2KEBA

Nmr solution structure of the n-terminal domain of the dna polymerase alpha p68 subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
MSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELIAFCTSTHKVGLTSEILNSFEHEFLSKRLSKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a DNA polymerase alpha-primase domain that docks on the SV40 helicase and activates the viral primosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA polymerase subunit alpha B
total genus 19
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2009-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.530 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kebA00
2KEBA
chains in the Genus database with same CATH superfamily
3HKPA 2CWBA 5EP3A 2LVOC 2UU9M 4HL4A 3SYLA 4B7GA 4FCWA 4OW0A 4LGMA 4D81A 3KSXA 2DWLA 1GL6A 2QNJA 2YR0A 3SBJA 3TPZA 3PFIA 5F3WA 2L2DA 4QHTA 3UK6A 2UUBM 2ZAOA 1TGUA 4GIPA 3CTWB 1L1ZA 1T3TA 3GRYA 3QYBA 3MJ5A 5ITRA 3VK8A 4DV5M 3WHLA 2WSCF 2V6ZM 2KZUA 3D8BA 3C58A 1WJ7A 1OIPA 1QYRA 1IN6A 1N75A 4OVZB 1L2BA 1IN7A 4JN6A 4DUYM 2EO2A 4PDGA 3VDUA 3IHPA 2LVQD 3B7NA 4LRTA 1Z6TA 4IBEA 1HQCA 4M9XA 5KO3A 3UGJA 2LXEA 4DR3M 3HHXA 1N77A 4CISA 3LCVB 1WIVA 5LMNM 3U6CA 2BWBA 3C9PA 1L2DA 2WSEF 4GRIA 3RGSA 2FS1A 4PD2A 4NSRA 1SXJA 2OOBA 2JP7A 2Z7JA 2VIIA 2O25A 2JY6B 4MGZE 3T38A 4CHTB 2XFTA 3U6QA 2CV0A 1GLNA 1XNQM 1MU5A 4DV6M 4R71A 3U60A 5FLXS 2XGNA 1GJSA 1GO5A 2P5TA 1XNRM 1KSFX 2KEBA 3RFWA 2R4EA 5C1BA 1HQYE 3CF0A 1OQYA 1I94M 2DXIA 3VK7A 1K3XA 3SATA 3AOGA 1OAOC 1X37A 2R0IA 4GC9A 4XBOA 2L09A 3HHYA 4DR6M 3B74A 1AIPC 2R65A 3KSJA 3PNVA 1IBLM 4L16A 4D82A 1HR0M 1H6UA 2VF7A 4L4UA 4LJ6A 1XWIA 4IBJA 1DGHB 3T15A 3HZJA 3PXGA 5L8RF 4BB9A 4NRWA 1TH4A 4IBFA 2LVNC 1L1TA 4M0DA 5FTKA 4IBCA 4IBGA 4WURA 4IBKA 5KPTA 4DV4M 2LWXA 1TH2A 4QOSA 4CIZA 1DO0A 2ZAMA 4LG2A 1PJSA 3RGPA 2VDBB 1EFUB 5E26A 1L2CA 1NY5A 3HJSA 1G4AE 5DYIA 3TWMA 2XSZA 1QQWA 1KYIA 1Q02A 1JR3D 5ITXE 4KT0F 3SC3A 1E9SA 3FD9A 1IXZA 4PCZA 4DV0M 2M5ZA 4RKUF 4LJ8A 1I4WA 4L15A 1S3SA 3THGA 3H4MA 3M6AA 2Z4RA 2D7GA 4LF4M 1HNXM 4PDIA 3AOEA 3HJ8A 3ZCBB 3BBZA 5EJCA 1XXHB 2MGWA 3B9PA 3SHGB 2KNZA 2R18A 2K6BA 2C9CA 2LVAA 5FTNA 1AUAA 1SXJC 3GRUA 2UUCM 2XEPA 1XC8A 1N36M 1QAMA 3L25A 2ERCA 2DI0A 4KODA 4LJ7A 2DWMA 1P3QQ 2FH0A 2L7HA 5JI2E 4B3RM 4LJ5A 2MROB 3GLGA 2JNHA 4DV1M 2X8AA 2UXBM 1DGGA 1NHWC 3TQSA 5DNYA 3SMPA 4QNMA 1V33A 3JAMS 1R7RA 4G4QA 3W0FA 4QNRA 4S12A 3U6EA 1R2YA 3FUVA 4GKJM 2APLA 4GITA 3KP0E 1IFYA 3UZUA 1R4GA 4P16A 3I51A 1G41A 1DGFA 2QCUA 4I8OA 4B08A 3IECA 3ILKA 1T6OA 1XMOM 2Z8YM 4NSOB 2XZUA 2DNAA 3OTOM 4JI6M 2DVWB 2G3QA 1V92A 1WGLA 4MGIE 2MR9A 3I01M 1WXQA 1QZMA 1N34M 3GPYA 1UM8A 2R44A 4FWHA 2KXEA 1Y8GA 4B3SM 1SXJD 4Q7JA 1ZMVA 4IIWA 4MGYE 4FCTA 2VQEM 1VQ1A 3E21A 4DR2M 4F2LA 1DO2A 3QAUA 1KFVA 3SYKA 4YY3M 2ZANA 3FUUA 3BOSA 2ZM6M 3CF2A 2L6OA 4X65M 2F5NA 4AI6A 2KRKA 4M9SA 5EQTA 4QHSA 4CGYB 2Y0TA 3A42A 1ZQ9A 4IBDA 2M60A 1N32M 2KDLA 1YE9A 3L29A 2CHQA 4G6ZA 1QUTA 4HEOA 3PNYA 2BNKA 5BPVA 4GKKM 3GLFE 2OPFA 1D0MA 1TDZA 3E9SA 2MJ5B 4D80A 1NV9A 4K0KM 4GHAA 1IY0A 1QVRA 2K47A 1IM2A 3FUTA 5EP1A 2QENA 2L7IA 1YLAA 3MMPA 4LZZA 4MH0E 4B3MM 2FNAA 1NJGA 3K92A 1EE8A 4FCVA 5H37D 4DV7M 2R46A 3HWSA 2B3TA 3K9PA 3GRRA 4L6V6 4DBGB 1J09A 3L26A 5KPZA 5FSWA 1R2ZA 3U6LA 2CUZA 2JZ1A 3FTCA 2CV1A 4LF7M 4JI1M 3E4RA 1Z5AA 3J2PB 4XK8F 3I4YA 4II7A 3W68A 5ITYA 2XH9A 3KW6A 7CATA 2HHHM 4A3VB 3GQ4A 1YSYA 1OIZA 3R8FA 1UFZA 1VG5A 1XB2B 1Q39A 4JXJA 4AW4A 5FTLA 2KRUA 3TWKA 3LW5F 3J81S 2G8LA 5BR8M 4DR4M 4GMQA 4Z6YA 1DV0A 3Q8XA 3B89A 1EIJA 3FE3A 3I4VA 4JV5M 3HU2A 2C9OA 1N33M 