2KEDA

Structure of sdf-1/cxcl12
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
b'KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1-alpha
publication title Monomeric structure of the cardioprotective chemokine SDF-1/CXCL12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kedA00
2B2YC 2B2VC 1X3QA 3MTSA 1E0BA 1WTVA 3I8ZA 2FMMA 4RA8A 3N52A 4HCSA 4XDXA 5D14A 1SSOA 2MPMA 1CA5A 4XT1B 3LWEA 2FHTA 1PDQA 1M8AA 4HEDA 5E4XA 4DN4M 5EJWA 4MN3A 5EQ0A 3TN2A 2FJ2A 1DOMA 2EOTA 4RAUC 4X3TA 5CMDA 4CJ1B 2RVLA 1GUWA 2D9UA 3TZDA 1RTOA 2KOLA 2K03A 4UAIA 3UI2A 1CA6A 1HHVA 2HUGA 2Q8RE 2KEEA 1SAPA 1BO0A 3I90A 4QUCA 1IL8A 2H1EA 1IKMA 4IUPA 1SDFA 2CVRA 1C8CA 1WTRA 5CORA 1PFNA 1WTQA 2N88A 4LMQD 1RODA 1AZPA 1AZQA 5T1IA 1EL0A 1NR4A 2DY8A 1NCVA 1WD0A 2KEDA 3DEOA 4CJ2C 4ZK9B 1EIGA 1PFMA 5CBEE 1HUMA 2J7ZA 1EOTA 1TVXA 3SVMA 1J9OA 2X69A 3Q6SA 4NW2A 1B2TA 3DM1A 1EIHA 1HFGA 1B4OA 1U4RA 1PFBA 3GV6A 1BNZA 4HAEA 1ML0D 1HRJA 4X3UA 1KNAA 5EPLA 1XX8A 1G2SA 3G7LA 1WD1A 1U4LA 1MI2A 3MWYW 1S4ZA 3DEPA 2HDLA 1RTNA 3R93A 1X32A 3KUPA 1O80A 2X6LA 1RJTA 1QNKA 2B2UC 1AP0A 1B50A 2IL8A 2NYZD 2EE1A 2MGSA 3I91A 3IFDA 2VXWA 3IL8A 1F2LA 5T1GA 5E4WC 2KVMA 5EPKA 2L1BA 3H91A 5EKIA 2DY7A 2NWGA 3D6WA 2HDMA 1MSHA 2X6GA 1ICWA 1DZ1A 4IURA 3HP3A 3FPUB 2N55A 4R9WA 2HCCA 4R8IA 2B2WA 1JICA 1O7YA 1F9SA 3F2UA 4ZAIA 1B53A 2KECA 2L12A 3GV3A 1DONA 1A15A 1KNEA 2L11A 1DOKA 1HUNA 4ZKCB 1ZXTA 2K28A 1DOLA 2B2TA 1NR2A 2B2YA 2B2VA 4X3SA 1VMPA 1U4MA 5D65A 1F9QA 1B3AA 1MGSA 1WTOA 4IUVA 2K04A 2MP1A 1BBXC 4ZLTF 2L9HA 1VMCA 3I3CA 1BF4A 1O7ZA 2RA4A 1IKLA 1XYIA 1G6ZA 2BDNA 1HA6A 2K01A 5JJZA 4QUFA 1NAPA 1F9RA 2JP1A 3P7JA 4MHEA 5CBAE 4CJ0B 1WTWA 2L4NA 1J8IA 2FFKB 1MSGA 2RSOA 1CM9A 1LV9A 2M2LA 3ONAB 1Q3LA 1PLFA 2RSNA 5COYA 4IUUA 4O42A 2K1BA 1ESRA 3QO2A 1WVLA 1QG7A 1G2TA 4XT3B 1QE6A 1WTPA 2K05A 2FINB 2R3ZA 5DNFA 4IUQA 2Q8TA 1F9PA 2HCIA 1ILQA 4U68A 2EPBA 2XIWA 2NZ1D 1G91A 2KUMA 4IUTA 4X3KA 1WTXA 4OIKA 1JE4A 1RHPA 2B2WC 3FDTA 1HFNA 2MJ8A 4OIJA 1EQTA 1X3PA 2JYOA 2SDFA 4ZKBB 5EPJA 3KBXA 4HSVA 1U4PA 1ILPA 2B2UA 4RWSC 5AFWA 2B2TC
chains in the Genus database with same CATH superfamily
2ZXOA 3F8TA 4IUNA 1VQDA 4NPSA 2F0SA 3KK7A 3OIQA 3M4PA 5A2QE 1A3UA 3T1YQ 3LWEA 5IYCG 1BR9A 3G6JB 2B63B 5C4XB 1YNNC 3FMCA 2MUYA 5LMNQ 1SROA 2VUMB 1S5DD 2KOLA 2JJQA 5JJLA 5CV9A 3J81E 1HZCA 3DM3A 2HIXA 1IL2A 1H9MA 1KDBA 4LF6Q 1FNWA 2KEDA 2O5JC 5FK9C 3G48A 3JAML 2QCPX 1GO3E 3F1ZA 1KLUD 1EOTA 1T9HA 4KKSA 4MTNA 4IPHA 1S3OA 2RQXA 4IPDA 1EY5A 4M1UB 3A55A 2EDGA 2YTVA 4DUYL 4K5XA 4LF4Q 4OXPA 2M9VA 3GTKH 4K2LA 3J7AV 3I70A 1VF7A 3A7AB 1JWMD 1N32L 2MQHA 3MA2B 2E5LQ 1KXLA 3J80c 1KTKA 1EWIA 1TWFH 4LFCL 3A56A 4IO9A 5IP9G 4HIDA 1EY0A 1PXUA 2LKVA 2PCFB 3KF6A 4ZKCB 4X3SA 1PA6A 1F9QA 2E75C 2JQOA 2R92B 2LFNA 2WACA 1MJCA 1SYDA 2ATWA 2EJMA 1EIYB 2JP1A 3P7JA 3K0YA 3E6ZX 1JT8A 1LTBD 2RCNA 1GKHA 2ZTCA 3FRPB 1PMRA 4A3KB 2F0NA 1VQNA 3HOZG 4DUZQ 4RKLA 2EJGC 1A8VA 1CKOA 2WP8J 4RFBA 5I4DA 3BJUA 4JI7L 2B8GA 3KF6B 4LF7Q 2IWHA 4YIJA 2NZ1D 4L5SA 3HOUG 3J81i 1SNPA 4C3IG 4JI6Q 4X62L 2EYMA 2FMCA 2R61A 3NSWA 2K32A 3VR6A 1U9RA 4HCSA 2RKSA 2PW5A 3CCLA 1D8LA 2I5MX 4JOIA 4P2CB 4HEDA 5TSSA 4MN3A 3CCJA 5FLMH 1FD7D 2EYOA 3PO3B 4J6HA 2E2HB 1CHQD 3DWAA 1XNQL 2F0WA 2KEEA 4P75A 5BN5A 2F4VQ 1N9WA 3VYRA 1JR0D 1D6EC 2JA7G 1QZHA 5JPNC 2UXDL 5LMUQ 4JCVE 3T1HL 1CFMA 2DUDA 1K9MC 1HNWL 3P1HA 3A0JA 3HEJA 5JPMC 3ULPA 2GVAA 4PQXA 1PFBA 2JA5H 2NVQB 3RZOB 4TQUS 3NBHB 1LACA 3RZDB 3NHHA 5ELNA 1WD1A 4HJAA 1VQPA 1TIID 3CC7A 1J6QA 2RDHA 4L5TA 4PMCA 4KKUA 4GNXA 3C3LA 2A6HC 2CWAA 3S1NB 2NVXH 4DV5Q 4UDUC 1GUTA 1DGSA 2UU9L 1MSHA 3SE0A 1SLJA 4HJ9A 2F0IA 4OGQC 1JE5A 1PFSA 2B2TA 2K5QA 5M5XB 4A3EG 1PH2A 3I4LA 2Q2TA 2E2JH 1SMXA 1GHJA 3BZKA 1BBXC 3SR1A 1IKLA 4XYOA 4I7AA 4NB3A 5C3WA 1CKMA 4C2MH 1WTWA 1K83B 4LF5L 1PH4A 4LFAL 4A3IH 3HOWG 1Y8OB 2L15A 1XWEA 4KY6A 4GKKQ 4JI3L 4J8QA 1FVIA 1HR0Q 4H13C 1PH5A 4O42A 5C44B 3W5OA 1UE1A 1VQ8A 3CRLC 2BOSA 1ESFA 4L6TB 3FKIH 1LTID 4OL7A 3JAMc 2FINB 2QKIC 3SEBA 4IUQA 4KJNA 4DR1Q 3EBEA 2VZAA 3QOLA 1B44D 3S14B 2Q2UA 4P73A 1LM0A 2MJ8A 3S2HH 4L5QA 5M3FB 3D6WA 4OWXB 2IHEA 2I0QA 1B3QA 4CDCC 1I5FA 4DR2L 3URYA 2R7FA 3I8ZA 5C3EH 4DAVA 5IE8A 1EU4A 2C9OA 4C3HB 1KDAA 4QL5A 2FHTA 1VQLA 1SNQA 1OXVA 5CMDA 5DEHA 2AQ2B 4DR5L 1BOSA 2IPKD 2XRSD 1GOZA 1UEAB 4ME5A 1SAPA 4DR6L 4A3CH 4XQNA 4DA2A 5IGEA 2EXZA 1WTQA 1BCPD 2EXDA 2WFWA 3AQQA 2R93H 4EX5A 3CQZB 1II3A 1JWUD 3H94A 5CBEE 2HQEA 4A3FB 2F0PA 5FLXE 2PI2A 5EPLA 3K5LA 2Z6BA 1FNVA 2KQ3A 4OHJA 1EIFA 4R4OA 4YCWA 4JV5Q 1X56A 1RF2D 2X6LA 4HJ5A 2MGSA 1EYCA 3L3OC 1HNXL 1NE3A 2UUBQ 1SNMA 1I3QB 2FXQA 1PRTF 2G9DA 1JICA 2L11A 1DOKA 5IYDH 4B9WA 3WWVA 2LXKA 3GTQB 4B3TL 1XMOL 1SYEA 1NJIC 5FJ8H 3ICEA 5C3XA 1KC8C 5IGFA 3C1FA 1ET6A 5E1FA 2YU9H 4GN5A 2K14A 2Z1CA 1N36L 5IGGA 3TBIB 4P71A 3MXNA 4CKEA 1EYAA 5IWAQ 3TMEA 2A6HD 1MSGA 2F3VA 3BDOA 4ULLA 1MJEA 2Z0SA 2PZUA 2EY5A 2ZXPA 4HMJA 4XT3B 3CPWA 2KHSA 4AYBG 5JJIA 1G51A 5DNFA 3G6EA 1SYGA 2CKZB 4K5VA 4C3JG 2JA6H 2LY7A 1RCVD 2F0VA 3HKZG 4IUTA 3V05A 4KHPL 4BBSH 3QR8A 3W1BA 4RMFA 4DK1A 1KRTA 1HUNA 3MXNB 2VQFQ 1JJGA 4JI0L 4ZCKA 1CTMA 1SSOA 3VYUA 4LUOA 5C4XG 5CV6A 1H9JA 1SJHD 4OX9Q 2BE5C 5EBDA 3HOZB 4WORA 4RAUC 5JEAH 1D7QA 5ELDA 1KAWA 4DV6L 2RCFA 1JOOA 1HNZL 1PZKD 1JB7A 5EKLA 3HKSA 4RGOS 5IT9E 3HOUB 4DXGA 4DV4Q 1FJGQ 5JVG3 1VQOA 4C3IB 1XXGA 3ITPA 3CMAA 2B29A 4ZK9B 4CJ2C 3SDZA 1I4PA 1SE4A 3GTOH 4GOPC 3D4RA 3SVMA 1EIHA 2F0KA 3TQYA 1XJVA 1P16A 3KDFA 4LF9L 2R7ZH 4BY1G 3GQBA 2DNCA 4DNIA 4B3MQ 2XSCA 4JYAL 2CQOA 2JXMB 1PH9A 2A69D 3CU7A 1S5BD 4UHVA 5IYBH 3X3MA 3V2TA 2A73B 3K6OA 5I6YA 2HDMA 2JA7B 1HJPA 1STYA 2OT2A 2CW0C 2OQ0A 1Q81C 3L2PA 2I5LX 1D1KA 5KYIA 1TWHH 1DOLA 3DMUA 3BS1A 2PZWA 1SYBA 1HH2P 3S17B 3KYHC 1HZAA 3KDFB 3I3CA 4QF4A 4A3JH 4JW0A 2K50A 4KN4C 1SYFA 1EFWA 1TWAB 2H4OA 4JBWA 1GM5A 3GTLB 3TS2A 