RF0A 1IXSB 4B7GA 4FD2A 4Z6YA 4M0WA 1NY5A 4AKIA 3HGIA 3HJSA 4QHTA 2DWMA 2R45A 4X62M 2BJWA 2FFJA 1XHBA 4BB9A 3HJQA 3GRVA 2L6OA 3KP1E 1GLNA 2Z7JA 3RFWA 3GLGA 2XF3A 2BNKA 1XXHA 5E6JA 4LF7M 4RF1A 3D8LA 4NSRA 3JR4A 1HR0M 2CHGA 2L7HA 1C1KA 2QCUA 3SYLA 5KPZA 1PJIA 2ZAOA 1IBMM 1HT2E 2H1RA 2ZANA 5KQDA 3E9SA 3FYDA 4FCWA 4DV7M 3KS4A 3L27A 3SMSA 3HU2A 5KQ8A 4GKJM 2CHQA 5FTMA 3TE6A 1L2DA 1HNZM 3U6EA 5ITUA 4YHHM 1G4AE 1OFHA 1GL7A 4EIWA 3AKZA 1K3XA 1Z59A 5ITXA 1KFVA 3W0LB 3GRYA 3UK6A 2F5OA 1I4WA 4DR1M 5EXTA 4GH9A 2HCBA 3LQQA 2LWXA 3GLIA 3SAWA 3BOSA 3KW6A 4NL4H 3GLHB 5ITQA 2ZAMA 2D7EA 1JR3A 2V1UA 2XFSA 4OW0A 1HNXM 4NSOB 4LF4M 2QZ4A 4QHSA 4BLCA 3JR5A 1GKIA 4JV5M 2KA6B 4MH0E 4R3DA 4AW4A 2C5RA 1NVMA 2Q2EB 3DFZA 2CV0A 1N32M 4NOOB 5LMUM 4TUWA 3U5ZB 1R7RA 3GPYA 1QAMA 3TPZA 2F5NA 2G5GX 3IG5A 4CHTB 3FUXA 3R8FA 4IBEA 4RNAA 4YY3M 1XMOM 4LG2A 1TH3A 3AFHA 1GVNA 3FYCA 4IBIA 1T3TA 4JXJA 3U61A 4G6ZA 4NXNM 4AI6A 3FUTA 4DV6M 3HHZA 4Z8XA 2UU9M 4DV4M 5E26A 3GRUA 1IN5A 1TGUA 1KYIA 4IBGA 5EXSA 1IBKM 5EJCA 3THGA 3WHKA 2DXIA 2R4JA 1L1TA 3SMPA 4JYAM 4HL4A 5FSWA 3L26A 1JQJC 1KSFX 5IZ7D 4G4RA 4LZZA 5DNYA 4L4UA 3QWLA 4FW9A 1MU5A 2K47A 3KSXA 1G59A 4LZJA 4DUZM 3A42A 4B7HA 5ITRA 1TDZA 3DA1A 1J5EM 2KXEA 4IBCA 5FTJA 4JI8M 2F5SA 4LY6A 2CE7A 4B7FA 5EXXA 4DR3M 4GRIA 3VDPA 5A2QS 3KVWA 2XZFA 1N34M 4DUYM 1NNUC 4MGHA 4AG6A 1X37A 1YSYA 2DWLA 3AOEA 2BJVA 5BR8M 4GHLA 5IREB 5IWAM 1Z6TA 5EP1A 5KO3A 4ITQA 2YFQA 3WHLA 3CTWB 3KP0E 2ZBKB 4G4NA 2HL7A 3IG8A 4FCVA 3KOWE 4IBFA 1SXJA 4G4OA 3GQ5A 3DOAA 3VKHA 2X4AA 2ZM6M 3FD9A 1Q3BA 3VFDA 3KS8A 4MGKE 3M6AA 4FWHA 2RGOA 4B3TM 4LCBA 3U6SA 1N77A 3R9XB 3T1HM 5H37D 1NSFA 4OVZB 2W82A 1IXRC 4QNMA 3U60B 4JI2M 2OQ4A 2J7OA 2C9OA 1QYRA 1IBLM 3T1YM 2A5YB 3J7BA 4B3RM 4JI5M 1NNJA 5FTLA 4NXMM 4JI3M 3RGSA 5ITYA 1DGGA 1QAQA 3HU1A 4BBAA 1N36M 5FLXS 1VDDA 4AZFA 2DHRA 1W5TA 3SC3A 2C99A 2CFOA 1NJFA 3KSJA 2Z4SA 2YNMD 4LJ6A 2CHVA 2DZNB 2F5QA 4IIWA 5JI3E 3LVWA 4NRWA 3SHGB 3L28A 2X8AA 1YE9A 3UMMA 4AQYM 4IBDA 4HLQA 3GLFA 2DWNA 4QNRA 4ZPXA 3ZCBB 4IBKA 1HQYE 3L2AA 1IY0A 3J81S 3I51A 5ITXE 3JAMS 4MGYE 2F5PA 2NQ8C 4GMQA 3L29A 3VLFB 4D80A 4DV1M 2M5ZA 2CV1A 3KOXE 3PNYA 4X65M 4X64M 1DGBA 4DR4M 4I5SA 3FUUA 3GPUA 4FCTA 2KW0A 1IXZA 3Q8XA 5LMNM 5EP3A 4FWGA 4DV2M 2YR0A 4LRTA 4DR5M 2CEAA 4GKKM 4MB7A 1XNQM 3SAUA 3L25A 2JA2A 1D2NA 2C9CA 2RKOA 2QBYA 1QANA 3MHVC 3HHWA 3A98B 4OU7A 4M0DA 3TQSA 2EO2A 2QPAA 3U6LA 2HHHM 4LFCM 4B08A 3SHFA 3UZUA 3AJIB 3CF0A 4LFAM 3VK7A 1GL6A 1Q39A 3GPXA 1G3IA 4JI0M 3QAUA 2Y0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEB A; 