2GNOA 2UXCM 4FD2A 5EP2A 2XLJA 1D2NA 2LTUA 2RGOA 1ZMWA 3UJNA 3GPUA 4AKIA 2R6FA 3GLHE 3VFDA 5ITUA 4OU7A 3LCUA 2NQ8C 2ZTDA 1OKSA 1IXRC 3SHFA 4KHPM 2YQZA 3SASA 3KS8A 1PJTA 4EIWA 4JI2M 2C99A 4CJ6A 4JI4M 1HT1E 2L4EA 1JR3A 3L27A 3U61A 3SAVA 2D7EA 2DAGA 3IG8A 4LF9M 1VEGA 4BLCA 1PJIA 2VQFM 3FYCA 3FRIA 5IZ7D 2QP9X 1NO1A 4JI5M 2F4VM 3AKZA 3NBXX 2QBYB 3AV0A 3GLFB 3GRVA 3H4JA 5EXXA 2DAEA 1G8PA 5IT9S 2K9DA 1LTMA 3F92A 2FFJA 2EA0A 2DHRA 3HHZA 4DUZM 3HU3A 1Z5BA 4DR5M 3U6MA 4JYAM 5IREB 3MK6A 2JY5A 1NSFA 1PJQA 1BVSA 2KW0A 2QQ8A 2F5OA 1FJGM 1TTEA 2D7HA 3J7BA 3HGIA 1T43A 3K9OA 2HCBA 3T1YM 5IWAM 2F5SA 2WZJA 2DAMA 2DAIA 3M0EA 3Q8GA 1K3WA 2CV2A 2DZLA 4RF1A 2CE7A 1IXSA 3DZDA 1OJLA 1PRBA 3QYEA 4LFCM 2QHOB 3KP1E 1SG9A 4I5SA 1XHBA 1IN8A 1R5LA 2EUCA 2N35A 5ITQA 1GL7A 3U61B 2L4FA 4G3OA 4REZA 1J5EM 1QANA 3B7ZA 3FTDA 1WGNA 2KA6B 1IQPA 4TUWA 2KNAA 2Y20A 1IY1A 4Z8XA 3JR5A 4AKGA 3WHKA 3T1HM 2YFQA 1WR1B 2G5GX 4X66M 1IBKM 4LZJA 5EP4A 4AQYM 3AL0C 3FYDA 3D8LA 1NJFA 2ZBKB 1QDRA 2JXNA 2R4JA 3NWLA 2A5YB 2H5XA 4B7HA 4LF8M 4FW9A 2JWSA 2LNHC 2R45A 3LVWA 1C1KA 1LV7A 4B7FA 1JQJC 1VDDA 2Z4SA 5FTJA 2LBCA 3TL4X 3GLGE 2RGHA 1NV8A 1ORYB 3FTEA 2V1CA 4YHHM 2BWEA 1NNJA 5FTMA 1DGBA 3SAUA 3VKHA 2J5YA 2UXDM 1TH3A 2QZ4A 1QAOA 3RE8A 4AG6A 4PT5A 4LFAM 5ITXA 2JZ0A 3U6PA 3SARA 3CGWA 2RRUA 1A5TA 3L28A 5DFLA 2YNMD 5A2QS 3HY5A 4NL4H 1NY6A 3GQ3A 1PGYA 2JY8A 4MGHA 5LMUM 1W5TA 3W0LB 2OQ4A 3KOYE 2E5LM 2LHCA 4RF0A 2MH8A 4G4NA 1TF0B 4IJFA 4KLNA 1XMQM 3J7AS 2BJWA 2VF8A 2QPAA 3GLHB 2C96A 3GP1A 3KS4A 3U5ZA 1QZEA 2V1UA 3KVWA 1HNWM 2BJVA 4F1IA 4IJEA 1GJTA 2J7NA 3A98B 1IN5A 3FUWA 3ZH9B 3LMMA 4AZFA 3JR4A 4GEWA 3DFZA 4I81A 3ZQJA 1NNUC 1ZV1A 4MGKE 4R3DA 4LCBA 4M9ZA 1QUSA 1TR8A 2Q2EB 3UMMA 3U6DA 3U60B 3R9XB 1XXHE 8CATA 4X62M 2Y0QA 1L8QA 1GVNA 1Q3CA 4MM3B 1G59A 2KHHA 2R62A 4L8RC 1HJPA 3M7GA 3MHVC 2XF3A 1Q3BA 4NXMM 2K0BX 3K2LA 1HT2E 1W5SA 4LFBM 3T6PA 4HLQA 2CHVA 2JUJA 2EKKA 3TWLA 2EJSA 1NVMA 2HAKA 3GLIE 3SMSA 1ZAEA 3GLIA 4JI3M 5EXSA 2ZTCA 2DWNA 3K8ZA 1CUKA 1G71A 1QDTA 3V76A 2C5RA 4RNAA 4LJ9A 2CRUA 1TDHA 2XFSA 1WHCA 2C98A 3B7QA 1J7KA 4DR1M 1PM5A 4B3TM 3DOAA 4ITQA 3U6OA 3AOEC 3HX3A 4LY6A 1GKIA 5EXPA 4LRSA 4GHLA 1F4IA 2WSFF 4LF6M 2QBYA 2DZOB 2LH0A 4DR7M 3U6SA 1IY2A 2X4AA 3FTFA 4MB7A 1JR3E 1QAQA 4OVZA 2HL7A 4XGIA 1SXJE 3EIEA 2W82A 1E32A 2Y21A 4BBAA 3HHWA 1OFHA 3GPPA 5KQDA 2OO9A 3IG5A 1R6BX 3W67A 4JI7M 2CEAA 1ZMUA 4ANRA 4DV2M 2EKFA 2F5PA 3DA1A 2KZSA 3GPXA 4GC5A 2HKJA 3NBIA 3QWLA 3GO8A 2DZNB 2HWJA 3SFZA 3EIHA 4LJAA 2AHMA 1SXJB 3C3DA 1FNNA 3L2AA 4GH9A 1K82A 4FWDA 4WW0A 2DHYA 3VDPA 2F5QA 3A45A 1V34A 1JB0F 2I7NA 3FKEA 3LVVA 4L78A 3GQ5A 1IBMM 5KQ8A 4OX9M 4IBBA 2O01F 1VEJA 4FVMA 3VLFB 4G4RA 3GLGB 1MX0A 3HJQA 5KPRA 4G4OA 2O5RA 5ITTA 4DV3M 2XSZD 1G3IA 4R7GA 2LHGA 4M0WA 1VDLA 3VKGA 4NC6A 5DYGA 4AG5A 3KOXE 1OFIA 4I4LA 2RKOA 3U5ZB 1VEKA 4AKHA 5GKNA 1MN3A 4KO8A 2XZFA 5EXTA 4X64M 4LF5M 3GLFA 3C3EA 4NRVA 2QSFX 1DGHA 1E9RA 3KXEC 3FRHA 5E6JA 2Z3XA 4NXNM 2OOAA 3PVSA 3K1JA 3KDSE 3BXWA 3I04M 3LQQA 1D0KA 1OTRA 2X49A 1RU3A 3J80S 1C7YA 1NHGC 3AFHA 4LJ4A 3A46A 2UUAM 2DKLA 3ZC7B 3KOWE 3FUXA 4ZPXA 3TE6A 3SAWA 1HNZM 3HU1A 4JI0M 4QOZC 1D0LA 4WP2A 3LQRA 2LVPC 2CFOA 4Y28F 2GQFA 3KOZE 1N78A 1MJGM 1XXHA 1GABA 2DENA 2I7PA 4JI8M 1Z5CA 1E94E 5C18A 3CF6E 2DWZB 2H1RA 1OAIA 4UN2B 3J27B 3E46A 4LGYA 2CP8A 2JA2A 1IXSB 2FE8A 5JI3E 4FWGA 3KFUG 3GLHA 1IN4A 2DAKA 4IBIA 3GLIB 2CHGA 2KNVA 4W5WA 1PJJA 2JY7A 2FOIC 1YUBA 4P17A 2J7OA 4NOOB 1Z59A 3AJIB
chains in the Genus database with same CATH topology