3K59A 2L4NA 3NQIA 4A3BH 3A8JE 4G57A 3OTOL 4A3DH 3BZCA 4BY7B 4OEMB 2M00A 3G71A 1A6XA 2RSNA 5COYA 1ONLA 3HFZB 2VS1A 5IIFA 4FO2A 3H15A 2MNAA 4ID6A 4OWWB 1ASYA 4XQJA 1F9PA 2NB0A 2JA9A 2IX0A 2I46A 4WRDA 4CDDC 4JBJA 2H5XA 4X3KA 1PH7A 5F2DA 2A74C 2PI2E 2F03A 2QF7A 4A76A 3T1YL 2B2YC 1H9RA 3MTSA 3HOWB 3ER0A 4XDXA 2YV5A 2OQKA 5LMNL 3NP8A 2L0CA 2Z6KC 2F0FA 4LW1A 4EVOA 4NXNL 4J1MA 1EEFD 2K03A 3GO5A 4DAPA 3K7UC 2CQAA 4ME3A 3WOEA 4QUCA 2JN4A 1IKMA 4LF8L 1B70B 2F0JA 1JB3A 1WTRA 5IP7G 1L0YB 2N88A 4N8FA 3RNUA 5FJ8G 2WAQG 4YWKA 1AZQA 2KENA 4BA2I 2HHHQ 3DEOA 2JEBI 4G4KA 4X66Q 3GTKB 1GUNA 5M5WB 4N9TA 3KLRA 4AH6A 2VY3A 4LK1C 4HJ7A 3BYTB 4LF4L 2PYKA 2BE5D 1TU2B 5L37A 5K36H 3VR4A 2D5DA 1CHPD 1VDZA 1SR3A 4IZ8A 3NQTA 2LXJA 3IFDA 2OTJA 3WOFA 4BWGB 2KJXA 2BH2A 4QJFA 2ID0A 1X3EA 1CI3M 5J1ZA 1K73C 1J5EQ 3I4NH 3FP9A 1JORA 3K58A 2EY1A 3QIAA 2EYHA 2E2DC 1UE7A 1IYJB 4Z9CB 1Q1EA 1D5XC 3VA5A 3M4OH 2L9HA 1SFOH 4K8JA 1STEA 2F0LA 2DJGC 2HIVA 3U50C 2K5HA 3NK9A 1AW7A 1Q7YC 1XNRL 4DKAC 2E76C 4A3MH 4LUZA 1J8IA 4QIWB 3EIVA 2VNUD 3H0GH 3EN2A 3ZYYX 1PYSB 3HG9A 2UUAQ 5C44G 2A5HA 1EQRA 1NBWA 4LF7L 3OW7A 1PYBA 1Q86C 2Q8TA 1D5MC 2L5TA 4QY7A 4UP8A 3MXPA 2JA8G 4PZ7A 2Q2HA 1X54A 4YWMA 3UDFA 4BBRH 1R9TH 2WKCA 3CCRA 3PO2H 5J39A 4DF7A 4OO1I 2B2VC 4AQYQ 3TZUA 1UAPA 3QWNA 3TP6A 2NN6G 2F0HA 5D3IB 5IGCA 1ICFB 4DN4M 2EOTA 4AYBB 1KABA 4O2DA 2F4VL 4C3JB 5HGTA 2K5NA 1UUPA 2H1EA 1RDPD 2D0PA 5NUCA 4F8MA 3HKZB 3AFPA 1VF5C 5LMNW 3GTGH 2NTSA 1NSNS 3W1GA 4A3GG 1IZ6A 1PVOA 4A3FG 1J9OA 1Y1WH 3S1MH 1BNZA 3G7LA 3MWYW 1ZEQX 1UE5A 3M4YA 4DV5L 3AEVA 4IJLA 1CQVA 1PTOH 1FGUA 3I91A 3S1QH 1YHBA 1LLRD 1UWVA 3NWSA 1KD1C 4BXXG 1LTLA 1QOHA 4IURA 1SN8A 4NKLA 3VDYA 3HOVG 2N8NA 5JOBA 1LT6D 2PO4A 4C2MB 3N6RA 4ABNA 4IUVA 3PQIA 4BY1B 4PNYA 1AEXA 1OXTA 5J3BA 2UXCQ 4CHTB 4QB4A 2WB1G 3GTMB 1UEBA 4PG3A 4GKKL 3J80E 3IAYA 4MHEA 3FKIB 3K0XA 5C0XG 1HR0L 3E9IA 2AMCB 4PZ8A 4KTAA 3D4WA 4KV6A 5JVH3 4A93H 4N8X1 1EWCA 1RIPA 1NUCA 5I6WA 3S16B 5LHY1 4DR1L 1YVCA 3BYYB 1QB5D 4Y7NB 4GZYC 1CQFA 4IFDG 2LMCB 2R3ZA 5JAVA 3KF8A 4FF2A 4POGA 3C46A 1I4XA 4L5RC 2QEJC 5JJKA 4OIKA 1F2ZA 3M9BA 4OIJA 5IGBA 2SDFA 1R4PB 4U673 1H9SA 1DM0B 1V43A 2UXBQ 3N52A 2ICIA 3CCSA 4JI4L 2B8FA 1BKBA 2EYFA 5C0XJ 1PDQA 5E4XA 3EA6A 3HOYH 4RHSA 5EJWA 5EQ0A 3U58A 1TWCH 4YCUA 4CJ1B 3A8KE 1XPRA 1LTSD 5IGDA 1XTCD 3TZDA 1TS5A 2R6GA 4GN3B 2J0TD 3BG3A 1U0LA 3NXWA 5CV5A 2CVRA 1BCPC 4IFDJ 1PZID 1RODA 2GA4B 4RCNA 5M3MH 1NR4A 2PMZE 3HS0C 2JK8A 1EY9A 1L1OC 2F0GA 3MXUA 1H9SB 1B1ZA 2OTLA 3Q6SA 5FLXL 1GXDC 4RGTA 4RHRA 4JV5L 1C48A 1ML0D 2YTXA 1G2SA 1I50H 1MI2A 1SJED 4DV2Q 2RF4A 2AUJD 5ELBA 2UUBL 2B2UC 4FXDA 3E0EA 1E1TA 4AYBE 3HOXH 4DNTB 5FO7B 2ES2A 1YJWA 2WAQB 5FKAC 3Q23A 4R9WA 2HCCA 3HKZE 4BBRG 1KNEA 1I6VC 1VQGA 2K28A 1TR5A 1YJ9A 1JC7A 1E2ZA 1LTRD 3PUVA 2YYZA 2NTTA 4LFBQ 2RHSB 1Y1VH 5IWAL 2NVTH 1PTOD 5M5YH 1JJ2A 2NVYH 1PYWD 3W2DA 2L55A 5E3FA 3DWPA 4NDXA 4OONA 4G7HC 4BY7G 3PMFA 3CXCA 2P5ZX 1PLFA 2VB3X 1A3TA 3I4MH 4JG2A 3H09A 4DK0A 2K05A 4JBKA 1I4GA 5C5MA 1HTLD 4KD3A 4MZ9A 4RH6A 1HR0W 4GOPA 1C7YA 4K0KQ 4K6LA 1X3GA 2B63H 2EY6A 2IT1A 1ENAA 4JBMA 1QVFA 2DN8A 1CKNA 2VQFL 3A74A 1EFID 4Y52H 2B3GA 2UUCQ 2QW7A 2BH8A 1SE2A 2VUMH 4GNXB 2IHFA 4B3SQ 2QEXA 4OX9L 2KCMA 3JAME 2FMMA 3M3YB 3RLFA 3GTJH 1M8AA 2A68C 3S1RB 1GUWA 4QGUA 4A4IA 2JA8B 2SNSA 4DV4L 2G5DA 4V0BA 4QCLA 1FJGL 4KK7A 5FO8B 1IL8A 4GOPB 3SK4A 4RGMA 5GAHC 3X3NA 1AZPA 3TP8A 1LTAD 2HD3A 1CKNB 1STBA 1QUQA 4F88A 4HIKA 3EJIA 1TKWB 3DM1A 4H02A 1HFGA 2ALYB 2GVBA 3GV6A 4L8JA 4R4TA 2OXPA 3DLLA 4WJ3M 1DD2A 3DEPA 3WDNA 4KKTA 1T5EA 2A69C 1IYVA 1RJTA 2IL8A 4DAYA 5GROA 3K57A 1TWHB 2V4DA 3TREA 1YEZA 5E4WC 5EPKA 1TT2A 1H9KA 2L1BA 2BCOA 2SEBD 4KY5A 2R92H 3IRBA 3CCMA 1QNUA 4A3GB 2VW9A 1ET9A 3LX0A 1QUQB 2B2YA 4O1NA 3QB3A 4N9PA 1U4MA 3TSSA 1NMFA 1X65A 2Z6KA 1G6ZA 5C4HA 1HA6A 3HOYG 3RD4A 3SK5A 1D5ZC 2JSOA 4IN3A 1ZYRC 1E7ZA 3CC4A 3FPPA 4ZUIA 3QG1A 2E8GA 3JAMi 4K8IA 3K81C 2ASBA 3HOVB 2ZM6Q 1WTPA 2WAQE 1EOVA 3CMEA 1M90C 3HGBA 1HCZA 4DV7Q 5FLXc 3R2TA 2Z8LA 2KUMA 2JE6I 5EAYA 2WB1B 3T51B 4OO1H 4OELB 1WTXA 1EEID 4QQBX 3KJPA 3VR5A 2XN9C 3RUZA 5FLMG 1F2YA 3I55A 4I7ZC 1TS3A 1V1QA 1ILPA 2I5HA 3CF5A 1TS4A 2E2HH 4HMIA 3ND8A 3R3OA 4DPGA 1OO9B 3S2DH 4GS3A 4EQOA 4IOAA 3OW2A 4KLKA 1JJCB 5D3DA 2RHQB 2BA1A 4BS9A 3I90A 2EQSA 3MVVA 4DR7Q 1SDFA 2NVQH 2JA5G 4KI0A 3RZOH 1X9NA 1HZBA 4V190 3OMCA 1EL0A 2DY8A 1NCVA 4PV1C 3CCUA 1L2FA 3K5NA 1TWGB 3D3RA 1CUKA 4UP9A 1Y8NB 1EZ8A 1K8AC 1E24A 2A68D 1M4VA 4B3RQ 4EQNA 3CCEA 1DYQA 1QNKA 3UDIA 3PF5A 2XGTA 4S3SA 3IL8A 1J5EL 4K5WA 2XWJB 5G3LF 3M4OB 3CHBD 1Q82C 3R8BA 5FO9B 3GV3A 1DONA 1A15A 2N78A 1K83H 1IW7C 2B2VA 4DV3Q 4A3MB 1LT3D 4A3IG 1MGSA 1JQYD 3T13A 3V96A 1STNA 3K5OA 2XRQD 2NZOA 4HR7B 1IBKQ 2PQAA 4KMUC 1V8QA 2D62A 3U9OA 4QUFA 2IW3A 1NAPA 2CFMA 4Q0FA 2G9HD 1RD9D 3FKIG 2UUAL 1JOQA 2FFKB 2WV6D 2VB2X 2WKDA 3L9AX 1WJJA 5A35A 3S14H 1R4QB 5M9OA 4DR2Q 5DLQE 4GN4B 2C35B 1N34Q 1WVLA 4BBRB 1MBYA 1Q46A 1I94Q 1VS0A 1R9TB 1K8MA 1CZWA 5M3FH 1STGA 1WOCA 1K8OA 3NTIA 1GHKA 3BVMA 5C3EG 3RMHA 1S40A 5I2XA 1EYGA 2CHBD 4IPGA 1STHA 4NMZA 1JE4A 3RLNA 1EQTA 4EQPA 2PQAB 4O0AA 3VYTA 1WYDA 4AQYL 4F7XA 4DV1Q 1V1OA 3A54A 1RKNA 1X3QA 1S5CD 1ZYRD 2E2IB 1IYUA 2KHIA 2MPMA 4A3CG 1LYLA 3GTGB 3SHLA 1XYIA 1TY2A 3ZJYC 2Z4IA 1BBUA 2RVLA 2R93G 3CQZH 3F2CA 1BXTA 1BVSA 1JWSD 4X65Q 3T4AC 5CR3A 3K8AA 3S1MB 5IYCH 1C8CA 4PMWA 4IPCA 5BR8Q 1VQJA 4DR4Q 3PV0A 3T16A 1AFPA 5CGKA 1Q8KA 2WB1E 1D2BA 4X6AH 2RDFA 1DCZA 4P72A 2MFIA 4TKOB 1E1OA 5A2QL 1UE6A 4TSSA 1B2TA 3S1QB 1YHAA 5E7NA 4HSPA 2Z4HA 1KL9A 3UDGA 1KNAA 4MIUA 4JC0A 4B3TQ 1O80A 1AP0A 4PMBA 2Q8IB 3RR5A 2ENBA 5IYDG 3E0JA 3J81L 4DR3Q 4LF6L 5IY0A 3H91A 2QA4A 4YY3Q 3FEWX 1YBYA 4JI1Q 2IX1A 1BUVT 2ZTDA 2NZHA 3FPUB 4R8IA 1O7YA 3I72A 1F9SA 3F2UA 1AN8A 5KEEA 4YHHQ 1OXSC 1NR2A 2UXCL 2AWNA 3CPFA 4H7BA 1EY7A 2BA0A 5C5LA 4KD4A 