#chains in the Genus database with same CATH topology
 4KT0 F;  1CUK A;  1VG5 A;  2LTU A;  1XXH B;  3M0E A;  1A5T A;  5L8R F;  3GQ4 A;  2FE8 A;  1GJT A;  2CUZ A;  3C9P A;  3H4M A;  2G8L A;  2DVW B;  5ITT A;  3J7A S;  5GKN A;  1D0L A;  2AHM A;  4DV0 M;  4I8O A;  3U6M A;  1E9R A;  4LRS A;  1YLA A;  4IBJ A;  3TWK A;  1NY6 A;  4GC9 A;  2LBC A;  2FNA A;  1OFI A;  1L1Z A;  1W5S A;  1PJQ A;  5KPR A;  3D8B A;  3T15 A;  4LF6 M;  5EP4 A;  1OTR A;  3HHY A;  3PXG A;  3SFZ A;  2F4V M;  3EIH A;  3PFI A;  1IN8 A;  1OAI A;  3GLH A;  3SAR A;  4OX9 M;  1MX0 A;  4X66 M;  3FUV A;  3H4J A;  4GC5 A;  4LF8 M;  3KDS E;  3GLI B;  1FNN A;  1QDR A;  1E9S A;  2LXE A;  2CV2 A;  4P16 A;  2XEP A;  3J27 B;  2RGH A;  1XNR M;  3KFU G;  3K9O A;  3K1J A;  4LGM A;  2JZ0 A;  3C3D A;  4M9S A;  4MM3 B;  1WIV A;  2QQ8 A;  1TDH A;  4KOD A;  2P5T A;  1IQP A;  3MMP A;  4AG5 A;  1R6B X;  3ZQJ A;  3FTE A;  3U6P A;  2EA0 A;  3U5Z A;  1FJG M;  3I4Y A;  1ZMV A;  1XB2 B;  1IM2 A;  3K92 A;  1NHG C;  1HNW M;  3FTF A;  3C58 A;  2VII A;  4FWD A;  1DO0 A;  1SXJ E;  5JI2 E;  2GNO A;  3VDU A;  1Z5C A;  4LJ5 A;  3HHX A;  2LNH C;  4XBO A;  5IT9 S;  4M9Z A;  3RE8 A;  4I4L A;  2VF8 A;  4DR6 M;  4II7 A;  1DGH A;  2L09 A;  4LFB M;  2J7N A;  2V1C A;  2DWZ B;  2LVA A;  2UUA M;  1XWI A;  1Z5B A;  1E32 A;  2HAK A;  2R46 A;  2Y20 A;  4DV5 M;  1Y8G A;  3LMM A;  3U61 B;  4B3M M;  2DI0 A;  5EP2 A;  4DV3 M;  3AL0 C;  1ORY B;  2DZO B;  1IY2 A;  1WHC A;  3HKP A;  3HU3 A;  3NWL A;  3Q8G A;  4D82 A;  4JI4 M;  4JI1 M;  3FRH A;  4I81 A;  1DV0 A;  1OKS A;  4IJF A;  1JR3 D;  2V6Z M;  3U6C A;  2QP9 X;  1NJG A;  3M7G A;  1Q02 A;  1IN4 A;  4L78 A;  2DEN A;  4G4Q A;  1TH2 A;  1PJT A;  1NHW C;  2MRO B;  3A45 A;  2VQE M;  5F3W A;  1F4I A;  1EE8 A;  2LVQ D;  3QYB A;  4PD2 A;  1IN7 A;  1N75 A;  4G3O A;  1VEJ A;  2CRU A;  3KOZ E;  3KOY E;  2XZU A;  4L15 A;  1XMQ M;  1ZQ9 A;  2Z4R A;  4REZ A;  2M60 A;  2WZJ A;  1L8Q A;  4LF9 M;  4KO8 A;  1LTM A;  1YUB A;  4LGY A;  1J7K A;  1H6U A;  1IN6 A;  1R2Y A;  1L2B A;  5DYI A;  3EIE A;  4GEW A;  2MGW A;  3I04 M;  3ZH9 B;  3U6O A;  2LH0 A;  2KZS A;  3PNV A;  4M9X A;  2KNA A;  2OPF A;  3GLG B;  3GRR A;  2B3T A;  2DHY A;  3GLF E;  2HWJ A;  1WR1 B;  3MJ5 A;  3TWL