3HKPA 5EP3A 2UU9M 4HL4A 3SYLA 4B7GA 4FCWA 4OW0A 4LGMA 4D81A 3KSXA 2DWLA 1GL6A 2YR0A 3SBJA 3TPZA 3PFIA 5F3WA 4QHTA 3UK6A 2UUBM 2ZAOA 1TGUA 4GIPA 3CTWB 1L1ZA 1T3TA 3GRYA 5ITRA 3MJ5A 3VK8A 4DV5M 3WHLA 2V6ZM 2KZUA 3D8BA 3C58A 4OVZB 1QYRA 1IN6A 1N75A 1L2BA 1IN7A 4JN6A 4DUYM 2EO2A 4PDGA 3VDUA 4LRTA 1Z6TA 4IBEA 1HQCA 4M9XA 5KO3A 3UGJA 2LXEA 4DR3M 3HHXA 1N77A 1Z59A 4CISA 5LMNM 3U6CA 1L2DA 4GRIA 3RGSA 4PD2A 4NSRA 1SXJA 2Z7JA 2VIIA 4MGZE 3T38A 4CHTB 2XFTA 3U6QA 2CV0A 1GLNA 1XNQM 1MU5A 4DV6M 3U60A 5FLXS 2XGNA 2P5TA 1XNRM 1KSFX 2KEBA 3RFWA 2R4EA 5C1BA 1HQYE 3CF0A 1I94M 2DXIA 3SATA 3VK7A 1K3XA 3AOGA 1X37A 4GC9A 4XBOA 2L09A 3HHYA 4DR6M 3PNVA 2R65A 1IBLM 3KSJA 4L16A 4D82A 1HR0M 1H6UA 4L4UA 4LJ6A 1XWIA 4IBJA 1DGHB 3T15A 3PXGA 4BB9A 4NRWA 1TH4A 4IBFA 1L1TA 4M0DA 5FTKA 4IBCA 4IBGA 4WURA 4IBKA 5KPTA 4DV4M 2LWXA 1TH2A 4QOSA 4LG2A 1DO0A 2ZAMA 3RGPA 5E26A 1L2CA 1NY5A 3HJSA 1G4AE 5DYIA 3TWMA 2XSZA 1QQWA 1KYIA 1JR3D 5ITXE 3SC3A 1E9SA 3FD9A 1IXZA 4PCZA 4DV0M 2M5ZA 4LJ8A 1I4WA 4L15A 1S3SA 3THGA 3H4MA 3M6AA 2Z4RA 2D7GA 4LF4M 1HNXM 4PDIA 3AOEA 3HJ8A 3ZCBB 5EJCA 1XXHB 3B9PA 3SHGB 2R18A 2C9CA 5FTNA 2UUCM 1SXJC 3GRUA 2XEPA 1XC8A 1N36M 1QAMA 3L25A 2ERCA 4KODA 4LJ7A 2DWMA 2L7HA 5JI2E 4B3RM 4LJ5A 3GLGA 4DV1M 2X8AA 2UXBM 1DGGA 1NHWC 3TQSA 5DNYA 3SMPA 4QNMA 3JAMS 1R7RA 4G4QA 3W0FA 4QNRA 4S12A 3U6EA 1R2YA 3FUVA 4GKJM 4GITA 3KP0E 3UZUA 4P16A 3I51A 1G41A 1DGFA 2QCUA 4I8OA 4B08A 3ILKA 1XMOM 4NSOB 2XZUA 3OTOM 4JI6M 2DVWB 4MGIE 1WXQA 1QZMA 1N34M 3GPYA 1UM8A 4FWHA 4B3SM 2KXEA 1SXJD 4IIWA 4MGYE 4FCTA 2VQEM 4DR2M 1DO2A 3QAUA 1KFVA 3SYKA 4YY3M 2ZANA 3FUUA 3BOSA 2ZM6M 3CF2A 2L6OA 4X65M 2F5NA 4AI6A 2KRKA 4M9SA 5EQTA 4QHSA 4CGYB 2Y0TA 3A42A 1ZQ9A 4IBDA 2M60A 1N32M 1YE9A 3L29A 2CHQA 4G6ZA 3PNYA 2BNKA 5BPVA 4GKKM 2OPFA 1TDZA 3E9SA 4D80A 4K0KM 4GHAA 1IY0A 1QVRA 2K47A 1IM2A 3FUTA 5EP1A 2QENA 2L7IA 4LZZA 4MH0E 1PJJA 4B3MM 2FNAA 1NJGA 4FCVA 3K92A 1EE8A 5H37D 4DV7M 2R46A 3HWSA 3GRRA 3L26A 1J09A 5KPZA 5FSWA 1R2ZA 3U6LA 2CUZA 3FTCA 2CV1A 4LF7M 4JI1M 3E4RA 1Z5AA 3J2PB 3I4YA 4II7A 5ITYA 2XH9A 3KW6A 7CATA 2HHHM 4A3VB 3GQ4A 1YSYA 3R8FA 1Q39A 4JXJA 4AW4A 5FTLA 2KRUA 3TWKA 3J81S 2G8LA 5BR8M 4DR4M 4GMQA 4Z6YA 3Q8XA 3I4VA 4JV5M 3HU2A 2C9OA 1N33M 2UXCM 4FD2A 5EP2A 2XLJA 1D2NA 2RGOA 3UJNA 3GPUA 4AKIA 4OU7A 3VFDA 5ITUA 2NQ8C 1IXRC 3SHFA 4KHPM 2YQZA 3SASA 3KS8A 4EIWA 4JI2M 2C99A 4JI4M 1HT1E 1JR3A 3L27A 3U61A 3SAVA 2D7EA 3IG8A 4LF9M 4BLCA 1PJIA 2VQFM 3FYCA 5IZ7D 2QP9X 4JI5M 2F4VM 3AKZA 2QBYB 3AV0A 3GLFB 3GRVA 5EXXA 1G8PA 5IT9S 2EA0A 2FFJA 2DHRA 3HHZA 4DUZM 3HU3A 1Z5BA 4DR5M 3U6MA 4JYAM 5IREB 3MK6A 1NSFA 2KW0A 2F5OA 1FJGM 2D7HA 3J7BA 3HGIA 3T1YM 2HCBA 5IWAM 2F5SA 1K3WA 3M0EA 2CV2A 4RF1A 2CE7A 3DZDA 4LFCM 1OJLA 3KP1E 4I5SA 1XHBA 1IN8A 2EUCA 5ITQA 1GL7A 3U61B 4REZA 1J5EM 1QANA 3FTDA 2KA6B 1IQPA 4TUWA 2Y20A 1IY1A 4Z8XA 3JR5A 4AKGA 3WHKA 3T1HM 2YFQA 2G5GX 4X66M 1IBKM 4LZJA 5EP4A 4AQYM 3AL0C 3FYDA 3D8LA 1NJFA 2ZBKB 2R4JA 3NWLA 2A5YB 4B7HA 4LF8M 4FW9A 2LNHC 2R45A 1C1KA 1LV7A 4B7FA 1JQJC 1VDDA 2Z4SA 5FTJA 3TL4X 2RGHA 1ORYB 3FTEA 2V1CA 4YHHM 3VKHA 1NNJA 5FTMA 1DGBA 3SAUA 2UXDM 1TH3A 2QZ4A 1QAOA 3RE8A 4AG6A 4PT5A 4LFAM 5ITXA 3U6PA 3SARA 3L28A 2YNMD 5A2QS 4NL4H 1NY6A 3GQ3A 5LMUM 4MGHA 1W5TA 3W0LB 2OQ4A 3KOYE 2E5LM 4RF0A 4G4NA 4IJFA 4KLNA 1XMQM 3J7AS 2BJWA 3GLHB 2QPAA 2C96A 3GP1A 3KS4A 3U5ZA 2V1UA 1HNWM 3KVWA 2BJVA 4IJEA 2J7NA 3A98B 1IN5A 3FUWA 3ZH9B 3LMMA 4AZFA 3JR4A 3DFZA 4I81A 1NNUC 4MGKE 4R3DA 4LCBA 4M9ZA 3U6DA 2Q2EB 3UMMA 3U60B 3R9XB 8CATA 4X62M 2Y0QA 1L8QA 1GVNA 1Q3CA 4MM3B 1G59A 2R62A 4L8RC 3M7GA 3MHVC 2XF3A 1Q3BA 4NXMM 3K2LA 1HT2E 1W5SA 4LFBM 4HLQA 2CHVA 3TWLA 1NVMA 3SMSA 1ZAEA 3GLIA 4JI3M 