1TWFB 1FGBD 4MTKA 1H95A 1KIXA 1N8RC 2E5LL 1VQHA 4A3LH 1EYDA 2Y0SG 1XPUA 2JA6G 1BQQT 1ESRA 4BBSG 1QG7A 1QILA 4JI0Q 1L1OA 1IW7D 1VQ6A 1QCBD 1CK1A 4DV0Q 1EY4A 1SNOA 3HOZH 1RHPA 2B2WC 4C1NI 3HOYB 1TWCB 5EPJA 5JEAG 4HSVA 1U4PA 2B2UA 5AFWA 2PPBC 5KNDA 5KNCA 4DUZL 4NXMQ 1EWHA 1VQMA 1YZ6A 3S15H 4APVA 3PGZA 3CRKC 4XT1B 3H3VI 3J7ZC 1BCPB 1IHZA 4X3TA 5CV8A 3QJYA 4C3IH 2D9UA 1RTOA 1PH6A 1CA6A 1S5ED 3AB9A 4LF9Q 1KLGD 1YJNA 1L1OB 2AQ1B 4JI6L 4XQQA 2OF1A 3STBD 2R7ZG 2ZXRA 2MO1A 4JK1C 1I50B 4X64Q 4GLAC 4HTHA 1WD0A 4XXEA 3OYYA 1EIGA 2VQEQ 4ZUJA 2X69A 1XMQQ 5IYBG 4DV2L 3NTKA 5JEAJ 3EQLC 3RN5A 1KRSA 1RTNA 1X32A 3KUPA 2O5IC 5I2YA 1LO5D 2NYZD 3OIPA 5J22A 2VXWA 2DNEA 3OPOA 5LMUL 1MIUA 2JA5B 1SE3A 2EYJA 3TP7A 1Y1VB 3OTOQ 2NVTB 1B53A 4A3JG 3BDCA 2GN5A 4LAAA 3VR2A 1TWAH 3GTPH 5DM73 3GTLH 4LFBL 5M5YB 2NVYB 4A3BG 1C0AA 2NVXB 3B6YA 4A3DG 2F0MA 3H6MA 4JI5Q 3O13A 4B08A 1C9OA 1Z6HA 3CC2A 1VMCA 1O7ZA 1VQBA 4JVZA 1PTOC 1TQOA 2K01A 3RN2A 1PRTC 2F0OA 2K5VA 4A3EH 4F87A 2E2JB 2RSOA 1Y69U 1CM9A 1XTDA 2E74C 1LV9A 2M2LA 1Q12A 3ONAB 4QMGA 4EGVA 4RCOA 3TS0A 2K1BA 1D1IA 4CBVA 4K0KL 4KN7C 4A3IB 3HOWH 4GKJQ 1TY0A 4NXNQ 2UUCL 4H0LC 3GTJB 1HQRD 1K3RA 4B3SL 1S5FD 2YTYA 2JYOA 4WJ4A 1C4QA 4ZKBB 4LF8Q 3KLWA 5BN3A 4UY8C 4RWSC 2JEAI 1E0BA 3J81c 4G7OC 4I65A 1MD2D 2EY2A 4NP5A 1NY4A 1I6HH 5HY6A 5LL6S 2TSSA 3MFGA 3TN2A 1W3SA 2FJ2A 3S2HB 1B8AA 1SNCA 2LSSA 4UAIA 1HZ9A 3AFQA 5C3EB 1HHVA 2HT1A 1GUOA 2HUGA 2Q8RE 1IBLQ 3PIPA 3RLOA 5M5WH 1PHJA 1NNXA 2XWBB 1PFNA 1IBMQ 3FHWA 4FYDA 4WFN3 3K7AH 2NN6I 5K36G 3MZ5A 3KLSA 3TEHB 3CD6A 1PFMA 1ASZA 1MHWC 2J7ZA 3NE5B 3SXHA 3PUZA 4JI8Q 4NW2A 1DXMA 1B4OA 4A3LG 5EBCA 3NWTA 4QIWE 2KCCA 1E22A 4DNRB 1U4LA 2V1CC 1RL2A 2R93B 3EROA 3I4NG 3CCQA 2ZJPA 1X3FA 1E3PA 3KF8B 5KRUA 4KY7A 2NWGA 4ODGA 3TRZA 1XNRQ 3HP3A 4POFA 1HA5A 1F77A 4ZAIA 1XPOA 3ERQA 1Q1BA 4FDBA 1ZXTA 1SEBD 1WFQA 3ND9A 4A3MG 1VMPA 3H0GG 1WTOA 4E6IA 1YHQA 3D31A 4CDFC 5AJ3Q 2MO0A 2BDNA 5JJZA 3IFTA 3J80i 2A8VA 4JI2Q 1IXRA 1WCMH 4J15A 4OWTB 3AMUA 1EQQA 3Q0AA 2QDBA 2ZM6L 2YU9B 2EYLA 1VQEA 3NBHA 2F0EA 3NTHA 2ZJQA 4DV7L 3E5SA 4KHVA 1AE3A 5KIXA 1LT5D 3PO2G 1K3BC 2PQEA 2A6EC 1EU3A 1SRUA 2HCIA 5GADC 2EJFC 5C0XI 2XIWA 4FF3A 3S2DB 5ELEA 3A5ZB 2XVSA 1Y8PB 3K80C 2CWPA 1I4HA 3A5UA 2F52A 3BU2A 1PRTD 1VQIA 4ALPA 4C3JH 2Y0SB 1N33Q 2JA6B 1ENFA 4IFDI 4FF1A 4LNQA 4BBSB 1YNND 1E2VA 5C4JH 1LTGD 1PZJD 3AYHB 4DR7L 4IOCA 1K28A 2NBFA 2SOBA 4R4IA 5I9OA 4XIGS 1QWYA 3M7GA 1Y1WG 5C4XH 3LGJA 3PUYA 4PZ6A 4LMQD 3NBIA 4XYQA 5T1IA 3GP7A 1BBWA 3R2IA 3S24A 3SK6A 3P20A 2C5CA 1HUMA 3DXJC 1TVXA 5ELCA 2KBNA 4B3RL 5DAUA 4X3UA 4MNOA 2BDOA 1PH3A 2DJFC 1PH1A 3HZXA 1YNJC 1FNUA 1I4RA 1Q8IA 2EE1A 3GTOB 3I73A 5T1GA 3Q8DA 5IT9L 4DUYQ 5EKIA 4A75A 3E3XA 2CCZA 2R7ZB 2WINB 4BY1H 1ICWA 2PNRC 1B7YB 4DV3L 2IJ0A 3GTMH 4XTCS 4L63B 1N32Q 3D6CA 4B3ML 4EQ5A 5K5PA 2TMPA 1IBKL 4FXGC 4LFCQ 3MEFA 3PIP3 4A93G 1M1KC 3I7FA 3S16H 2RA4A 1SNDA 3A7LA 1Z9FA 1W2BA 1G6PA 5CBAE 3L0OA 5G3LD 4Y7NH 3P75A 1X55A 1N34L 1B9NA 2OCEA 3S9WA 1I94L 3CW2C 1B9MA 1OXXK 2NUCA 4UPAA 4A3JB 3PSIA 3QO2A 3CP0A 1G2TA 3MXGA 4R4CA 3MAQA 4JI4Q 1V9PA 4A3BB 2WIIB 4A3DB 4U68A 4A3KH 3W3AA 4JI7Q 1OXUA 4DV1L 3C2PA 4AIMA 1HFNA 1W6JA 1QVGA 1AH9A 3U4ZA 2F0QA 3H3VC 4DAYB 3BVGA 4DAMA 4HJ8A 3H3VH 1WTVA 3BDLA 3GDEA 4C56C 4X62Q 1L0WA 5IODA 1BDOA 3I56A 2AQ3B 3MHBA 4HN7A 1DOMA 4X65L 5M3MG 1VQ5A 4FNFA 1OTCA 2A6ED 3UI2A 2K75A 4KHZA 5BR8L 5CV4A 4BA1I 3D0FA 4ZRZA 2AUKA 4DR4L 2CH4A 4HIOA 1XNQQ 1CZGA 1PTOF 3BZDB 3D8GA 2ICEC 2EIFA 3OHXC 4M8AA 4WJWA 3F2DA 3PO3H 2AWOA 1KHIA 2F3IA 1Y14B 1Z47A 4DGZA 3HOXG 2UXDQ 3T1HQ 1WCMG 5IP7H 1HNWQ 4HAEA 1HRJA 2AHOB 2K5DA 3PF4A 2Y0SE 4H44C 3MEHA 1VQ7A 3PIOA 2HDLA 4DR3L 3JC66 3KFUA 1B50A 4IQZA 4YY3L 4DK3C 4JI1L 1YIJA 4CKCA 1UNSA 3KOJA 1F2LA 5BN4A 2HHHL 1HPCA 5KYLA 4JOIC 3RZDH 4X66L 2X6GA 4YHHL 1DZ1A 4DK6C 2B2WA 1Y1VG 4ZYSA 1Z7TA 2RBMA 2KECA 1E2WA 5GAGC 3Q24A 2UU9Q 1QVCA 1P8LA 2F0TA 3S1NH 2Z9HA 1KDCA 3MFYA 4R4QA 4B9XA 5C6AA 1K0SA 1A3VA 1WI5A 2K04A 2MP1A 3KBGA 3VYSA 1BF4A 2LS01 1YNJD 3I4MG 3A8IE 3FVQA 3I4NB 5M5XH 1HTPA 1LUZA 1I4QA 3J81j 1FL0A 1G291 1VQKA 4IUUA 4LF5Q 1SFOB 2B63G 4LFAQ 3C1EA 3QOJA 1VQ4A 3SGIA 4JI3Q 4DV0L 3HRZC 4GNXC 4FP5D 2MHVA 2PZTA 2VUMG 2ZT9C 1GUSA 3H0GB 5I9PA 2QGQA 3M3YH 3S15B 4LWCA 1G91A 5H1SE 4LJZC 5C44H 3FDTA 3OMGA 2OEOA 4NXML 1O7IA 2KHJA 3S1RH 3KBXA 4DU9A 5LL6X 1V1PA 2O2LD 2B2TC 4TVAB 2JA8H 1AE2A 2F4IA 1BCPF 5IT9c 3ERSX 1QJOA 1W6KA 2A1AA 4RG1A 3OOCA 3TDQA 4C1NK 3PO2B 1GVPA 3I4OA 1WTHA 2K6AA 4GLXA 4ZQ3A 4CKBA 4DXFA 1QZGA 4DR5Q 4C3HH 2F1MA 4Q5VA 5CYUA 4X64L 1CSPA 2XTIA 1VCIA 3STBC 1VQFA 2NN6H 3IKJA 2ZTEA 3TP5A 5FOBB 2VQEL 2OWOA 4DR6Q 1EZ6A 4K2KA 2KA7A 1XMQL 2Q2IA 5ELOA 2KCNA 1K0RA 1V1PB 3M4QA 1A2TA 3CKIB 3E9HA 1XX8A 3LNNA 2F3WA 2K4KA 1S4ZA 2R92G 1ENCA 4CDEC 4UP7A 4RKBA 5CC4A 5DM63 4A3GH 4LUVA 4A3FH 3GTPB 1Y1WB 1S72A 2DY7A 2KCTA 3KJOA 2HQLA 2CH4W 1SMYC 4A3KG 3NUCA 5CV7A 1HNXQ 1A63A 3GD7A 4FXKC 1SE8A 2L12A 1PTOB 4JI5L 3PUWA 1YI2A 1PRTB 4A3EB 5D65A 1GD7A 1Q90A 1L0XB 2R7DA 3OWEB 2SNMA 4BXXH 4ILWA 1I3QH 3DHQA 3UE0A 4IALA 2J4XA 5EKKA 1XMOQ 2XNAC 3HOVH 2O4XA 3PUXA 4YWLA 4HIMA 1F9RA 1O78A 3K5MA 4DFAA 3L7ZC 3GTQH 1TXYA 3OWFA 1N36Q 2VL6A 1LTTD 1G8ZD 3EVQA 3MC0B 3VR3A 4OO1G 3ULLA 4GKJL 3PIO3 3I2ZA 5C0XH 3PO3G 1MKHA 4TRDA 4A93B 1JOKA 1I6HB 3M7NA 3T56B 1FYCA 5IP9H 1LT4D 1X6OA 1YITA 3J80L 2IX3A 1X3PA 4K6DA 4IFDH 5KNBA 4KHPQ 3SK8A 4K14A 4FVMA 1JCKB 4RA8A 5D14A 1VQ9A 3CAMA 1PH8A 1CA5A 2QILA 3KLSX 4CGYB 1A62A 3J7AF 4GLVB 4R8NA 1TS2A 1PV4A 1JMCA 2I07B 1IBLL 3K7AB 4G7ZC 3U4VA 1SBBB 3Q22A 1TWGH 5GQOA 1BO0A 2AKWB 4P74A 4DV6Q 3F2BA 1IBML 4IUPA 4R1JA 4KJOA 5CORA 3LWUA 1YNXA 1KQSA 2UXBL 2EZVA 1HNZQ 2F0UA 4JI8L 4HCEA 3NEMA 5ISRA 2QDLA 3NENA 3NPPA 1U4RA 2N3SA 3HOUH 3UDXA 1FR3A 4RGNA 3M85A 1NMGA 1A0IA 5M3MB 5GAEC 3R93A 1GJXA 1GUGA 2K52A 1CT1D 3PCOB 4JYAQ 2KVMA 1SXTA 1VQCA 1LABA 2DGYA 2D0OA 1STAA 3D4DA 2B39A 3DWQA 3EFXD 4FF4A 2N55A 2CW0D 1A2UA 5HURA 1HXYD 1NTGA 2PW7A 1HQMC 2PNHA 3HOXB 1EY6A 1O7LA 3T53B 1WCMB 1VQAA 5AJ3L 1KAAA 2N49A 2IY5B 2EVBA 1EUJA 4IJHA 2JA7H 1B3AA 2K5WA 3DUZA 4ZLTF 2PMZB 2A19A 1U5KA 4JI2L 2ZJRA 2D2CC 1EY8A 4CJ0B 5M3FG 2RDGA 1T5XD 3J7YW 1DJRD 3NELA 3S17H 1CSQA 2K33A 4C3HG 1Q3LA 1EQVA 3UE1A 3AU7A 1SMYD 5HGQA 3CCVA 5C4ZA 1QE6A 2EYPA 3G4SA 3U9SA 1K8GA 1ZKOA 4YCVA 3VA7A 4BY7H 1ILQA 2E2IH 2EPBA 5IOCA 3BVZA 1F2MA 2K7VA 3ULJA 3I4MB 5ELFA 4JPBW 1SYCA 2F0DA 5EGTA 1N33L 3OSOA 5C4JB 3J7A5 5KGUA