A;  2R4E A;  1G41 A;  3FKE A;  2D7H A;  1HT1 E;  1D0K A;  2C96 A;  2YQZ A;  2G3Q A;  4LF5 M;  3J80 S;  1R5L A;  5EQT A;  7CAT A;  2R18 A;  3IEC A;  2KHH A;  1HJP A;  3GP1 A;  1N33 M;  4IJE A;  4B3S M;  4NRV A;  3UJN A;  4LJ7 A;  8CAT A;  2XGN A;  1XC8 A;  2XFT A;  4ANR A;  4LJ9 A;  4QOZ C;  1AUA A;  1GAB A;  4WP2 A;  3HWS A;  4W5W A;  1PM5 A;  1SXJ B;  1L2C A;  3SAS A;  3OTO M;  1IFY A;  4JN6 A;  1K82 A;  1VEG A;  1Z5A A;  1I94 M;  2X49 A;  3B9P A;  2L4F A;  2XSZ D;  3LCV B;  4S12 A;  3CF6 E;  3IHP A;  1G8P A;  2R65 A;  4CGY B;  1BVS A;  2QEN A;  4IBB A;  1QZM A;  1R4G A;  2L7I A;  3I4V A;  2OOA A;  4KLN A;  4LJ8 A;  4OVZ A;  3FRI A;  3ZC7 B;  4PDI A;  3FUW A;  1E94 E;  3U60 A;  1K3W A;  2HKJ A;  2QSF X;  4LJA A;  4R7G A;  1J09 A;  3PVS A;  2UXD M;  2Y21 A;  1N78 A;  3MK6 A;  1R2Z A;  1V92 A;  1DGH B;  3VK8 A;  2LVN C;  3SBJ A;  3BBZ A;  3AV0 A;  4HEO A;  4MGZ E;  3SYK A;  4JI7 M;  1TH4 A;  1WGN A;  3K8Z A;  2FOI C;  3NBI A;  2O5R A;  3GO8 A;  1S3S A;  4A3V B;  2E5L M;  4F2L A;  3TWM A;  4AKG A;  4GHA A;  3CF2 A;  1MJG M;  5KPT A;  3J2P B;  2UUB M;  4CJ6 A;  4CIS A;  4KHP M;  4GIT A;  1WJ7 A;  4PCZ A;  3LQR A;  1SXJ D;  3DZD A;  2VQF M;  4K0K M;  4MGI E;  4PDG A;  2DAK A;  1QVR A;  5C18 A;  4JI6 M;  1DGF A;  3VKG A;  2Z3X A;  2QHO B;  3T38 A;  1UM8 A;  2UXB M;  2BWB A;  4L16 A;  2I7P A;  2UXC M;  3FTC A;  4LJ4 A;  2EUC A;  2XSZ A;  2UUC M;  3GLF B;  3K2L A;  1T43 A;  3AOG A;  3UGJ A;  4AKH A;  5DFL A;  1TTE A;  2KEB A;  2KNV A;  2KRU A;  1IY1 A;  2Y0Q A;  5C1B A;  3GLH E;  1PJJ A;  5FTN A;  2I7N A;  4GIP A;  3HJ8 A;  1OAO C;  3SAV A;  3GPP A;  2R62 A;  3RGP A;  2C98 A;  4DR2 M;  4F1I A;  4QOS A;  3SAT A;  3U6D A;  3FTD A;  4FVM A;  1ZV1 A;  1QZE A;  1WXQ A;  2ERC A;  4D81 A;  3ILK A;  2DAI A;  2O01 F;  2KZU A;  3U6Q A;  1OJL A;  3B7Q A;  2D7G A;  4PT5 A;  4WW0 A;  2R0I A;  2XH9 A;  3A46 A;  4DR7 M;  4L8R C;  3LVV A;  3AOE C;  3W0F A;  4WUR A;  5BPV A;  5EXP A;  3LCU A;  5FTK A;  1QAO A;  1Q3C A;  2EKK A;  1HQC A;  5DYG A;  3TL4 X;  1QUS A;  2QBY B;  2KRK A;  3E4R A;  2J5Y A;  1AIP C;  4XGI A;  1SXJ C;  3K9P A;  3KXE C;  1QQW A;  1DO2 A;  2XLJ A;  3GQ3 A;  1ZAE A;  1LV7 A;  3NBX X;  2JUJ A;  4RF0 A;  1IXS B;  4B7G A;  4FD2 A;  4Z6Y A;  4M0W A;  1NY5 A;  2VDB B;  4AKI A;  3HGI A;  3HJS A;  4QHT A;  2DWM A;  2R45 A;  4X62 M;  3W67 A;  2BJW A;  1TR8 A;  