5EXSA 2DWNA 3K8ZA 2C5RA 4RNAA 4LJ9A 1PM5A 1TDHA 2XFSA 2C98A 4DR1M 4B3TM 1J7KA 3DOAA 4ITQA 3U6OA 3AOEC 4LY6A 5EXPA 1GKIA 4LRSA 4GHLA 4LF6M 2QBYA 2DZOB 2LH0A 4DR7M 3U6SA 1IY2A 2X4AA 3FTFA 4MB7A 1QAQA 4OVZA 2HL7A 4XGIA 1SXJE 3EIEA 2W82A 1E32A 2Y21A 4BBAA 3HHWA 1OFHA 3GPPA 5KQDA 3IG5A 4JI7M 1R6BX 2CEAA 4DV2M 2F5PA 3DA1A 2KZSA 3GPXA 4GC5A 2HKJA 3NBIA 3QWLA 3GO8A 2DZNB 3SFZA 3EIHA 4LJAA 2AHMA 1SXJB 1FNNA 3L2AA 4GH9A 1K82A 4FWDA 4WW0A 3VDPA 2F5QA 3A45A 3GQ5A 2I7NA 3FKEA 3LVVA 4L78A 1IBMM 5KQ8A 4OX9M 4IBBA 4FVMA 3VLFB 4G4RA 3GLGB 1MX0A 3HJQA 5KPRA 4G4OA 2O5RA 5ITTA 4DV3M 2XSZD 1G3IA 4R7GA 4M0WA 3VKGA 4AG5A 5DYGA 3KOXE 1OFIA 4I4LA 2RKOA 3U5ZB 4AKHA 5GKNA 4KO8A 2XZFA 5EXTA 4X64M 4LF5M 3GLFA 4NRVA 1DGHA 1E9RA 3KXEC 5E6JA 2Z3XA 4NXNM 3PVSA 3K1JA 3KDSE 3LQQA 2X49A 3J80S 2UUAM 1NHGC 3AFHA 4LJ4A 3A46A 3ZC7B 3KOWE 3FUXA 4ZPXA 3TE6A 3SAWA 1HNZM 3HU1A 4JI0M 4QOZC 3LQRA 2CFOA 3KOZE 1N78A 1XXHA 2I7PA 4JI8M 1Z5CA 1E94E 5C18A 3CF6E 2DWZB 2H1RA 3J27B 4LGYA 2JA2A 1IXSB 2FE8A 5JI3E 4FWGA 3KFUG 3GLHA 1IN4A 4IBIA 3GLIB 2CHGA 4W5WA 2FOIC 1YUBA 2J7OA 4NOOB 3LVWA 3AJIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEB A; 
#chains in the Genus database with same CATH topology
 3HKP A;  2CWB A;  5EP3 A;  2LVO C;  2UU9 M;  4HL4 A;  3SYL A;  4B7G A;  4FCW A;  4OW0 A;  4LGM A;  4D81 A;  3KSX A;  2DWL A;  1GL6 A;  2QNJ A;  2YR0 A;  3SBJ A;  3TPZ A;  3PFI A;  5F3W A;  2L2D A;  4QHT A;  3UK6 A;  2UUB M;  2ZAO A;  1TGU A;  4GIP A;  3CTW B;  1L1Z A;  1T3T A;  3GRY A;  3QYB A;  3MJ5 A;  5ITR A;  3VK8 A;  4DV5 M;  3WHL A;  2WSC F;  2V6Z M;  2KZU A;  3D8B A;  3C58 A;  1WJ7 A;  1OIP A;  1QYR A;  1IN6 A;  1N75 A;  4OVZ B;  1L2B A;  1IN7 A;  4JN6 A;  4DUY M;  2EO2 A;  4PDG A;  3VDU A;  3IHP A;  2LVQ D;  3B7N A;  4LRT A;  1Z6T A;  4IBE A;  1HQC A;  4M9X A;  5KO3 A;  3UGJ A;  2LXE A;  4DR3 M;  3HHX A;  1N77 A;  4CIS A;  3LCV B;  1WIV A;  5LMN M;  3U6C A;  2BWB A;  3C9P A;  1L2D A;  2WSE F;  4GRI A;  3RGS A;  2FS1 A;  4PD2 A;  4NSR A;  1SXJ A;  2OOB A;  2JP7 A;  2Z7J A;  2VII A;  2O25 A;  2JY6 B;  4MGZ E;  3T38 A;  4CHT B;  2XFT A;  3U6Q A;  2CV0 A;  1GLN A;  1XNQ M;  1MU5 A;  4DV6 M;  4R71 A;  3U60 A;  5FLX S;  2XGN A;  1GJS A;  1GO5 A;  2P5T A;  1XNR M;  1KSF X;  2KEB A;  3RFW A;  2R4E A;  5C1B A;  1HQY E;  3CF0 A;  1OQY A;  1I94 M;  2DXI A;  3VK7 A;  1K3X A;  3SAT A;  3AOG A;  1OAO C;  1X37 A;  2R0I A;  4GC9 A;  4XBO A;  2L09 A;  3HHY A;  4DR6 M;  3B74 A;  1AIP C;  2R65 A;  3KSJ A;  3PNV A;  1IBL M;  4L16 A;  4D82 A;  1HR0 M;  1H6U A;  2VF7 A;  4L4U A;  4LJ6 A;  1XWI A;  4IBJ A;  1DGH B;  3T15 A;  3HZJ A;  3PXG A;  5L8R F;  4BB9 A;  4NRW A;  1TH4 A;  4IBF A;  2LVN C;  1L1T A;  4M0D A;  5FTK A;  4IBC A;  4IBG A;  4WUR A;  4IBK A;  5KPT A;  4DV4 M;  2LWX A;  1TH2 A;  4QOS A;  4CIZ A;  1DO0 A;  2ZAM A;  4LG2 A;  1PJS A;  3RGP A;  2VDB B;  1EFU B;  5E26 A;  1L2C A;  1NY5 A;  3HJS A;  1G4A E;  5DYI A;  3TWM A;  2XSZ A;  1QQW A;  1KYI A;  1Q02 A;  1JR3 D;  5ITX E;  4KT0 F;  3SC3 A;  1E9S A;  3FD9 A;  1IXZ A;  4PCZ A;  4DV0 M;  2M5Z A;  4RKU F;  4LJ8 A;  1I4W A;  4L15 A;  1S3S A;  3THG A;  3H4M A;  3M6A A;  2Z4R A;  2D7G A;  4LF4 M;  1HNX M;  4PDI A;  3AOE A;  3HJ8 A;  3ZCB B;  3BBZ A;  5EJC A;  1XXH B;  2MGW A;  3B9P A;  3SHG B;  2KNZ A;  2R18 A;  2K6B A;  2C9C A;  2LVA A;  5FTN A;  1AUA A;  1SXJ C;  3GRU A;  2UUC M;  2XEP A;  1XC8 A;  1N36 M;  1QAM A;  3L25 A;  2ERC A;  2DI0 A;  4KOD A;  4LJ7 A;  2DWM A;  1P3Q Q;  2FH0 A;  2L7H A;  5JI2 E;  4B3R M;  4LJ5 A;  2MRO B;  3GLG A;  2JNH A;  