chains in the Genus database with same CATH topology
2ZXOA 4IUNA 2F0SA 3KK7A 3OIQA 5A2QE 1A3UA 2B63B 3LWEA 5C4XB 1BR9A 3G6JB 1YNNC 3FMCA 2MUYA 2VUMB 1S5DD 2KOLA 5CV9A 3J81E 1H9MA 1KDBA 1FNWA 2KEDA 2O5JC 5FK9C 3JAML 2QCPX 1KLUD 1EOTA 4KKSA 2RQXA 1EY5A 4M1UB 3A55A 2EDGA 4K5XA 2M9VA 4K2LA 3J7AV 3I70A 1VF7A 3A7AB 1JWMD 3MA2B 1KTKA 3A56A 1EY0A 1PXUA 2LKVA 2PCFB 4ZKCB 4X3SA 1F9QA 2E75C 2R92B 2LFNA 2WACA 1SYDA 2EJMA 2JP1A 3P7JA 3K0YA 3E6ZX 1LTBD 3FRPB 1PMRA 4A3KB 2F0NA 4RKLA 2EJGC 2WP8J 4RFBA 5I4DA 2B8GA 2IWHA 4YIJA 2NZ1D 1SNPA 4C3IG 2EYMA 2FMCA 2R61A 3NSWA 2K32A 3VR6A 1U9RA 4HCSA 2RKSA 2PW5A 4P2CB 4HEDA 5TSSA 4MN3A 1FD7D 2EYOA 3PO3B 4J6HA 2E2HB 1CHQD 3DWAA 2F0WA 2KEEA 5BN5A 3VYRA 1JR0D 1D6EC 5JPNC 1CFMA 3P1HA 3HEJA 5JPMC 4PQXA 1PFBA 2NVQB 3RZOB 4TQUS 1LACA 3RZDB 3NHHA 1WD1A 1TIID 2RDHA 4PMCA 4KKUA 3C3LA 2A6HC 3S1NB 4UDUC 1GUTA 1MSHA 3SE0A 2F0IA 4OGQC 2B2TA 2K5QA 5M5XB 3I4LA 1GHJA 1BBXC 3SR1A 1IKLA 4XYOA 5C3WA 1WTWA 1K83B 1Y8OB 1XWEA 4KY6A 4J8QA 4H13C 4O42A 5C44B 3CRLC 2BOSA 1ESFA 4L6TB 1LTID 4OL7A 2FINB 2QKIC 3SEBA 4IUQA 4KJNA 3QOLA 1B44D 3S14B 2MJ8A 5M3FB 3D6WA 3URYA 3I8ZA 4DAVA 1EU4A 2C9OA 4C3HB 1KDAA 2FHTA 1SNQA 1OXVA 5CMDA 5DEHA 2AQ2B 1BOSA 2IPKD 2XRSD 1GOZA 1UEAB 4ME5A 1SAPA 4XQNA 4DA2A 5IGEA 2EXZA 1WTQA 1BCPD 3CQZB 1II3A 1JWUD 3H94A 5CBEE 2HQEA 4A3FB 2F0PA 5FLXE 5EPLA 3K5LA 1FNVA 2KQ3A 4OHJA 1RF2D 2X6LA 2MGSA 1EYCA 3L3OC 1SNMA 1I3QB 1PRTF 2G9DA 1JICA 2L11A 1DOKA 4B9WA 3GTQB 1SYEA 5C3XA 5IGFA 3C1FA 1ET6A 5E1FA 2Z1CA 5IGGA 3TBIB 3MXNA 4CKEA 1EYAA 3TMEA 2A6HD 1MSGA 2F3VA 3BDOA 4ULLA 2PZUA 2EY5A 2ZXPA 4HMJA 4XT3B 2KHSA 5DNFA 1SYGA 4K5VA 4C3JG 2LY7A 1RCVD 2F0VA 4IUTA 3V05A 4DK1A 1HUNA 1CTMA 1SSOA 3VYUA 5CV6A 1H9JA 1SJHD 3HOZB 2BE5C 5EBDA 4WORA 4RAUC 5JEAH 5ELDA 1JOOA 1PZKD 5EKLA 4RGOS 5IT9E 3HOUB 4DXGA 5JVG3 4C3IB 1XXGA 3ITPA 4ZK9B 4CJ2C 3SDZA 1I4PA 1SE4A 3D4RA 3SVMA 1EIHA 2F0KA 3GQBA 2DNCA 2XSCA 2JXMB 2A69D 3CU7A 1S5BD 3X3MA 3V2TA 2A73B 3K6OA 5I6YA 2HDMA 2JA7B 1STYA 2OT2A 2CW0C 1D1KA 5KYIA 1DOLA 3DMUA 3BS1A 2PZWA 1SYBA 3S17B 3I3CA 4QF4A 4KN4C 1SYFA 1TWAB 2H4OA 4JBWA 3GTLB 3K59A 2L4NA 3NQIA 3A8JE 4G57A 4BY7B 2M00A 1A6XA 2RSNA 5COYA 1ONLA 5IIFA 4FO2A 4ID6A 4XQJA 1F9PA 2NB0A 2IX0A 2I46A 4WRDA 4X3KA 5F2DA 2A74C 2F03A 2QF7A 2B2YC 1H9RA 3MTSA 3HOWB 4XDXA 3NP8A 2L0CA 2F0FA 4EVOA 4J1MA 1EEFD 2K03A 3GO5A 4DAPA 2CQAA 3WOEA 4QUCA 1IKMA 2F0JA 1JB3A 1WTRA 1L0YB 2N88A 1AZQA 4BA2I 3DEOA 2JEBI 4G4KA 3GTKB 1GUNA 5M5WB 4N9TA 3KLRA 4LK1C 3BYTB 2PYKA 2BE5D 1TU2B 5K36H 3VR4A 2D5DA 1CHPD 1VDZA 4IZ8A 3NQTA 3IFDA 3WOFA 4BWGB 2KJXA 2ID0A 1CI3M 5J1ZA 1JORA 3K58A 2EY1A 3QIAA 2EYHA 2E2DC 4Z9CB 1Q1EA 1D5XC 3VA5A 2L9HA 4K8JA 1STEA 2F0LA 3NK9A 1AW7A 2E76C 1J8IA 4QIWB 2VNUD 3ZYYX 3HG9A 2A5HA 3OW7A 2Q8TA 1D5MC 2L5TA 3MXPA 2WKCA 5J39A 4DF7A 4OO1I 2B2VC 3TZUA 1UAPA 3QWNA 3TP6A 2NN6G 2F0HA 5D3IB 5IGCA 4DN4M 2EOTA 4AYBB 1KABA 4C3JB 5HGTA 1UUPA 2H1EA 1RDPD 5NUCA 4F8MA 3HKZB 1VF5C 2NTSA 1NSNS 1J9OA 1BNZA 3G7LA 3MWYW 1ZEQX 3M4YA 1CQVA 1PTOH 3I91A 1LLRD 3NWSA 1QOHA 4IURA 4NKLA 5JOBA 1LT6D 2PO4A 4C2MB 3N6RA 4ABNA 4IUVA 4BY1B 4PNYA 1AEXA 1OXTA 4CHTB 4QB4A 3GTMB 3J80E 3IAYA 4MHEA 3FKIB 5C0XG 4KTAA 3D4WA 4KV6A 5JVH3 1EWCA 1NUCA 5I6WA 3S16B 5LHY1 3BYYB 1QB5D 4Y7NB 4GZYC 1CQFA 4IFDG 2LMCB 2R3ZA 5JAVA 3KF8A 4FF2A 3C46A 1I4XA 2QEJC 4OIKA 1F2ZA 4OIJA 5IGBA 2SDFA 1R4PB 4U673 1H9SA 1DM0B 1V43A 3N52A 2ICIA 2B8FA 2EYFA 5C0XJ 1PDQA 5E4XA 3EA6A 4RHSA 5EJWA 5EQ0A 4CJ1B 3A8KE 1LTSD 5IGDA 1XTCD 3TZDA 1TS5A 2R6GA 2J0TD 3BG3A 3NXWA 5CV5A 2CVRA 1BCPC 4IFDJ 1PZID 1RODA 2GA4B 4RCNA 1NR4A 3HS0C 1EY9A 2F0GA 3MXUA 1H9SB 1B1ZA 3Q6SA 5FLXL 1GXDC 4RGTA 4RHRA 1C48A 1ML0D 1G2SA 1MI2A 1SJED 2AUJD 5ELBA 2B2UC 4FXDA 4DNTB 5FO7B 2WAQB 5FKAC 3Q23A 4R9WA 2HCCA 1KNEA 1I6VC 2K28A 1TR5A 1JC7A 1E2ZA 1LTRD 3PUVA 2YYZA 2NTTA 1PTOD 3W2DA 1PYWD 2L55A 5E3FA 3DWPA 4NDXA 4G7HC 3PMFA 1PLFA 2VB3X 1A3TA 4DK0A 3H09A 2K05A 1I4GA 5C5MA 1HTLD 4KD3A 4RH6A 4K6LA 2EY6A 2IT1A 1ENAA 2DN8A 1EFID 1SE2A 3JAME 2FMMA 3M3YB 3RLFA 1M8AA 2A68C 3S1RB 1GUWA 2JA8B 2SNSA 4V0BA 4QCLA 4KK7A 5FO8B 1IL8A 3SK4A 4RGMA 3X3NA 1AZPA 3TP8A 1LTAD 1STBA 4F88A 3EJIA 1TKWB 3DM1A 1HFGA 3GV6A 4L8JA 2OXPA 1DD2A 3DEPA 3WDNA 4KKTA 1T5EA 2A69C 1IYVA 1RJTA 2IL8A 4DAYA 3K57A 1TWHB 2V4DA 5E4WC 5EPKA 1TT2A 1H9KA 2L1BA 2BCOA 2SEBD 4KY5A 1QNUA 4A3GB 1ET9A 3LX0A 2B2YA 4O1NA 3QB3A 4N9PA 1U4MA 3TSSA 1G6ZA 5C4HA 1HA6A 3RD4A 3SK5A 1D5ZC 2JSOA 4IN3A 1ZYRC 3FPPA 4ZUIA 3QG1A 4K8IA 3HOVB 1WTPA 3HGBA 1HCZA 3R2TA 2Z8LA 2KUMA 2JE6I 2WB1B 3T51B 4OO1H 1WTXA 1EEID 3VR5A 2XN9C 3RUZA 1F2YA 4I7ZC 1TS3A 1ILPA 1TS4A 4HMIA 3ND8A 3R3OA 1OO9B 4EQOA 5D3DA 2BA1A 4BS9A 3I90A 3MVVA 1SDFA 4KI0A 4V190 3OMCA 1EL0A 2DY8A 1NCVA 4PV1C 3K5NA 1TWGB 3D3RA 1Y8NB 1EZ8A 2A68D 1M4VA 4EQNA 1DYQA 1QNKA 4S3SA 3IL8A 4K5WA 2XWJB 5G3LF 3M4OB 3CHBD 3R8BA 5FO9B 3GV3A 1DONA 1A15A 1IW7C 2B2VA 4A3MB 1LT3D 1MGSA 1JQYD 3T13A 3V96A 1STNA 3K5OA 2XRQD 4HR7B 4KMUC 1V8QA 2D62A 3U9OA 4QUFA 2IW3A 1NAPA 4Q0FA 2G9HD 1RD9D 1JOQA 2FFKB 2WV6D 2VB2X 2WKDA 3L9AX 5A35A 1R4QB 5M9OA 1WVLA 4BBRB 1MBYA 1R9TB 1K8MA 1CZWA 1STGA 1K8OA 3NTIA 1GHKA 3BVMA 3RMHA 5I2XA 2CHBD 1STHA 4NMZA 1JE4A 1EQTA 4EQPA 3VYTA 4F7XA 1V1OA 3A54A 1RKNA 1X3QA 1S5CD 1ZYRD 2E2IB 1IYUA 2MPMA 3GTGB 3SHLA 1XYIA 