2FFJ A;  2KDL A;  1XHB A;  4BB9 A;  2EKF A;  3HJQ A;  3GRV A;  2L6O A;  3KP1 E;  1GLN A;  1PGY A;  2Z7J A;  3RFW A;  2XF3 A;  2BNK A;  3GLG A;  2JNH A;  1XXH A;  5E6J A;  4LF7 M;  4RF1 A;  3D8L A;  4NSR A;  3JR4 A;  1HR0 M;  2CHG A;  1C7Y A;  1V34 A;  2L7H A;  1C1K A;  2K0B X;  2QCU A;  3LW5 F;  3SYL A;  2ZAO A;  2RRU A;  5KPZ A;  1PJI A;  1IBM M;  1HT2 E;  2H1R A;  1P3Q Q;  2ZAN A;  5KQD A;  3E9S A;  3FYD A;  4FCW A;  4DV7 M;  3KS4 A;  2L2D A;  3L27 A;  3SMS A;  3HU2 A;  5KQ8 A;  4GKJ M;  2CHQ A;  5FTM A;  3TE6 A;  2LVO C;  1L2D A;  3U6E A;  2OOB A;  1HNZ M;  1EIJ A;  5ITU A;  4YHH M;  1G4A E;  1OFH A;  1GL7 A;  4EIW A;  3AKZ A;  1K3X A;  1Z59 A;  5ITX A;  1KFV A;  3W0L B;  3GRY A;  3UK6 A;  2F5O A;  1I4W A;  4DR1 M;  2FS1 A;  5EXT A;  4GH9 A;  1ZMW A;  2HCB A;  3LQQ A;  2LWX A;  3GLI A;  3SAW A;  3BOS A;  3KW6 A;  4NL4 H;  3GLH B;  5ITQ A;  2MJ5 B;  2D7E A;  2ZAM A;  4CIZ A;  1JR3 A;  2V1U A;  2JY7 A;  2XFS A;  4OW0 A;  1HNX M;  4NSO B;  4LF4 M;  2QZ4 A;  2DZL A;  2WSE F;  4QHS A;  4BLC A;  3JR5 A;  1GKI A;  4JV5 M;  2KA6 B;  4MH0 E;  4R3D A;  1UFZ A;  4AW4 A;  1NVM A;  2Q2E B;  3DFZ A;  2ZTC A;  2C5R A;  2CV0 A;  1N32 M;  2EJS A;  2R44 A;  4NOO B;  2KNZ A;  5LMU M;  4TUW A;  3U5Z B;  1R7R A;  3GPY A;  1QAM A;  4NC6 A;  4Y28 F;  2G5G X;  3IG5 A;  3TPZ A;  4CHT B;  2F5N A;  3FUX A;  3R8F A;  4IBE A;  1VDL A;  4RNA A;  2LHC A;  4YY3 M;  1XMO M;  4LG2 A;  1TH3 A;  3AFH A;  1GVN A;  3FYC A;  4IBI A;  1T3T A;  4JXJ A;  3U61 A;  4G6Z A;  4NXN M;  1WGL A;  4AI6 A;  1RU3 A;  1T6O A;  3FUT A;  4DV6 M;  3HHZ A;  4Z8X A;  2UU9 M;  2DKL A;  4DV4 M;  2DAG A;  5E26 A;  3T6P A;  3I01 M;  4UN2 B;  1V33 A;  3GRU A;  1IN5 A;  1TGU A;  1KYI A;  4IBG A;  1G71 A;  4P17 A;  5EJC A;  5EXS A;  3THG A;  1IBK M;  1OIZ A;  1PJS A;  2VF7 A;  3WHK A;  2DXI A;  2R4J A;  1L1T A;  3SMP A;  4JYA M;  4HL4 A;  5FSW A;  1NV9 A;  3L26 A;  1JQJ C;  1KSF X;  5IZ7 D;  4G4R A;  4LZZ A;  1NV8 A;  5DNY A;  1ZMU A;  4L4U A;  3QWL A;  4FW9 A;  1MU5 A;  1QUT A;  2K47 A;  3KSX A;  1G59 A;  1JB0 F;  4LZJ A;  4DUZ M;  3A42 A;  4B7H A;  5ITR A;  1TDZ A;  3DA1 A;  4L6V 6;  1J5E M;  2KXE A;  4IBC A;  5FTJ A;  2JZ1 A;  2JY5 A;  3C3E A;  4JI8 M;  3QYE A;  2CP8 A;  2F5S A;  3B74 A;  4LY6 A;  2CE7 A;  2JP7 A;  4B7F A;  4RKU F;  5EXX A;  4DR3 M;  4GRI A;  3VDP A;  5A2Q S;  3KVW A;  2XZF A;  2Z8Y M;  1N34 M;  