4DV1 M;  2X8A A;  2UXB M;  1DGG A;  1NHW C;  3TQS A;  5DNY A;  3SMP A;  4QNM A;  1V33 A;  3JAM S;  1R7R A;  4G4Q A;  3W0F A;  4QNR A;  4S12 A;  3U6E A;  1R2Y A;  3FUV A;  4GKJ M;  2APL A;  4GIT A;  3KP0 E;  1IFY A;  3UZU A;  1R4G A;  4P16 A;  3I51 A;  1G41 A;  1DGF A;  2QCU A;  4I8O A;  4B08 A;  3IEC A;  3ILK A;  1T6O A;  1XMO M;  2Z8Y M;  4NSO B;  2XZU A;  2DNA A;  3OTO M;  4JI6 M;  2DVW B;  2G3Q A;  1V92 A;  1WGL A;  4MGI E;  2MR9 A;  3I01 M;  1WXQ A;  1QZM A;  1N34 M;  3GPY A;  1UM8 A;  2R44 A;  4FWH A;  2KXE A;  1Y8G A;  4B3S M;  1SXJ D;  4Q7J A;  1ZMV A;  4IIW A;  4MGY E;  4FCT A;  2VQE M;  1VQ1 A;  3E21 A;  4DR2 M;  4F2L A;  1DO2 A;  3QAU A;  1KFV A;  3SYK A;  4YY3 M;  2ZAN A;  3FUU A;  3BOS A;  2ZM6 M;  3CF2 A;  2L6O A;  4X65 M;  2F5N A;  4AI6 A;  2KRK A;  4M9S A;  5EQT A;  4QHS A;  4CGY B;  2Y0T A;  3A42 A;  1ZQ9 A;  4IBD A;  2M60 A;  1N32 M;  2KDL A;  1YE9 A;  3L29 A;  2CHQ A;  4G6Z A;  1QUT A;  4HEO A;  3PNY A;  2BNK A;  5BPV A;  4GKK M;  3GLF E;  2OPF A;  1D0M A;  1TDZ A;  3E9S A;  2MJ5 B;  4D80 A;  1NV9 A;  4K0K M;  4GHA A;  1IY0 A;  1QVR A;  2K47 A;  1IM2 A;  3FUT A;  5EP1 A;  2QEN A;  2L7I A;  1YLA A;  3MMP A;  4LZZ A;  4MH0 E;  4B3M M;  2FNA A;  1NJG A;  3K92 A;  1EE8 A;  4FCV A;  5H37 D;  4DV7 M;  2R46 A;  3HWS A;  2B3T A;  3K9P A;  3GRR A;  4L6V 6;  4DBG B;  1J09 A;  3L26 A;  5KPZ A;  5FSW A;  1R2Z A;  3U6L A;  2CUZ A;  2JZ1 A;  3FTC A;  2CV1 A;  4LF7 M;  4JI1 M;  3E4R A;  1Z5A A;  3J2P B;  4XK8 F;  3I4Y A;  4II7 A;  3W68 A;  5ITY A;  2XH9 A;  3KW6 A;  7CAT A;  2HHH M;  4A3V B;  3GQ4 A;  1YSY A;  1OIZ A;  3R8F A;  1UFZ A;  1VG5 A;  1XB2 B;  1Q39 A;  4JXJ A;  4AW4 A;  5FTL A;  2KRU A;  3TWK A;  3LW5 F;  3J81 S;  2G8L A;  5BR8 M;  4DR4 M;  4GMQ A;  4Z6Y A;  1DV0 A;  3Q8X A;  3B89 A;  1EIJ A;  3FE3 A;  3I4V A;  4JV5 M;  3HU2 A;  2C9O A;  1N33 M;  2GNO A;  2UXC M;  4FD2 A;  5EP2 A;  2XLJ A;  1D2N A;  2LTU A;  2RGO A;  1ZMW A;  3UJN A;  3GPU A;  4AKI A;  2R6F A;  3GLH E;  3VFD A;  5ITU A;  4OU7 A;  3LCU A;  2NQ8 C;  2ZTD A;  1OKS A;  1IXR C;  3SHF A;  4KHP M;  2YQZ A;  3SAS A;  3KS8 A;  1PJT A;  4EIW A;  4JI2 M;  2C99 A;  4CJ6 A;  4JI4 M;  1HT1 E;  2L4E A;  1JR3 A;  3L27 A;  3U61 A;  3SAV A;  2D7E A;  2DAG A;  3IG8 A;  4LF9 M;  1VEG A;  4BLC A;  1PJI A;  2VQF M;  3FYC A;  3FRI A;  5IZ7 D;  2QP9 X;  1NO1 A;  4JI5 M;  2F4V M;  3AKZ A;  3NBX X;  2QBY B;  3AV0 A;  3GLF B;  3GRV A;  3H4J A;  5EXX A;  2DAE A;  1G8P A;  5IT9 S;  2K9D A;  1LTM A;  3F92 A;  2FFJ A;  2EA0 A;  2DHR A;  3HHZ A;  4DUZ M;  3HU3 A;  1Z5B A;  4DR5 M;  3U6M A;  4JYA M;  5IRE B;  3MK6 A;  2JY5 A;  1NSF A;  1PJQ A;  1BVS A;  2KW0 A;  2QQ8 A;  2F5O A;  1FJG M;  1TTE A;  2D7H A;  3J7B A;  3HGI A;  1T43 A;  3K9O A;  2HCB A;  3T1Y M;  5IWA M;  2F5S A;  2WZJ A;  2DAM A;  2DAI A;  3M0E A;  3Q8G A;  1K3W A;  2CV2 A;  2DZL A;  4RF1 A;  2CE7 A;  1IXS A;  3DZD A;  1OJL A;  1PRB A;  3QYE A;  4LFC M;  2QHO B;  3KP1 E;  1SG9 A;  4I5S A;  1XHB A;  1IN8 A;  1R5L A;  2EUC A;  2N35 A;  5ITQ A;  1GL7 A;  3U61 B;  2L4F A;  4G3O A;  4REZ A;  1J5E M;  1QAN A;  3B7Z A;  3FTD A;  1WGN A;  2KA6 B;  1IQP A;  4TUW A;  2KNA A;  2Y20 A;  1IY1 A;  4Z8X A;  3JR5 A;  4AKG A;  3WHK A;  3T1H M;  2YFQ A;  1WR1 B;  2G5G X;  4X66 M;  1IBK M;  4LZJ A;  5EP4 A;  4AQY M;  3AL0 C;  3FYD A;  3D8L A;  1NJF A;  2ZBK B;  1QDR A;  2JXN A;  2R4J A;  3NWL A;  2A5Y B;  2H5X A;  4B7H A;  4LF8 M;  4FW9 A;  2JWS A;  2LNH C;  2R45 A;  3LVW A;  1C1K A;  1LV7 A;  4B7F A;  1JQJ C;  1VDD A;  2Z4S A;  5FTJ A;  2LBC A;  3TL4 