1TY2A 2Z4IA 2RVLA 1BXTA 1JWSD 3T4AC 5CR3A 3S1MB 1C8CA 4PMWA 3PV0A 3T16A 1AFPA 5CGKA 1D2BA 2RDFA 1DCZA 4TKOB 5A2QL 1B2TA 4TSSA 3S1QB 4HSPA 2Z4HA 1KNAA 4MIUA 1O80A 1AP0A 4PMBA 2Q8IB 2ENBA 3E0JA 3J81L 3H91A 3FEWX 2IX1A 1BUVT 3FPUB 4R8IA 1O7YA 3I72A 1F9SA 3F2UA 1AN8A 5KEEA 1OXSC 1NR2A 2AWNA 4H7BA 1EY7A 2BA0A 5C5LA 4KD4A 1TWFB 1FGBD 1EYDA 1BQQT 1ESRA 1QG7A 1QILA 1IW7D 1QCBD 1CK1A 1EY4A 1SNOA 1RHPA 2B2WC 4C1NI 3HOYB 1TWCB 5EPJA 5JEAG 4HSVA 1U4PA 2B2UA 5AFWA 2PPBC 5KNDA 5KNCA 1EWHA 4XT1B 3CRKC 1BCPB 1IHZA 4X3TA 5CV8A 3QJYA 2D9UA 1RTOA 1CA6A 1S5ED 3AB9A 1KLGD 2AQ1B 4XQQA 2OF1A 2ZXRA 4JK1C 1I50B 4HTHA 1WD0A 4XXEA 1EIGA 4ZUJA 2X69A 3NTKA 5JEAJ 3EQLC 1RTNA 1X32A 3KUPA 2O5IC 5I2YA 1LO5D 2NYZD 3OIPA 5J22A 2VXWA 2DNEA 3OPOA 2JA5B 1SE3A 2EYJA 3TP7A 1Y1VB 2NVTB 1B53A 3BDCA 4LAAA 3VR2A 5DM73 5M5YB 2NVYB 2NVXB 2F0MA 3H6MA 3O13A 4B08A 1Z6HA 1VMCA 1O7ZA 1PTOC 1TQOA 2K01A 1PRTC 2F0OA 4F87A 2E2JB 2RSOA 1Y69U 1CM9A 2E74C 4QMGA 1LV9A 2M2LA 1Q12A 3ONAB 4EGVA 4RCOA 2K1BA 1D1IA 4CBVA 4KN7C 4A3IB 1TY0A 4H0LC 3GTJB 1HQRD 1S5FD 2JYOA 1C4QA 4ZKBB 5BN3A 4RWSC 2JEAI 1E0BA 4G7OC 4I65A 1MD2D 2EY2A 4NP5A 5LL6S 2TSSA 3MFGA 3TN2A 2FJ2A 3S2HB 1SNCA 4UAIA 1HHVA 5C3EB 1GUOA 2HUGA 2Q8RE 2XWBB 1PFNA 4FYDA 4WFN3 2NN6I 5K36G 3MZ5A 3KLSA 1PFMA 3NE5B 2J7ZA 3SXHA 3PUZA 4NW2A 1DXMA 1B4OA 5EBCA 3NWTA 2KCCA 4DNRB 1U4LA 2R93B 3EROA 5KRUA 4KY7A 2NWGA 4ODGA 3HP3A 1HA5A 1F77A 4ZAIA 3ERQA 1Q1BA 1ZXTA 1SEBD 3ND9A 1VMPA 1WTOA 4E6IA 3D31A 2BDNA 5JJZA 3IFTA 3AMUA 3Q0AA 2QDBA 2YU9B 2EYLA 3NBHA 2F0EA 3NTHA 3E5SA 4KHVA 5KIXA 1LT5D 2PQEA 2A6EC 1EU3A 2HCIA 2EJFC 5C0XI 2XIWA 4FF3A 3S2DB 5ELEA 2XVSA 1Y8PB 1I4HA 1PRTD 2Y0SB 2JA6B 1ENFA 4IFDI 4FF1A 4BBSB 1YNND 1E2VA 1LTGD 1PZJD 2NBFA 2SOBA 5I9OA 4XIGS 1QWYA 3M7GA 3PUYA 4LMQD 3NBIA 4XYQA 5T1IA 3GP7A 3R2IA 3SK6A 3P20A 2C5CA 1HUMA 3DXJC 1TVXA 5ELCA 5DAUA 4X3UA 2BDOA 3HZXA 1YNJC 1FNUA 1I4RA 1Q8IA 2EE1A 3GTOB 3I73A 5T1GA 5IT9L 5EKIA 2R7ZB 2WINB 1ICWA 2PNRC 2IJ0A 4XTCS 4L63B 3D6CA 5K5PA 2TMPA 4FXGC 3PIP3 2RA4A 1SNDA 3A7LA 5CBAE 5G3LD 3P75A 1B9NA 3S9WA 1B9MA 1OXXK 2NUCA 4A3JB 3QO2A 1G2TA 3MXGA 3MAQA 4A3BB 2WIIB 4A3DB 4U68A 3W3AA 1OXUA 3C2PA 1HFNA 1W6JA 2F0QA 3H3VC 3BVGA 1WTVA 3BDLA 4C56C 5IODA 1BDOA 2AQ3B 3MHBA 4HN7A 1DOMA 4FNFA 2A6ED 3UI2A 4KHZA 5CV4A 4BA1I 4ZRZA 2AUKA 1CZGA 1PTOF 3BZDB 3D8GA 2ICEC 3OHXC 4M8AA 4WJWA 2AWOA 1Z47A 4DGZA 4HAEA 1HRJA 2K5DA 4H44C 3MEHA 2HDLA 1B50A 4IQZA 4CKCA 1UNSA 1F2LA 5BN4A 1HPCA 5KYLA 2X6GA 1DZ1A 2B2WA 4ZYSA 1Z7TA 2RBMA 2KECA 1E2WA 3Q24A 2F0TA 1KDCA 3MFYA 5C6AA 4B9XA 1A3VA 2K04A 3VYSA 2MP1A 3KBGA 1BF4A 2LS01 1YNJD 3A8IE 3FVQA 3I4NB 1HTPA 1I4QA 1G291 4IUUA 1SFOB 3C1EA 3QOJA 3HRZC 4FP5D 2MHVA 2PZTA 2ZT9C 1GUSA 3H0GB 5I9PA 3S15B 1G91A 4LJZC 3FDTA 3OMGA 2OEOA 3KBXA 4DU9A 5LL6X 1V1PA 2O2LD 2B2TC 2F4IA 1BCPF 1QJOA 1W6KA 3OOCA 3TDQA 4C1NK 3PO2B 2K6AA 4ZQ3A 4CKBA 4DXFA 2F1MA 4Q5VA 5CYUA 1VCIA 2NN6H 3IKJA 3TP5A 5FOBB 1EZ6A 4K2KA 2KA7A 2KCNA 1V1PB 1A2TA 3CKIB 1XX8A 3LNNA 2F3WA 1S4ZA 1ENCA 4RKBA 5CC4A 5DM63 3GTPB 1Y1WB 2DY7A 1SMYC 3NUCA 5CV7A 3GD7A 4FXKC 2L12A 1PTOB 3PUWA 1PRTB 4A3EB 5D65A 1Q90A 1L0XB 3OWEB 2SNMA 4ILWA 3DHQA 4IALA 2J4XA 5EKKA 2XNAC 2O4XA 3PUXA 1F9RA 1O78A 3K5MA 4DFAA 3L7ZC 3OWFA 1LTTD 1G8ZD 3EVQA 3MC0B 3VR3A 4OO1G 3PIO3 5C0XH 4TRDA 4A93B 1JOKA 1I6HB 3M7NA 3T56B 1FYCA 1LT4D 3J80L 2IX3A 1X3PA 4K6DA 4IFDH 5KNBA 3SK8A 4K14A 4FVMA 1JCKB 4RA8A 5D14A 1CA5A 2QILA 3KLSX 4CGYB 3J7AF 4R8NA 1TS2A 2I07B 3K7AB 4G7ZC 1SBBB 3Q22A 1BO0A 4IUPA 4KJOA 5CORA 3LWUA 2EZVA 2F0UA 4HCEA 5ISRA 3NPPA 1U4RA 1FR3A 4RGNA 3M85A 5M3MB 3R93A 1GJXA 1GUGA 1CT1D 2KVMA 1SXTA 1LABA 1STAA 3D4DA 2B39A 3DWQA 3EFXD 4FF4A 2N55A 2CW0D 1A2UA 5HURA 1HXYD 2PW7A 1HQMC 3HOXB 1EY6A 1O7LA 3T53B 1WCMB 1KAAA 2EVBA 1B3AA 2K5WA 3DUZA 4ZLTF 2PMZB 2D2CC 1EY8A 4CJ0B 2RDGA 1T5XD 3J7YW 1DJRD 2K33A 4C3HG 1Q3LA 1EQVA 3AU7A 1SMYD 5C4ZA 1QE6A 2EYPA 3U9SA 1ZKOA 3VA7A 1ILQA 2EPBA 5IOCA 3BVZA 1F2MA 2K7VA 3I4MB 5ELFA 1SYCA 2F0DA 5EGTA 3OSOA 5C4JB 5KGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2Y C;  2B2V C;  1X3Q A;  3MTS A;  1E0B A;  1WTV A;  3I8Z A;  2FMM A;  4RA8 A;  3N52 A;  4HCS A;  4XDX A;  5D14 A;  1SSO A;  2MPM A;  1CA5 A;  4XT1 B;  3LWE A;  2FHT A;  1PDQ A;  1M8A A;  4HED A;  5E4X A;  4DN4 M;  5EJW A;  4MN3 A;  5EQ0 A;  3TN2 A;  2FJ2 A;  1DOM A;  2EOT A;  4RAU C;  4X3T A;  5CMD A;  4CJ1 B;  2RVL A;  1GUW A;  2D9U A;  3TZD A;  1RTO A;  2KOL A;  2K03 A;  4UAI A;  3UI2 A;  1CA6 A;  1HHV A;  2HUG A;  2Q8R E;  2KEE A;  1SAP A;  1BO0 A;  3I90 A;  4QUC A;  1IL8 A;  2H1E A;  1IKM A;  4IUP A;  1SDF A;  2CVR A;  1C8C A;  1WTR A;  5COR A;  1PFN A;  1WTQ A;  2N88 A;  4LMQ D;  1ROD A;  1AZP A;  1AZQ A;  5T1I A;  1EL0 A;  1NR4 A;  2DY8 A;  1NCV A;  1WD0 A;  2KED A;  3DEO A;  4CJ2 C;  4ZK9 B;  1EIG A;  1PFM A;  5CBE E;  1HUM A;  2J7Z A;  1EOT A;  1TVX A;  3SVM A;  1J9O A;  2X69 A;  3Q6S A;  4NW2 A;  1B2T A;  3DM1 A;  1EIH A;  1HFG A;  1B4O A;  1U4R A;  1PFB A;  3GV6 A;  1BNZ A;  4HAE A;  1ML0 D;  1HRJ A;  4X3U A;  1KNA A;  5EPL A;  1XX8 A;  1G2S A;  3G7L A;  1WD1 A;  1U4L A;  1MI2 A;  3MWY W;  1S4Z A;  3DEP A;  2HDL A;  1RTN A;  3R93 A;  1X32 A;  3KUP A;  1O80 A;  2X6L A;  1RJT A;  1QNK A;  2B2U C;  1AP0 A;  1B50 A;  2IL8 A;  2NYZ D;  2EE1 A;  2MGS A;  3I91 A;  3IFD A;  2VXW A;  3IL8 A;  1F2L A;  5T1G A;  5E4W C;  2KVM A;  5EPK A;  2L1B A;  3H91 A;  5EKI A;  2DY7 A;  2NWG A;  3D6W A;  2HDM A;  1MSH A;  2X6G A;  1ICW A;  1DZ1 A;  4IUR A;  3HP3 A;  3FPU B;  2N55 A;  4R9W A;  2HCC A;  4R8I A;  2B2W A;  1JIC A;  1O7Y A;  1F9S A;  3F2U A;  4ZAI A;  1B53 A;  2KEC A;  2L12 A;  3GV3 A;  1DON A;  1A15 A;  1KNE A;  2L11 A;  1DOK A;  1HUN A;  4ZKC B;  1ZXT A;  2K28 A;  1DOL A;  2B2T A;  1NR2 A;  2B2Y A;  2B2V A;  4X3S A;  1VMP A;  1U4M A;  5D65 A;  1F9Q A;  