4DUY M;  3HZJ A;  1NNU C;  4MGH A;  4AG6 A;  1X37 A;  1YSY A;  2DWL A;  2BJV A;  3AOE A;  2ZTD A;  5BR8 M;  5IRE B;  5IWA M;  4GHL A;  1Z6T A;  5EP1 A;  5KO3 A;  4ITQ A;  2YFQ A;  3WHL A;  3CTW B;  3KP0 E;  2ZBK B;  4G4N A;  2HL7 A;  3IG8 A;  4FCV A;  3KOW E;  4IBF A;  1SXJ A;  4G4O A;  3GQ5 A;  3DOA A;  3VKH A;  2X4A A;  2ZM6 M;  3FD9 A;  1Q3B A;  1TF0 B;  3VFD A;  3B7N A;  3KS8 A;  4MGK E;  3M6A A;  1GO5 A;  4FWH A;  2RGO A;  4B3T M;  4LCB A;  3U6S A;  1D0M A;  1N77 A;  1SG9 A;  2DNA A;  3T1H M;  3R9X B;  2JWS A;  5H37 D;  1NSF A;  2L4E A;  2WSF F;  4OVZ B;  2W82 A;  1IXR C;  1OIP A;  4QNM A;  1PRB A;  1NO1 A;  3U60 B;  2OQ4 A;  3E46 A;  2J7O A;  2C9O A;  4JI2 M;  1QYR A;  3HY5 A;  1OQY A;  2OO9 A;  1MN3 A;  1IBL M;  2DAE A;  2A5Y B;  3J7B A;  3T1Y M;  4B3R M;  4JI5 M;  1NNJ A;  5FTL A;  2K9D A;  4NXM M;  4JI3 M;  3RGS A;  5ITY A;  2DAM A;  2FH0 A;  1DGG A;  1QAQ A;  3GLG E;  1GJS A;  3HU1 A;  3V76 A;  2JY8 A;  4BBA A;  5FLX S;  1XXH E;  1VDD A;  1N36 M;  4AZF A;  2DHR A;  1W5T A;  3SC3 A;  2C99 A;  2CFO A;  1NJF A;  3KSJ A;  2Z4S A;  2YNM D;  4LJ6 A;  2CHV A;  2DZN B;  2F5Q A;  4IIW A;  5JI3 E;  2O25 A;  3LVW A;  3W68 A;  4NRW A;  3SHG B;  4R71 A;  3L28 A;  1VQ1 A;  2X8A A;  1YE9 A;  3UMM A;  4AQY M;  4IBD A;  1QDT A;  4HLQ A;  3GLF A;  2DWN A;  2GQF A;  4QNR A;  4XK8 F;  4ZPX A;  3ZCB B;  4IBK A;  1HQY E;  3L2A A;  1VEK A;  1IY0 A;  3HX3 A;  3I51 A;  5ITX E;  3J81 S;  3JAM S;  4MGY E;  2F5P A;  2N35 A;  2NQ8 C;  4GMQ A;  2K6B A;  2JY6 B;  3E21 A;  3L29 A;  3VLF B;  3GLI E;  4D80 A;  4DV1 M;  2M5Z A;  3B7Z A;  2LVP C;  2CWB A;  2CV1 A;  3KOX E;  1JR3 E;  3F92 A;  3PNY A;  2WSC F;  4X65 M;  4X64 M;  4Q7J A;  1DGB A;  4DR4 M;  4I5S A;  3FUU A;  3GPU A;  4FCT A;  2KW0 A;  2H5X A;  1IXZ A;  3Q8X A;  2BWE A;  5LMN M;  5EP3 A;  2MR9 A;  4FWG A;  4DV2 M;  2YR0 A;  4LRT A;  2JXN A;  4DR5 M;  2CEA A;  4GKK M;  2APL A;  4MB7 A;  1XNQ M;  3SAU A;  3L25 A;  2JA2 A;  1D2N A;  2C9C A;  1EFU B;  2RKO A;  2QBY A;  1QAN A;  3MHV C;  2QNJ A;  3B89 A;  3HHW A;  3A98 B;  4OU7 A;  4M0D A;  3TQS A;  2EO2 A;  2QPA A;  3BXW A;  1IXS A;  2MH8 A;  3U6L A;  3FE3 A;  2HHH M;  2R6F A;  4LFC M;  4B08 A;  3SHF A;  4DBG B;  3UZU A;  3AJI B;  3CF0 A;  2LHG A;  4LFA M;  1GL6 A;  3VK7 A;  1Q39 A;  3CGW A;  3GPX A;  1G3I A;  4JI0 M;  3QAU A;  2Y0T A; 
#chains in the Genus database with same CATH homology