X;  3GLG E;  2RGH A;  1NV8 A;  1ORY B;  3FTE A;  2V1C A;  4YHH M;  2BWE A;  1NNJ A;  5FTM A;  1DGB A;  3SAU A;  3VKH A;  2J5Y A;  2UXD M;  1TH3 A;  2QZ4 A;  1QAO A;  3RE8 A;  4AG6 A;  4PT5 A;  4LFA M;  5ITX A;  2JZ0 A;  3U6P A;  3SAR A;  3CGW A;  2RRU A;  1A5T A;  3L28 A;  5DFL A;  2YNM D;  5A2Q S;  3HY5 A;  4NL4 H;  1NY6 A;  3GQ3 A;  1PGY A;  2JY8 A;  4MGH A;  5LMU M;  1W5T A;  3W0L B;  2OQ4 A;  3KOY E;  2E5L M;  2LHC A;  4RF0 A;  2MH8 A;  4G4N A;  1TF0 B;  4IJF A;  4KLN A;  1XMQ M;  3J7A S;  2BJW A;  2VF8 A;  2QPA A;  3GLH B;  2C96 A;  3GP1 A;  3KS4 A;  3U5Z A;  1QZE A;  2V1U A;  3KVW A;  1HNW M;  2BJV A;  4F1I A;  4IJE A;  1GJT A;  2J7N A;  3A98 B;  1IN5 A;  3FUW A;  3ZH9 B;  3LMM A;  4AZF A;  3JR4 A;  4GEW A;  3DFZ A;  4I81 A;  3ZQJ A;  1NNU C;  1ZV1 A;  4MGK E;  4R3D A;  4LCB A;  4M9Z A;  1QUS A;  1TR8 A;  2Q2E B;  3UMM A;  3U6D A;  3U60 B;  3R9X B;  1XXH E;  8CAT A;  4X62 M;  2Y0Q A;  1L8Q A;  1GVN A;  1Q3C A;  4MM3 B;  1G59 A;  2KHH A;  2R62 A;  4L8R C;  1HJP A;  3M7G A;  3MHV C;  2XF3 A;  1Q3B A;  4NXM M;  2K0B X;  3K2L A;  1HT2 E;  1W5S A;  4LFB M;  3T6P A;  4HLQ A;  2CHV A;  2JUJ A;  2EKK A;  3TWL A;  2EJS A;  1NVM A;  2HAK A;  3GLI E;  3SMS A;  1ZAE A;  3GLI A;  4JI3 M;  5EXS A;  2ZTC A;  2DWN A;  3K8Z A;  1CUK A;  1G71 A;  1QDT A;  3V76 A;  2C5R A;  4RNA A;  4LJ9 A;  2CRU A;  1TDH A;  2XFS A;  1WHC A;  2C98 A;  3B7Q A;  1J7K A;  4DR1 M;  1PM5 A;  4B3T M;  3DOA A;  4ITQ A;  3U6O A;  3AOE C;  3HX3 A;  4LY6 A;  1GKI A;  5EXP A;  4LRS A;  4GHL A;  1F4I A;  2WSF F;  4LF6 M;  2QBY A;  2DZO B;  2LH0 A;  4DR7 M;  3U6S A;  1IY2 A;  2X4A A;  3FTF A;  4MB7 A;  1JR3 E;  1QAQ A;  4OVZ A;  2HL7 A;  4XGI A;  1SXJ E;  3EIE A;  2W82 A;  1E32 A;  2Y21 A;  4BBA A;  3HHW A;  1OFH A;  3GPP A;  5KQD A;  2OO9 A;  3IG5 A;  1R6B X;  3W67 A;  4JI7 M;  2CEA A;  1ZMU A;  4ANR A;  4DV2 M;  2EKF A;  2F5P A;  3DA1 A;  2KZS A;  3GPX A;  4GC5 A;  2HKJ A;  3NBI A;  3QWL A;  3GO8 A;  2DZN B;  2HWJ A;  3SFZ A;  3EIH A;  4LJA A;  2AHM A;  1SXJ B;  3C3D A;  1FNN A;  3L2A A;  4GH9 A;  1K82 A;  4FWD A;  4WW0 A;  2DHY A;  3VDP A;  2F5Q A;  3A45 A;  1V34 A;  1JB0 F;  2I7N A;  3FKE A;  3LVV A;  4L78 A;  3GQ5 A;  1IBM M;  5KQ8 A;  4OX9 M;  4IBB A;  2O01 F;  1VEJ A;  4FVM A;  3VLF B;  4G4R A;  3GLG B;  1MX0 A;  3HJQ A;  5KPR A;  4G4O A;  2O5R A;  5ITT A;  4DV3 M;  2XSZ D;  1G3I A;  4R7G A;  2LHG A;  4M0W A;  1VDL A;  3VKG A;  4NC6 A;  5DYG A;  4AG5 A;  3KOX E;  1OFI A;  4I4L A;  2RKO A;  3U5Z B;  1VEK A;  4AKH A;  5GKN A;  1MN3 A;  4KO8 A;  2XZF A;  5EXT A;  4X64 M;  4LF5 M;  3GLF A;  3C3E A;  4NRV A;  2QSF X;  1DGH A;  1E9R A;  3KXE C;  3FRH A;  5E6J A;  2Z3X A;  4NXN M;  2OOA A;  3PVS A;  3K1J A;  3KDS E;  3BXW A;  3I04 M;  3LQQ A;  1D0K A;  1OTR A;  2X49 A;  1RU3 A;  3J80 S;  1C7Y A;  1NHG C;  3AFH A;  4LJ4 A;  3A46 A;  2UUA M;  2DKL A;  3ZC7 B;  3KOW E;  3FUX A;  4ZPX A;  3TE6 A;  3SAW A;  1HNZ M;  3HU1 A;  4JI0 M;  4QOZ C;  1D0L A;  4WP2 A;  3LQR A;  2LVP C;  2CFO A;  4Y28 F;  2GQF A;  3KOZ E;  1N78 A;  1MJG M;  1XXH A;  1GAB A;  2DEN A;  2I7P A;  4JI8 M;  1Z5C A;  1E94 E;  5C18 A;  3CF6 E;  2DWZ B;  2H1R A;  1OAI A;  4UN2 B;  3J27 B;  3E46 A;  4LGY A;  2CP8 A;  2JA2 A;  1IXS B;  2FE8 A;  5JI3 E;  4FWG A;  3KFU G;  3GLH A;  1IN4 A;  2DAK A;  4IBI A;  3GLI B;  2CHG A;  2KNV A;  4W5W A;  1PJJ A;  2JY7 A;  2FOI C;  1YUB A;  4P17 A;  2J7O A;  4NOO B;  1Z59 A;  3AJI B; 
#chains in the Genus database with same CATH homology