1B3A A;  1MGS A;  1WTO A;  4IUV A;  2K04 A;  2MP1 A;  1BBX C;  4ZLT F;  2L9H A;  1VMC A;  3I3C A;  1BF4 A;  1O7Z A;  2RA4 A;  1IKL A;  1XYI A;  1G6Z A;  2BDN A;  1HA6 A;  2K01 A;  5JJZ A;  4QUF A;  1NAP A;  1F9R A;  2JP1 A;  3P7J A;  4MHE A;  5CBA E;  4CJ0 B;  1WTW A;  2L4N A;  1J8I A;  2FFK B;  1MSG A;  2RSO A;  1CM9 A;  1LV9 A;  2M2L A;  3ONA B;  1Q3L A;  1PLF A;  2RSN A;  5COY A;  4IUU A;  4O42 A;  2K1B A;  1ESR A;  3QO2 A;  1WVL A;  1QG7 A;  1G2T A;  4XT3 B;  1QE6 A;  1WTP A;  2K05 A;  2FIN B;  2R3Z A;  5DNF A;  4IUQ A;  2Q8T A;  1F9P A;  2HCI A;  1ILQ A;  4U68 A;  2EPB A;  2XIW A;  2NZ1 D;  1G91 A;  2KUM A;  4IUT A;  4X3K A;  1WTX A;  4OIK A;  1JE4 A;  1RHP A;  2B2W C;  3FDT A;  1HFN A;  2MJ8 A;  4OIJ A;  1EQT A;  1X3P A;  2JYO A;  2SDF A;  4ZKB B;  5EPJ A;  3KBX A;  4HSV A;  1U4P A;  1ILP A;  2B2U A;  4RWS C;  5AFW A;  2B2T C; 
#chains in the Genus database with same CATH topology
 2ZXO A;  3F8T A;  4IUN A;  1VQD A;  4NPS A;  2F0S A;  3KK7 A;  3OIQ A;  3M4P A;  5A2Q E;  1A3U A;  3T1Y Q;  3LWE A;  5IYC G;  1BR9 A;  3G6J B;  2B63 B;  5C4X B;  1YNN C;  3FMC A;  2MUY A;  5LMN Q;  1SRO A;  2VUM B;  1S5D D;  2KOL A;  2JJQ A;  5JJL A;  5CV9 A;  3J81 E;  1HZC A;  3DM3 A;  2HIX A;  1IL2 A;  1H9M A;  1KDB A;  4LF6 Q;  1FNW A;  2KED A;  2O5J C;  5FK9 C;  3G48 A;  3JAM L;  2QCP X;  1GO3 E;  3F1Z A;  1KLU D;  1EOT A;  1T9H A;  4KKS A;  4MTN A;  4IPH A;  1S3O A;  2RQX A;  4IPD A;  1EY5 A;  4M1U B;  3A55 A;  2EDG A;  2YTV A;  4DUY L;  4K5X A;  4LF4 Q;  4OXP A;  2M9V A;  3GTK H;  4K2L A;  3J7A V;  3I70 A;  1VF7 A;  3A7A B;  1JWM D;  1N32 L;  2MQH A;  3MA2 B;  2E5L Q;  1KXL A;  3J80 c;  1KTK A;  1EWI A;  1TWF H;  4LFC L;  3A56 A;  4IO9 A;  5IP9 G;  4HID A;  1EY0 A;  1PXU A;  2LKV A;  2PCF B;  3KF6 A;  4ZKC B;  4X3S A;  1PA6 A;  1F9Q A;  2E75 C;  2JQO A;  2R92 B;  2LFN A;  2WAC A;  1MJC A;  1SYD A;  2ATW A;  2EJM A;  1EIY B;  2JP1 A;  3P7J A;  3K0Y A;  3E6Z X;  1JT8 A;  1LTB D;  2RCN A;  1GKH A;  2ZTC A;  3FRP B;  1PMR A;  4A3K B;  2F0N A;  1VQN A;  3HOZ G;  4DUZ Q;  4RKL A;  2EJG C;  1A8V A;  1CKO A;  2WP8 J;  4RFB A;  5I4D A;  3BJU A;  4JI7 L;  2B8G A;  3KF6 B;  4LF7 Q;  2IWH A;  4YIJ A;  2NZ1 D;  4L5S A;  3HOU G;  3J81 i;  1SNP A;  4C3I G;  4JI6 Q;  4X62 L;  2EYM A;  2FMC A;  2R61 A;  3NSW A;  2K32 A;  3VR6 A;  1U9R A;  4HCS A;  2RKS A;  2PW5 A;  3CCL A;  1D8L A;  2I5M X;  4JOI A;  4P2C B;  4HED A;  5TSS A;  4MN3 A;  3CCJ A;  5FLM H;  1FD7 D;  2EYO A;  3PO3 B;  4J6H A;  2E2H B;  1CHQ D;  3DWA A;  1XNQ L;  2F0W A;  2KEE A;  4P75 A;  5BN5 A;  2F4V Q;  1N9W A;  3VYR A;  1JR0 D;  1D6E C;  2JA7 G;  1QZH A;  5JPN C;  2UXD L;  5LMU Q;  4JCV E;  3T1H L;  1CFM A;  2DUD A;  1K9M C;  1HNW L;  3P1H A;  3A0J A;  3HEJ A;  5JPM C;  3ULP A;  2GVA A;  4PQX A;  1PFB A;  2JA5 H;  2NVQ B;  3RZO B;  4TQU S;  3NBH B;  1LAC A;  3RZD B;  3NHH A;  5ELN A;  1WD1 A;  4HJA A;  1VQP A;  1TII D;  3CC7 A;  1J6Q A;  2RDH A;  4L5T A;  4PMC A;  4KKU A;  4GNX A;  3C3L A;  2A6H C;  2CWA A;  3S1N B;  2NVX H;  4DV5 Q;  4UDU C;  1GUT A;  1DGS A;  2UU9 L;  1MSH A;  3SE0 A;  1SLJ A;  4HJ9 A;  2F0I A;  4OGQ C;  1JE5 A;  1PFS A;  2B2T A;  2K5Q A;  5M5X B;  4A3E G;  1PH2 A;  3I4L A;  2Q2T A;  2E2J H;  1SMX A;  1GHJ A;  3BZK A;  1BBX C;  3SR1 A;  1IKL A;  4XYO A;  4I7A A;  4NB3 A;  5C3W A;  1CKM A;  4C2M H;  1WTW A;  1K83 B;  4LF5 L;  1PH4 A;  4LFA L;  4A3I H;  3HOW G;  1Y8O B;  2L15 A;  1XWE A;  4KY6 A;  4GKK Q;  4JI3 L;  4J8Q A;  1FVI A;  1HR0 Q;  4H13 C;  1PH5 A;  4O42 A;  5C44 B;  3W5O A;  1UE1 A;  1VQ8 A;  3CRL C;  2BOS A;  1ESF A;  4L6T B;  3FKI H;  1LTI D;  4OL7 A;  3JAM c;  2FIN B;  2QKI C;  3SEB A;  4IUQ A;  4KJN A;  4DR1 Q;  3EBE A;  2VZA A;  3QOL A;  1B44 D;  3S14 B;  2Q2U A;  4P73 A;  1LM0 A;  2MJ8 A;  3S2H H;  4L5Q A;  5M3F B;  3D6W A;  4OWX B;  2IHE A;  2I0Q A;  1B3Q A;  4CDC C;  1I5F A;  4DR2 L;  3URY A;  2R7F A;  3I8Z A;  5C3E H;  4DAV A;  5IE8 A;  1EU4 A;  2C9O A;  4C3H B;  1KDA A;  4QL5 A;  2FHT A;  1VQL A;  1SNQ A;  1OXV A;  5CMD A;  5DEH A;  2AQ2 B;  4DR5 L;  1BOS A;  2IPK D;  2XRS D;  1GOZ A;  1UEA B;  4ME5 A;  1SAP A;  4DR6 L;  4A3C H;  4XQN A;  4DA2 A;  5IGE A;  2EXZ A;  1WTQ A;  1BCP D;  2EXD A;  2WFW A;  3AQQ A;  2R93 H;  4EX5 A;  3CQZ B;  1II3 A;  1JWU D;  3H94 A;  5CBE E;  2HQE A;  4A3F B;  2F0P A;  5FLX E;  2PI2 A;  5EPL A;  3K5L A;  2Z6B A;  1FNV A;  2KQ3 A;  4OHJ A;  1EIF A;  4R4O A;  4YCW A;  4JV5 Q;  1X56 A;  1RF2 D;  2X6L A;  4HJ5 A;  2MGS A;  1EYC A;  3L3O C;  1HNX L;  1NE3 A;  2UUB Q;  1SNM A;  1I3Q B;  2FXQ A;  1PRT F;  2G9D A;  1JIC A;  2L11 A;  1DOK A;  5IYD H;  4B9W A;  3WWV A;  2LXK A;  3GTQ B;  4B3T L;  1XMO L;  1SYE A;  1NJI C;  5FJ8 H;  3ICE A;  5C3X A;  1KC8 C;  5IGF A;  3C1F A;  1ET6 A;  5E1F A;  2YU9 H;  4GN5 A;  2K14 A;  2Z1C A;  1N36 L;  5IGG A;  3TBI B;  4P71 A;  3MXN A;  4CKE A;  1EYA A;  5IWA Q;  3TME A;  2A6H D;  1MSG A;  2F3V A;  3BDO A;  4ULL A;  1MJE A;  2Z0S A;  2PZU A;  2EY5 A;  2ZXP A;  4HMJ A;  4XT3 B;  3CPW A;  2KHS A;  4AYB G;  5JJI A;  1G51 A;  5DNF A;  3G6E A;  1SYG A;  2CKZ B;  4K5V A;  4C3J G;  2JA6 H;  2LY7 A;  1RCV D;  2F0V A;  3HKZ G;  4IUT A;  3V05 A;  4KHP L;  4BBS H;  3QR8 A;  3W1B A;  4RMF A;  4DK1 A;  1KRT A;  1HUN A;  3MXN B;  2VQF Q;  1JJG A;  4JI0 L;  4ZCK A;  1CTM A;  1SSO A;  3VYU A;  4LUO A;  5C4X G;  5CV6 A;  1H9J A;  1SJH D;  4OX9 Q;  2BE5 C;  5EBD A;  3HOZ B;  4WOR A;  4RAU C;  5JEA H;  1D7Q A;  5ELD A;  1KAW A;  4DV6 L;  2RCF A;  1JOO A;  1HNZ L;  1PZK D;  1JB7 A;  5EKL A;  3HKS A;  4RGO S;  5IT9 E;  3HOU B;  4DXG A;  4DV4 Q;  1FJG Q;  5JVG 3;  1VQO A;  4C3I B;  1XXG A;  3ITP A;  3CMA A;  2B29 A;  4ZK9 B;  4CJ2 C;  3SDZ A;  1I4P A;  1SE4 A;  3GTO H;  4GOP C;  3D4R A;  