 1XXH B;  3M0E A;  3GQ4 A;  2FE8 A;  2CUZ A;  3H4M A;  2G8L A;  2DVW B;  5ITT A;  3J7A S;  5GKN A;  2AHM A;  4DV0 M;  4I8O A;  3U6M A;  1E9R A;  4LRS A;  4IBJ A;  3TWK A;  1NY6 A;  4GC9 A;  2FNA A;  1OFI A;  1L1Z A;  1W5S A;  5KPR A;  3D8B A;  3T15 A;  4LF6 M;  5EP4 A;  3PXG A;  3HHY A;  3SFZ A;  2F4V M;  3EIH A;  3PFI A;  1IN8 A;  3GLH A;  3SAR A;  4OX9 M;  1MX0 A;  4X66 M;  3FUV A;  4GC5 A;  4LF8 M;  3KDS E;  3GLI B;  1FNN A;  1E9S A;  2LXE A;  2CV2 A;  4P16 A;  2XEP A;  3J27 B;  2RGH A;  1XNR M;  3KFU G;  3K1J A;  4LGM A;  4MM3 B;  4M9S A;  1TDH A;  4KOD A;  2P5T A;  1IQP A;  4AG5 A;  1R6B X;  3FTE A;  3U6P A;  2EA0 A;  3U5Z A;  1FJG M;  3I4Y A;  1IM2 A;  3K92 A;  1NHG C;  1HNW M;  3FTF A;  3C58 A;  2VII A;  4FWD A;  1DO0 A;  1SXJ E;  5JI2 E;  3VDU A;  1Z5C A;  4LJ5 A;  3HHX A;  2LNH C;  4XBO A;  5IT9 S;  4M9Z A;  3RE8 A;  4I4L A;  4DR6 M;  4II7 A;  1DGH A;  2L09 A;  4LFB M;  2J7N A;  2V1C A;  2DWZ B;  2UUA M;  1XWI A;  1Z5B A;  1E32 A;  2R46 A;  2Y20 A;  4DV5 M;  3LMM A;  4B3M M;  3U61 B;  4DV3 M;  3AL0 C;  1ORY B;  2DZO B;  1IY2 A;  3HKP A;  3HU3 A;  4JI4 M;  3NWL A;  4JI1 M;  4D82 A;  4I81 A;  4IJF A;  1JR3 D;  2V6Z M;  3U6C A;  2QP9 X;  1NJG A;  3M7G A;  1IN4 A;  4L78 A;  4G4Q A;  1TH2 A;  1NHW C;  2VQE M;  3A45 A;  5F3W A;  1EE8 A;  4PD2 A;  1IN7 A;  1N75 A;  3KOZ E;  2XZU A;  3KOY E;  4L15 A;  1XMQ M;  1ZQ9 A;  2Z4R A;  4REZ A;  2M60 A;  1L8Q A;  4LF9 M;  4KO8 A;  1YUB A;  4LGY A;  1J7K A;  1H6U A;  1IN6 A;  1R2Y A;  1L2B A;  5DYI A;  3EIE A;  3ZH9 B;  3U6O A;  2KZS A;  2LH0 A;  3PNV A;  4M9X A;  2OPF A;  3GLG B;  3GRR A;  3MJ5 A;  3TWL A;  2R4E A;  1G41 A;  3FKE A;  2D7H A;  1HT1 E;  2C96 A;  2YQZ A;  4LF5 M;  3J80 S;  5EQT A;  7CAT A;  2R18 A;  3GP1 A;  1N33 M;  4IJE A;  4B3S M;  4NRV A;  3UJN A;  4LJ7 A;  8CAT A;  2XGN A;  1XC8 A;  2XFT A;  4LJ9 A;  4QOZ C;  3HWS A;  4W5W A;  1PM5 A;  1SXJ B;  1L2C A;  3SAS A;  3OTO M;  4JN6 A;  1K82 A;  1Z5A A;  1I94 M;  2X49 A;  3B9P A;  2XSZ D;  4S12 A;  4CGY B;  3CF6 E;  1G8P A;  2R65 A;  2QEN A;  4IBB A;  5EP2 A;  1QZM A;  2L7I A;  3I4V A;  4LJ8 A;  4OVZ A;  4KLN A;  3ZC7 B;  4PDI A;  3FUW A;  1E94 E;  3U60 A;  1K3W A;  2HKJ A;  4LJA A;  4R7G A;  1J09 A;  3PVS A;  2UXD M;  2Y21 A;  1N78 A;  3MK6 A;  1R2Z A;  1DGH B;  3VK8 A;  3SBJ A;  3AV0 A;  4MGZ E;  3SYK A;  4JI7 M;  1TH4 A;  