 3HKP A;  5EP3 A;  2UU9 M;  4HL4 A;  3SYL A;  4B7G A;  4FCW A;  4OW0 A;  4LGM A;  4D81 A;  3KSX A;  2DWL A;  1GL6 A;  2YR0 A;  3SBJ A;  3TPZ A;  3PFI A;  5F3W A;  4QHT A;  3UK6 A;  2UUB M;  2ZAO A;  1TGU A;  4GIP A;  3CTW B;  1L1Z A;  1T3T A;  3GRY A;  5ITR A;  3MJ5 A;  3VK8 A;  4DV5 M;  3WHL A;  2V6Z M;  2KZU A;  3D8B A;  3C58 A;  4OVZ B;  1QYR A;  1IN6 A;  1N75 A;  1L2B A;  1IN7 A;  4JN6 A;  4DUY M;  2EO2 A;  4PDG A;  3VDU A;  4LRT A;  1Z6T A;  4IBE A;  1HQC A;  4M9X A;  5KO3 A;  3UGJ A;  2LXE A;  4DR3 M;  3HHX A;  1N77 A;  1Z59 A;  4CIS A;  5LMN M;  3U6C A;  1L2D A;  4GRI A;  3RGS A;  4PD2 A;  4NSR A;  1SXJ A;  2Z7J A;  2VII A;  4MGZ E;  3T38 A;  4CHT B;  2XFT A;  3U6Q A;  2CV0 A;  1GLN A;  1XNQ M;  1MU5 A;  4DV6 M;  3U60 A;  5FLX S;  2XGN A;  2P5T A;  1XNR M;  1KSF X;  2KEB A;  3RFW A;  2R4E A;  5C1B A;  1HQY E;  3CF0 A;  1I94 M;  2DXI A;  3SAT A;  3VK7 A;  1K3X A;  3AOG A;  1X37 A;  4GC9 A;  4XBO A;  2L09 A;  3HHY A;  4DR6 M;  3PNV A;  2R65 A;  1IBL M;  3KSJ A;  4L16 A;  4D82 A;  1HR0 M;  1H6U A;  4L4U A;  4LJ6 A;  1XWI A;  4IBJ A;  1DGH B;  3T15 A;  3PXG A;  4BB9 A;  4NRW A;  1TH4 A;  4IBF A;  1L1T A;  4M0D A;  5FTK A;  4IBC A;  4IBG A;  4WUR A;  4IBK A;  5KPT A;  4DV4 M;  2LWX A;  1TH2 A;  4QOS A;  4LG2 A;  1DO0 A;  2ZAM A;  3RGP A;  5E26 A;  1L2C A;  1NY5 A;  3HJS A;  1G4A E;  5DYI A;  3TWM A;  2XSZ A;  1QQW A;  1KYI A;  1JR3 D;  5ITX E;  3SC3 A;  1E9S A;  3FD9 A;  1IXZ A;  4PCZ A;  4DV0 M;  2M5Z A;  4LJ8 A;  1I4W A;  4L15 A;  1S3S A;  3THG A;  3H4M A;  3M6A A;  2Z4R A;  2D7G A;  4LF4 M;  1HNX M;  4PDI A;  3AOE A;  3HJ8 A;  3ZCB B;  5EJC A;  1XXH B;  3B9P A;  3SHG B;  2R18 A;  2C9C A;  5FTN A;  2UUC M;  1SXJ C;  3GRU A;  2XEP A;  1XC8 A;  1N36 M;  1QAM A;  3L25 A;  2ERC A;  4KOD A;  4LJ7 A;  2DWM A;  2L7H A;  5JI2 E;  4B3R M;  4LJ5 A;  3GLG A;  4DV1 M;  2X8A A;  2UXB M;  1DGG A;  1NHW C;  3TQS A;  5DNY A;  3SMP A;  4QNM A;  3JAM S;  1R7R A;  4G4Q A;  3W0F A;  4QNR A;  4S12 A;  3U6E A;  1R2Y A;  3FUV A;  4GKJ M;  4GIT A;  3KP0 E;  3UZU A;  4P16 A;  3I51 A;  1G41 A;  1DGF A;  2QCU A;  4I8O A;  4B08 A;  3ILK A;  1XMO M;  4NSO B;  2XZU A;  3OTO M;  4JI6 M;  2DVW B;  4MGI E;  1WXQ A;  1QZM A;  1N34 M;  3GPY A;  1UM8 A;  4FWH A;  4B3S M;  2KXE A;  1SXJ D;  4IIW A;  4MGY E;  4FCT A;  2VQE M;  4DR2 M;  1DO2 A;  3QAU A;  1KFV A;  3SYK A;  4YY3 M;  2ZAN A;  3FUU A;  3BOS A;  2ZM6 M;  3CF2 A;  2L6O A;  4X65 M;  2F5N A;  4AI6 A;  2KRK A;  4M9S A;  5EQT A;  4QHS A;  4CGY B;  2Y0T A;  3A42 A;  1ZQ9 A;  4IBD A;  2M60 A;  1N32 M;  1YE9 A;  3L29 A;  2CHQ A;  4G6Z A;  3PNY A;  2BNK A;  5BPV A;  4GKK M;  2OPF A;  1TDZ A;  3E9S A;  4D80 A;  4K0K M;  4GHA A;  1IY0 A;  1QVR A;  2K47 A;  1IM2 A;  3FUT A;  5EP1 A;  2QEN A;  2L7I A;  4LZZ A;  4MH0 E;  1PJJ A;  4B3M M;  2FNA A;  1NJG A;  4FCV A;  3K92 A;  1EE8 A;  5H37 D;  4DV7 M;  2R46 A;  3HWS A;  3GRR A;  3L26 A;  1J09 A;  5KPZ A;  5FSW A;  1R2Z A;  3U6L A;  2CUZ A;  3FTC A;  2CV1 A;  4LF7 M;  4JI1 M;  3E4R A;  1Z5A A;  3J2P B;  3I4Y A;  4II7 A;  5ITY A;  2XH9 A;  3KW6 A;  7CAT A;  2HHH M;  4A3V B;  3GQ4 A;  1YSY A;  3R8F A;  1Q39 A;  4JXJ A;  4AW4 A;  5FTL A;  2KRU A;  3TWK A;  3J81 S;  2G8L A;  5BR8 M;  4DR4 M;  4GMQ A;  4Z6Y A;  3Q8X A;  3I4V A;  4JV5 M;  3HU2 A;  2C9O A;  1N33 M;  2UXC M;  4FD2 A;  5EP2 A;  2XLJ A;  1D2N A;  2RGO A;  3UJN A;  3GPU A;  4AKI A;  4OU7 A;  3VFD A;  5ITU A;  2NQ8 C;  1IXR C;  3SHF A;  4KHP M;  2YQZ A;  3SAS A;  3KS8 A;  4EIW A;  4JI2 M;  2C99 A;  4JI4 M;  1HT1 E;  1JR3 A;  3L27 A;  3U61 A;  3SAV A;  2D7E A;  3IG8 A;  4LF9 