3SVM A;  1EIH A;  2F0K A;  3TQY A;  1XJV A;  1P16 A;  3KDF A;  4LF9 L;  2R7Z H;  4BY1 G;  3GQB A;  2DNC A;  4DNI A;  4B3M Q;  2XSC A;  4JYA L;  2CQO A;  2JXM B;  1PH9 A;  2A69 D;  3CU7 A;  1S5B D;  4UHV A;  5IYB H;  3X3M A;  3V2T A;  2A73 B;  3K6O A;  5I6Y A;  2HDM A;  2JA7 B;  1HJP A;  1STY A;  2OT2 A;  2CW0 C;  2OQ0 A;  1Q81 C;  3L2P A;  2I5L X;  1D1K A;  5KYI A;  1TWH H;  1DOL A;  3DMU A;  3BS1 A;  2PZW A;  1SYB A;  1HH2 P;  3S17 B;  3KYH C;  1HZA A;  3KDF B;  3I3C A;  4QF4 A;  4A3J H;  4JW0 A;  2K50 A;  4KN4 C;  1SYF A;  1EFW A;  1TWA B;  2H4O A;  4JBW A;  1GM5 A;  3GTL B;  3TS2 A;  3K59 A;  2L4N A;  3NQI A;  4A3B H;  3A8J E;  4G57 A;  3OTO L;  4A3D H;  3BZC A;  4BY7 B;  4OEM B;  2M00 A;  3G71 A;  1A6X A;  2RSN A;  5COY A;  1ONL A;  3HFZ B;  2VS1 A;  5IIF A;  4FO2 A;  3H15 A;  2MNA A;  4ID6 A;  4OWW B;  1ASY A;  4XQJ A;  1F9P A;  2NB0 A;  2JA9 A;  2IX0 A;  2I46 A;  4WRD A;  4CDD C;  4JBJ A;  2H5X A;  4X3K A;  1PH7 A;  5F2D A;  2A74 C;  2PI2 E;  2F03 A;  2QF7 A;  4A76 A;  3T1Y L;  2B2Y C;  1H9R A;  3MTS A;  3HOW B;  3ER0 A;  4XDX A;  2YV5 A;  2OQK A;  5LMN L;  3NP8 A;  2L0C A;  2Z6K C;  2F0F A;  4LW1 A;  4EVO A;  4NXN L;  4J1M A;  1EEF D;  2K03 A;  3GO5 A;  4DAP A;  3K7U C;  2CQA A;  4ME3 A;  3WOE A;  4QUC A;  2JN4 A;  1IKM A;  4LF8 L;  1B70 B;  2F0J A;  1JB3 A;  1WTR A;  5IP7 G;  1L0Y B;  2N88 A;  4N8F A;  3RNU A;  5FJ8 G;  2WAQ G;  4YWK A;  1AZQ A;  2KEN A;  4BA2 I;  2HHH Q;  3DEO A;  2JEB I;  4G4K A;  4X66 Q;  3GTK B;  1GUN A;  5M5W B;  4N9T A;  3KLR A;  4AH6 A;  2VY3 A;  4LK1 C;  4HJ7 A;  3BYT B;  4LF4 L;  2PYK A;  2BE5 D;  1TU2 B;  5L37 A;  5K36 H;  3VR4 A;  2D5D A;  1CHP D;  1VDZ A;  1SR3 A;  4IZ8 A;  3NQT A;  2LXJ A;  3IFD A;  2OTJ A;  3WOF A;  4BWG B;  2KJX A;  2BH2 A;  4QJF A;  2ID0 A;  1X3E A;  1CI3 M;  5J1Z A;  1K73 C;  1J5E Q;  3I4N H;  3FP9 A;  1JOR A;  3K58 A;  2EY1 A;  3QIA A;  2EYH A;  2E2D C;  1UE7 A;  1IYJ B;  4Z9C B;  1Q1E A;  1D5X C;  3VA5 A;  3M4O H;  2L9H A;  1SFO H;  4K8J A;  1STE A;  2F0L A;  2DJG C;  2HIV A;  3U50 C;  2K5H A;  3NK9 A;  1AW7 A;  1Q7Y C;  1XNR L;  4DKA C;  2E76 C;  4A3M H;  4LUZ A;  1J8I A;  4QIW B;  3EIV A;  2VNU D;  3H0G H;  3EN2 A;  3ZYY X;  1PYS B;  3HG9 A;  2UUA Q;  5C44 G;  2A5H A;  1EQR A;  1NBW A;  4LF7 L;  3OW7 A;  1PYB A;  1Q86 C;  2Q8T A;  1D5M C;  2L5T A;  4QY7 A;  4UP8 A;  3MXP A;  2JA8 G;  4PZ7 A;  2Q2H A;  1X54 A;  4YWM A;  3UDF A;  4BBR H;  1R9T H;  2WKC A;  3CCR A;  3PO2 H;  5J39 A;  4DF7 A;  4OO1 I;  2B2V C;  4AQY Q;  3TZU A;  1UAP A;  3QWN A;  3TP6 A;  2NN6 G;  2F0H A;  5D3I B;  5IGC A;  1ICF B;  4DN4 M;  2EOT A;  4AYB B;  1KAB A;  4O2D A;  2F4V L;  4C3J B;  5HGT A;  2K5N A;  1UUP A;  2H1E A;  1RDP D;  2D0P A;  5NUC A;  4F8M A;  3HKZ B;  3AFP A;  1VF5 C;  5LMN W;  3GTG H;  2NTS A;  1NSN S;  3W1G A;  4A3G G;  1IZ6 A;  1PVO A;  4A3F G;  1J9O A;  1Y1W H;  3S1M H;  1BNZ A;  3G7L A;  3MWY W;  1ZEQ X;  1UE5 A;  3M4Y A;  4DV5 L;  3AEV A;  4IJL A;  1CQV A;  1PTO H;  1FGU A;  3I91 A;  3S1Q H;  1YHB A;  1LLR D;  1UWV A;  3NWS A;  1KD1 C;  4BXX G;  1LTL A;  1QOH A;  4IUR A;  1SN8 A;  4NKL A;  3VDY A;  3HOV G;  2N8N A;  5JOB A;  1LT6 D;  2PO4 A;  4C2M B;  3N6R A;  4ABN A;  4IUV A;  3PQI A;  4BY1 B;  4PNY A;  1AEX A;  1OXT A;  5J3B A;  2UXC Q;  4CHT B;  4QB4 A;  2WB1 G;  3GTM B;  1UEB A;  4PG3 A;  4GKK L;  3J80 E;  3IAY A;  4MHE A;  3FKI B;  3K0X A;  5C0X G;  1HR0 L;  3E9I A;  2AMC B;  4PZ8 A;  4KTA A;  3D4W A;  4KV6 A;  5JVH 3;  4A93 H;  4N8X 1;  1EWC A;  1RIP A;  1NUC A;  5I6W A;  3S16 B;  5LHY 1;  4DR1 L;  1YVC A;  3BYY B;  1QB5 D;  4Y7N B;  4GZY C;  1CQF A;  4IFD G;  2LMC B;  2R3Z A;  5JAV A;  3KF8 A;  4FF2 A;  4POG A;  3C46 A;  1I4X A;  4L5R C;  2QEJ C;  5JJK A;  4OIK A;  1F2Z A;  3M9B A;  4OIJ A;  5IGB A;  2SDF A;  1R4P B;  4U67 3;  1H9S A;  1DM0 B;  1V43 A;  2UXB Q;  3N52 A;  2ICI A;  3CCS A;  4JI4 L;  2B8F A;  1BKB A;  2EYF A;  5C0X J;  1PDQ A;  5E4X A;  3EA6 A;  3HOY H;  4RHS A;  5EJW A;  5EQ0 A;  3U58 A;  1TWC H;  4YCU A;  4CJ1 B;  3A8K E;  1XPR A;  1LTS D;  5IGD A;  1XTC D;  3TZD A;  1TS5 A;  2R6G A;  4GN3 B;  2J0T D;  3BG3 A;  1U0L A;  3NXW A;  5CV5 A;  2CVR A;  1BCP C;  4IFD J;  1PZI D;  1ROD A;  2GA4 B;  4RCN A;  5M3M H;  1NR4 A;  2PMZ E;  3HS0 C;  2JK8 A;  1EY9 A;  1L1O C;  2F0G A;  3MXU A;  1H9S B;  1B1Z A;  2OTL A;  3Q6S A;  5FLX L;  1GXD C;  4RGT A;  4RHR A;  4JV5 L;  1C48 A;  1ML0 D;  2YTX A;  1G2S A;  1I50 H;  1MI2 A;  1SJE D;  4DV2 Q;  2RF4 A;  2AUJ D;  5ELB A;  2UUB L;  2B2U C;  4FXD A;  3E0E A;  1E1T A;  4AYB E;  3HOX H;  4DNT B;  5FO7 B;  2ES2 A;  1YJW A;  2WAQ B;  5FKA C;  3Q23 A;  4R9W A;  2HCC A;  3HKZ E;  4BBR G;  1KNE A;  1I6V C;  1VQG A;  2K28 A;  1TR5 A;  1YJ9 A;  1JC7 A;  1E2Z A;  1LTR D;  3PUV A;  2YYZ A;  2NTT A;  4LFB Q;  2RHS B;  1Y1V H;  5IWA L;  2NVT H;  1PTO D;  5M5Y H;  1JJ2 A;  2NVY H;  1PYW D;  3W2D A;  2L55 A;  5E3F A;  3DWP A;  4NDX A;  4OON A;  4G7H C;  4BY7 G;  3PMF A;  3CXC A;  2P5Z X;  1PLF A;  2VB3 X;  1A3T A;  3I4M H;  4JG2 A;  3H09 A;  4DK0 A;  2K05 A;  4JBK A;  1I4G A;  5C5M A;  1HTL D;  4KD3 A;  4MZ9 A;  4RH6 A;  1HR0 W;  4GOP A;  1C7Y A;  4K0K Q;  4K6L A;  1X3G A;  2B63 H;  2EY6 A;  2IT1 A;  1ENA A;  4JBM A;  1QVF A;  2DN8 A;  1CKN A;  2VQF L;  3A74 A;  1EFI D;  4Y52 H;  2B3G A;  2UUC Q;  2QW7 A;  2BH8 A;  1SE2 A;  2VUM H;  4GNX B;  2IHF A;  4B3S Q;  2QEX A;  4OX9 L;  2KCM A;  3JAM E;  2FMM A;  3M3Y B;  3RLF A;  3GTJ H;  1M8A A;  2A68 C;  3S1R B;  1GUW A;  4QGU A;  4A4I A;  2JA8 B;  2SNS A;  4DV4 L;  2G5D A;  4V0B A;  4QCL A;  1FJG L;  4KK7 A;  5FO8 B;  1IL8 A;  4GOP B;  3SK4 A;  4RGM A;  5GAH C;  3X3N A;  1AZP A;  3TP8 A;  1LTA D;  2HD3 A;  1CKN B;  1STB A;  1QUQ A;  4F88 A;  4HIK A;  3EJI A;  