3K8Z A;  2FOI C;  3NBI A;  2O5R A;  3GO8 A;  1S3S A;  4A3V B;  2E5L M;  3TWM A;  4AKG A;  4GHA A;  3CF2 A;  5KPT A;  3J2P B;  2UUB M;  4CIS A;  4KHP M;  4GIT A;  4PCZ A;  3LQR A;  1SXJ D;  3DZD A;  2VQF M;  4K0K M;  4MGI E;  4PDG A;  1QVR A;  5C18 A;  4JI6 M;  1DGF A;  3VKG A;  2Z3X A;  3T38 A;  1UM8 A;  2UXB M;  4L16 A;  2I7P A;  2UXC M;  3FTC A;  4LJ4 A;  2EUC A;  2XSZ A;  2UUC M;  3GLF B;  3K2L A;  3AOG A;  3UGJ A;  4AKH A;  2KEB A;  2KRU A;  1IY1 A;  2Y0Q A;  5C1B A;  1PJJ A;  5FTN A;  2I7N A;  4GIP A;  3HJ8 A;  3SAV A;  3GPP A;  2R62 A;  3RGP A;  2C98 A;  4DR2 M;  4QOS A;  3SAT A;  3U6D A;  3FTD A;  4FVM A;  1WXQ A;  2ERC A;  4D81 A;  3ILK A;  2KZU A;  3U6Q A;  1OJL A;  4PT5 A;  2D7G A;  4WW0 A;  3A46 A;  2XH9 A;  4DR7 M;  4L8R C;  3LVV A;  3AOE C;  3W0F A;  4WUR A;  5BPV A;  5EXP A;  5FTK A;  1QAO A;  1Q3C A;  1HQC A;  5DYG A;  3TL4 X;  2QBY B;  2KRK A;  3E4R A;  4XGI A;  1SXJ C;  3KXE C;  2XLJ A;  1QQW A;  1DO2 A;  3GQ3 A;  1ZAE A;  1LV7 A;  4RF0 A;  1IXS B;  4B7G A;  4FD2 A;  4Z6Y A;  4M0W A;  1NY5 A;  4AKI A;  3HGI A;  3HJS A;  4QHT A;  2DWM A;  2R45 A;  4X62 M;  2BJW A;  2FFJ A;  1XHB A;  4BB9 A;  3HJQ A;  3GRV A;  2L6O A;  3KP1 E;  1GLN A;  2Z7J A;  3RFW A;  3GLG A;  2XF3 A;  2BNK A;  1XXH A;  5E6J A;  4LF7 M;  4RF1 A;  3D8L A;  4NSR A;  3JR4 A;  1HR0 M;  2CHG A;  2L7H A;  1C1K A;  2QCU A;  3SYL A;  5KPZ A;  1PJI A;  2ZAO A;  1IBM M;  1HT2 E;  2H1R A;  2ZAN A;  5KQD A;  3E9S A;  3FYD A;  4FCW A;  4DV7 M;  3KS4 A;  3L27 A;  3SMS A;  3HU2 A;  5KQ8 A;  4GKJ M;  2CHQ A;  5FTM A;  3TE6 A;  1L2D A;  1HNZ M;  3U6E A;  5ITU A;  4YHH M;  1G4A E;  1OFH A;  1GL7 A;  4EIW A;  3AKZ A;  1K3X A;  1Z59 A;  5ITX A;  1KFV A;  3W0L B;  3GRY A;  3UK6 A;  2F5O A;  1I4W A;  4DR1 M;  5EXT A;  4GH9 A;  2HCB A;  3LQQ A;  2LWX A;  3GLI A;  3SAW A;  3BOS A;  3KW6 A;  4NL4 H;  3GLH B;  5ITQ A;  2ZAM A;  2D7E A;  1JR3 A;  2V1U A;  2XFS A;  4OW0 A;  1HNX M;  4NSO B;  4LF4 M;  2QZ4 A;  4QHS A;  4BLC A;  3JR5 A;  1GKI A;  4JV5 M;  2KA6 B;  4MH0 E;  4R3D A;  4AW4 A;  2C5R A;  1NVM A;  2Q2E B;  3DFZ A;  2CV0 A;  1N32 M;  4NOO B;  5LMU M;  4TUW A;  3U5Z B;  1R7R A;  3GPY A;  1QAM A;  3TPZ A;  2F5N A;  2G5G X;  3IG5 A;  4CHT B;  3FUX A;  3R8F A;  4IBE A;  4RNA A;  4YY3 M;  1XMO M;  4LG2 A;  1TH3 A;  3AFH A;  1GVN A;  3FYC A;  4IBI A;  1T3T A;  4JXJ A;  3U61 A;  4G6Z A;  4NXN M;  