M;  4BLC A;  1PJI A;  2VQF M;  3FYC A;  5IZ7 D;  2QP9 X;  4JI5 M;  2F4V M;  3AKZ A;  2QBY B;  3AV0 A;  3GLF B;  3GRV A;  5EXX A;  1G8P A;  5IT9 S;  2EA0 A;  2FFJ A;  2DHR A;  3HHZ A;  4DUZ M;  3HU3 A;  1Z5B A;  4DR5 M;  3U6M A;  4JYA M;  5IRE B;  3MK6 A;  1NSF A;  2KW0 A;  2F5O A;  1FJG M;  2D7H A;  3J7B A;  3HGI A;  3T1Y M;  2HCB A;  5IWA M;  2F5S A;  1K3W A;  3M0E A;  2CV2 A;  4RF1 A;  2CE7 A;  3DZD A;  4LFC M;  1OJL A;  3KP1 E;  4I5S A;  1XHB A;  1IN8 A;  2EUC A;  5ITQ A;  1GL7 A;  3U61 B;  4REZ A;  1J5E M;  1QAN A;  3FTD A;  2KA6 B;  1IQP A;  4TUW A;  2Y20 A;  1IY1 A;  4Z8X A;  3JR5 A;  4AKG A;  3WHK A;  3T1H M;  2YFQ A;  2G5G X;  4X66 M;  1IBK M;  4LZJ A;  5EP4 A;  4AQY M;  3AL0 C;  3FYD A;  3D8L A;  1NJF A;  2ZBK B;  2R4J A;  3NWL A;  2A5Y B;  4B7H A;  4LF8 M;  4FW9 A;  2LNH C;  2R45 A;  1C1K A;  1LV7 A;  4B7F A;  1JQJ C;  1VDD A;  2Z4S A;  5FTJ A;  3TL4 X;  2RGH A;  1ORY B;  3FTE A;  2V1C A;  4YHH M;  3VKH A;  1NNJ A;  5FTM A;  1DGB A;  3SAU A;  2UXD M;  1TH3 A;  2QZ4 A;  1QAO A;  3RE8 A;  4AG6 A;  4PT5 A;  4LFA M;  5ITX A;  3U6P A;  3SAR A;  3L28 A;  2YNM D;  5A2Q S;  4NL4 H;  1NY6 A;  3GQ3 A;  5LMU M;  4MGH A;  1W5T A;  3W0L B;  2OQ4 A;  3KOY E;  2E5L M;  4RF0 A;  4G4N A;  4IJF A;  4KLN A;  1XMQ M;  3J7A S;  2BJW A;  3GLH B;  2QPA A;  2C96 A;  3GP1 A;  3KS4 A;  3U5Z A;  2V1U A;  1HNW M;  3KVW A;  2BJV A;  4IJE A;  2J7N A;  3A98 B;  1IN5 A;  3FUW A;  3ZH9 B;  3LMM A;  4AZF A;  3JR4 A;  3DFZ A;  4I81 A;  1NNU C;  4MGK E;  4R3D A;  4LCB A;  4M9Z A;  3U6D A;  2Q2E B;  3UMM A;  3U60 B;  3R9X B;  8CAT A;  4X62 M;  2Y0Q A;  1L8Q A;  1GVN A;  1Q3C A;  4MM3 B;  1G59 A;  2R62 A;  4L8R C;  3M7G A;  3MHV C;  2XF3 A;  1Q3B A;  4NXM M;  3K2L A;  1HT2 E;  1W5S A;  4LFB M;  4HLQ A;  2CHV A;  3TWL A;  1NVM A;  3SMS A;  1ZAE A;  3GLI A;  4JI3 M;  5EXS A;  2DWN A;  3K8Z A;  2C5R A;  4RNA A;  4LJ9 A;  1PM5 A;  1TDH A;  2XFS A;  2C98 A;  4DR1 M;  4B3T M;  1J7K A;  3DOA A;  4ITQ A;  3U6O A;  3AOE C;  4LY6 A;  5EXP A;  1GKI A;  4LRS A;  4GHL A;  4LF6 M;  2QBY A;  2DZO B;  2LH0 A;  4DR7 M;  3U6S A;  1IY2 A;  2X4A A;  3FTF A;  4MB7 A;  1QAQ A;  4OVZ A;  2HL7 A;  4XGI A;  1SXJ E;  3EIE A;  2W82 A;  1E32 A;  2Y21 A;  4BBA A;  3HHW A;  1OFH A;  3GPP A;  5KQD A;  3IG5 A;  4JI7 M;  1R6B X;  2CEA A;  4DV2 M;  2F5P A;  3DA1 A;  2KZS A;  3GPX A;  4GC5 A;  2HKJ A;  3NBI A;  3QWL A;  3GO8 A;  2DZN B;  3SFZ A;  3EIH A;  4LJA A;  2AHM A;  1SXJ B;  1FNN A;  3L2A A;  4GH9 A;  1K82 A;  4FWD A;  4WW0 A;  3VDP A;  2F5Q A;  3A45 A;  3GQ5 A;  2I7N A;  3FKE A;  3LVV A;  4L78 A;  1IBM M;  5KQ8 A;  4OX9 M;  4IBB A;  4FVM A;  3VLF B;  4G4R A;  3GLG B;  1MX0 A;  3HJQ A;  5KPR A;  4G4O A;  2O5R A;  5ITT A;  4DV3 M;  2XSZ D;  1G3I A;  4R7G A;  4M0W A;  3VKG A;  4AG5 A;  5DYG A;  3KOX E;  1OFI A;  4I4L A;  2RKO A;  3U5Z B;  4AKH A;  5GKN A;  4KO8 A;  2XZF A;  5EXT A;  4X64 M;  4LF5 M;  3GLF A;  4NRV A;  1DGH A;  1E9R A;  3KXE C;  5E6J A;  2Z3X A;  4NXN M;  3PVS A;  3K1J A;  3KDS E;  3LQQ A;  2X49 A;  3J80 S;  2UUA M;  1NHG C;  3AFH A;  4LJ4 A;  3A46 A;  3ZC7 B;  3KOW E;  3FUX A;  4ZPX A;  3TE6 A;  3SAW A;  1HNZ M;  3HU1 A;  4JI0 M;  4QOZ C;  3LQR A;  2CFO A;  3KOZ E;  1N78 A;  1XXH A;  2I7P A;  4JI8 M;  1Z5C A;  1E94 E;  5C18 A;  3CF6 E;  2DWZ B;  2H1R A;  3J27 B;  4LGY A;  2JA2 A;  1IXS B;  2FE8 A;  5JI3 E;  4FWG A;  3KFU G;  3GLH A;  1IN4 A;  4IBI A;  3GLI B;  2CHG A;  4W5W A;  2FOI C;  1YUB A;  2J7O A;  4NOO B;  3LVW A;  3AJI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...