4AI6 A;  3FUT A;  4DV6 M;  3HHZ A;  4Z8X A;  2UU9 M;  4DV4 M;  5E26 A;  3GRU A;  1IN5 A;  1TGU A;  1KYI A;  4IBG A;  5EXS A;  1IBK M;  5EJC A;  3THG A;  3WHK A;  2DXI A;  2R4J A;  1L1T A;  3SMP A;  4JYA M;  4HL4 A;  5FSW A;  3L26 A;  1JQJ C;  1KSF X;  5IZ7 D;  4G4R A;  4LZZ A;  5DNY A;  4L4U A;  3QWL A;  4FW9 A;  1MU5 A;  2K47 A;  3KSX A;  1G59 A;  4LZJ A;  4DUZ M;  3A42 A;  4B7H A;  5ITR A;  1TDZ A;  3DA1 A;  1J5E M;  2KXE A;  4IBC A;  5FTJ A;  4JI8 M;  2F5S A;  4LY6 A;  2CE7 A;  4B7F A;  5EXX A;  4DR3 M;  4GRI A;  3VDP A;  5A2Q S;  3KVW A;  2XZF A;  1N34 M;  4DUY M;  1NNU C;  4MGH A;  4AG6 A;  1X37 A;  1YSY A;  2DWL A;  3AOE A;  2BJV A;  5BR8 M;  4GHL A;  5IRE B;  5IWA M;  1Z6T A;  5EP1 A;  5KO3 A;  4ITQ A;  2YFQ A;  3WHL A;  3CTW B;  3KP0 E;  2ZBK B;  4G4N A;  2HL7 A;  3IG8 A;  4FCV A;  3KOW E;  4IBF A;  1SXJ A;  4G4O A;  3GQ5 A;  3DOA A;  3VKH A;  2X4A A;  2ZM6 M;  3FD9 A;  1Q3B A;  3VFD A;  3KS8 A;  4MGK E;  3M6A A;  4FWH A;  2RGO A;  4B3T M;  4LCB A;  3U6S A;  1N77 A;  3R9X B;  3T1H M;  5H37 D;  1NSF A;  4OVZ B;  2W82 A;  1IXR C;  4QNM A;  3U60 B;  4JI2 M;  2OQ4 A;  2J7O A;  2C9O A;  1QYR A;  1IBL M;  3T1Y M;  2A5Y B;  3J7B A;  4B3R M;  4JI5 M;  1NNJ A;  5FTL A;  4NXM M;  4JI3 M;  3RGS A;  5ITY A;  1DGG A;  1QAQ A;  3HU1 A;  4BBA A;  1N36 M;  5FLX S;  1VDD A;  4AZF A;  2DHR A;  1W5T A;  3SC3 A;  2C99 A;  2CFO A;  1NJF A;  3KSJ A;  2Z4S A;  2YNM D;  4LJ6 A;  2CHV A;  2DZN B;  2F5Q A;  4IIW A;  5JI3 E;  3LVW A;  4NRW A;  3SHG B;  3L28 A;  2X8A A;  1YE9 A;  3UMM A;  4AQY M;  4IBD A;  4HLQ A;  3GLF A;  2DWN A;  4QNR A;  4ZPX A;  3ZCB B;  4IBK A;  1HQY E;  3L2A A;  1IY0 A;  3J81 S;  3I51 A;  5ITX E;  3JAM S;  4MGY E;  2F5P A;  2NQ8 C;  4GMQ A;  3L29 A;  3VLF B;  4D80 A;  4DV1 M;  2M5Z A;  2CV1 A;  3KOX E;  3PNY A;  4X65 M;  4X64 M;  1DGB A;  4DR4 M;  4I5S A;  3FUU A;  3GPU A;  4FCT A;  2KW0 A;  1IXZ A;  3Q8X A;  5LMN M;  5EP3 A;  4FWG A;  4DV2 M;  2YR0 A;  4LRT A;  4DR5 M;  2CEA A;  4GKK M;  4MB7 A;  1XNQ M;  3SAU A;  3L25 A;  2JA2 A;  1D2N A;  2C9C A;  2RKO A;  2QBY A;  1QAN A;  3MHV C;  3HHW A;  3A98 B;  4OU7 A;  4M0D A;  3TQS A;  2EO2 A;  2QPA A;  3U6L A;  2HHH M;  4LFC M;  4B08 A;  3SHF A;  3UZU A;  3AJI B;  3CF0 A;  4LFA M;  3VK7 A;  1GL6 A;  1Q39 A;  3GPX A;  1G3I A;  4JI0 M;  3QAU A;  2Y0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...