1TKW B;  3DM1 A;  4H02 A;  1HFG A;  2ALY B;  2GVB A;  3GV6 A;  4L8J A;  4R4T A;  2OXP A;  3DLL A;  4WJ3 M;  1DD2 A;  3DEP A;  3WDN A;  4KKT A;  1T5E A;  2A69 C;  1IYV A;  1RJT A;  2IL8 A;  4DAY A;  5GRO A;  3K57 A;  1TWH B;  2V4D A;  3TRE A;  1YEZ A;  5E4W C;  5EPK A;  1TT2 A;  1H9K A;  2L1B A;  2BCO A;  2SEB D;  4KY5 A;  2R92 H;  3IRB A;  3CCM A;  1QNU A;  4A3G B;  2VW9 A;  1ET9 A;  3LX0 A;  1QUQ B;  2B2Y A;  4O1N A;  3QB3 A;  4N9P A;  1U4M A;  3TSS A;  1NMF A;  1X65 A;  2Z6K A;  1G6Z A;  5C4H A;  1HA6 A;  3HOY G;  3RD4 A;  3SK5 A;  1D5Z C;  2JSO A;  4IN3 A;  1ZYR C;  1E7Z A;  3CC4 A;  3FPP A;  4ZUI A;  3QG1 A;  2E8G A;  3JAM i;  4K8I A;  3K81 C;  2ASB A;  3HOV B;  2ZM6 Q;  1WTP A;  2WAQ E;  1EOV A;  3CME A;  1M90 C;  3HGB A;  1HCZ A;  4DV7 Q;  5FLX c;  3R2T A;  2Z8L A;  2KUM A;  2JE6 I;  5EAY A;  2WB1 B;  3T51 B;  4OO1 H;  4OEL B;  1WTX A;  1EEI D;  4QQB X;  3KJP A;  3VR5 A;  2XN9 C;  3RUZ A;  5FLM G;  1F2Y A;  3I55 A;  4I7Z C;  1TS3 A;  1V1Q A;  1ILP A;  2I5H A;  3CF5 A;  1TS4 A;  2E2H H;  4HMI A;  3ND8 A;  3R3O A;  4DPG A;  1OO9 B;  3S2D H;  4GS3 A;  4EQO A;  4IOA A;  3OW2 A;  4KLK A;  1JJC B;  5D3D A;  2RHQ B;  2BA1 A;  4BS9 A;  3I90 A;  2EQS A;  3MVV A;  4DR7 Q;  1SDF A;  2NVQ H;  2JA5 G;  4KI0 A;  3RZO H;  1X9N A;  1HZB A;  4V19 0;  3OMC A;  1EL0 A;  2DY8 A;  1NCV A;  4PV1 C;  3CCU A;  1L2F A;  3K5N A;  1TWG B;  3D3R A;  1CUK A;  4UP9 A;  1Y8N B;  1EZ8 A;  1K8A C;  1E24 A;  2A68 D;  1M4V A;  4B3R Q;  4EQN A;  3CCE A;  1DYQ A;  1QNK A;  3UDI A;  3PF5 A;  2XGT A;  4S3S A;  3IL8 A;  1J5E L;  4K5W A;  2XWJ B;  5G3L F;  3M4O B;  3CHB D;  1Q82 C;  3R8B A;  5FO9 B;  3GV3 A;  1DON A;  1A15 A;  2N78 A;  1K83 H;  1IW7 C;  2B2V A;  4DV3 Q;  4A3M B;  1LT3 D;  4A3I G;  1MGS A;  1JQY D;  3T13 A;  3V96 A;  1STN A;  3K5O A;  2XRQ D;  2NZO A;  4HR7 B;  1IBK Q;  2PQA A;  4KMU C;  1V8Q A;  2D62 A;  3U9O A;  4QUF A;  2IW3 A;  1NAP A;  2CFM A;  4Q0F A;  2G9H D;  1RD9 D;  3FKI G;  2UUA L;  1JOQ A;  2FFK B;  2WV6 D;  2VB2 X;  2WKD A;  3L9A X;  1WJJ A;  5A35 A;  3S14 H;  1R4Q B;  5M9O A;  4DR2 Q;  5DLQ E;  4GN4 B;  2C35 B;  1N34 Q;  1WVL A;  4BBR B;  1MBY A;  1Q46 A;  1I94 Q;  1VS0 A;  1R9T B;  1K8M A;  1CZW A;  5M3F H;  1STG A;  1WOC A;  1K8O A;  3NTI A;  1GHK A;  3BVM A;  5C3E G;  3RMH A;  1S40 A;  5I2X A;  1EYG A;  2CHB D;  4IPG A;  1STH A;  4NMZ A;  1JE4 A;  3RLN A;  1EQT A;  4EQP A;  2PQA B;  4O0A A;  3VYT A;  1WYD A;  4AQY L;  4F7X A;  4DV1 Q;  1V1O A;  3A54 A;  1RKN A;  1X3Q A;  1S5C D;  1ZYR D;  2E2I B;  1IYU A;  2KHI A;  2MPM A;  4A3C G;  1LYL A;  3GTG B;  3SHL A;  1XYI A;  1TY2 A;  3ZJY C;  2Z4I A;  1BBU A;  2RVL A;  2R93 G;  3CQZ H;  3F2C A;  1BXT A;  1BVS A;  1JWS D;  4X65 Q;  3T4A C;  5CR3 A;  3K8A A;  3S1M B;  5IYC H;  1C8C A;  4PMW A;  4IPC A;  5BR8 Q;  1VQJ A;  4DR4 Q;  3PV0 A;  3T16 A;  1AFP A;  5CGK A;  1Q8K A;  2WB1 E;  1D2B A;  4X6A H;  2RDF A;  1DCZ A;  4P72 A;  2MFI A;  4TKO B;  1E1O A;  5A2Q L;  1UE6 A;  4TSS A;  1B2T A;  3S1Q B;  1YHA A;  5E7N A;  4HSP A;  2Z4H A;  1KL9 A;  3UDG A;  1KNA A;  4MIU A;  4JC0 A;  4B3T Q;  1O80 A;  1AP0 A;  4PMB A;  2Q8I B;  3RR5 A;  2ENB A;  5IYD G;  3E0J A;  3J81 L;  4DR3 Q;  4LF6 L;  5IY0 A;  3H91 A;  2QA4 A;  4YY3 Q;  3FEW X;  1YBY A;  4JI1 Q;  2IX1 A;  1BUV T;  2ZTD A;  2NZH A;  3FPU B;  4R8I A;  1O7Y A;  3I72 A;  1F9S A;  3F2U A;  1AN8 A;  5KEE A;  4YHH Q;  1OXS C;  1NR2 A;  2UXC L;  2AWN A;  3CPF A;  4H7B A;  1EY7 A;  2BA0 A;  5C5L A;  4KD4 A;  1TWF B;  1FGB D;  4MTK A;  1H95 A;  1KIX A;  1N8R C;  2E5L L;  1VQH A;  4A3L H;  1EYD A;  2Y0S G;  1XPU A;  2JA6 G;  1BQQ T;  1ESR A;  4BBS G;  1QG7 A;  1QIL A;  4JI0 Q;  1L1O A;  1IW7 D;  1VQ6 A;  1QCB D;  1CK1 A;  4DV0 Q;  1EY4 A;  1SNO A;  3HOZ H;  1RHP A;  2B2W C;  4C1N I;  3HOY B;  1TWC B;  5EPJ A;  5JEA G;  4HSV A;  1U4P A;  2B2U A;  5AFW A;  2PPB C;  5KND A;  5KNC A;  4DUZ L;  4NXM Q;  1EWH A;  1VQM A;  1YZ6 A;  3S15 H;  4APV A;  3PGZ A;  3CRK C;  4XT1 B;  3H3V I;  3J7Z C;  1BCP B;  1IHZ A;  4X3T A;  5CV8 A;  3QJY A;  4C3I H;  2D9U A;  1RTO A;  1PH6 A;  1CA6 A;  1S5E D;  3AB9 A;  4LF9 Q;  1KLG D;  1YJN A;  1L1O B;  2AQ1 B;  4JI6 L;  4XQQ A;  2OF1 A;  3STB D;  2R7Z G;  2ZXR A;  2MO1 A;  4JK1 C;  1I50 B;  4X64 Q;  4GLA C;  4HTH A;  1WD0 A;  4XXE A;  3OYY A;  1EIG A;  2VQE Q;  4ZUJ A;  2X69 A;  1XMQ Q;  5IYB G;  4DV2 L;  3NTK A;  5JEA J;  3EQL C;  3RN5 A;  1KRS A;  1RTN A;  1X32 A;  3KUP A;  2O5I C;  5I2Y A;  1LO5 D;  2NYZ D;  3OIP A;  5J22 A;  2VXW A;  2DNE A;  3OPO A;  5LMU L;  1MIU A;  2JA5 B;  1SE3 A;  2EYJ A;  3TP7 A;  1Y1V B;  3OTO Q;  2NVT B;  1B53 A;  4A3J G;  3BDC A;  2GN5 A;  4LAA A;  3VR2 A;  1TWA H;  3GTP H;  5DM7 3;  3GTL H;  4LFB L;  5M5Y B;  2NVY B;  4A3B G;  1C0A A;  2NVX B;  3B6Y A;  4A3D G;  2F0M A;  3H6M A;  4JI5 Q;  3O13 A;  4B08 A;  1C9O A;  1Z6H A;  3CC2 A;  1VMC A;  1O7Z A;  1VQB A;  4JVZ A;  1PTO C;  1TQO A;  2K01 A;  3RN2 A;  1PRT C;  2F0O A;  2K5V A;  4A3E H;  4F87 A;  2E2J B;  2RSO A;  1Y69 U;  1CM9 A;  1XTD A;  2E74 C;  1LV9 A;  2M2L A;  1Q12 A;  3ONA B;  4QMG A;  4EGV A;  4RCO A;  3TS0 A;  2K1B A;  1D1I A;  4CBV A;  4K0K L;  4KN7 C;  4A3I B;  3HOW H;  4GKJ Q;  1TY0 A;  4NXN Q;  2UUC L;  4H0L C;  3GTJ B;  1HQR D;  1K3R A;  4B3S L;  1S5F D;  2YTY A;  2JYO A;  4WJ4 A;  1C4Q A;  4ZKB B;  4LF8 Q;  3KLW A;  5BN3 A;  4UY8 C;  4RWS C;  2JEA I;  1E0B A;  3J81 c;  4G7O C;  4I65 A;  1MD2 D;  2EY2 A;  4NP5 A;  1NY4 A;  1I6H H;  5HY6 A;  5LL6 S;  2TSS A;  3MFG A;  3TN2 A;  1W3S A;  2FJ2 A;  3S2H B;  1B8A A;  1SNC A;  2LSS A;  4UAI A;  1HZ9 A;  3AFQ A;  5C3E B;  1HHV A;  2HT1 A;  1GUO A;  2HUG A;  2Q8R E;  1IBL Q;  3PIP A;  3RLO A;  5M5W H;  1PHJ A;  1NNX A;  2XWB B;  1PFN A;  1IBM Q;  3FHW A;  4FYD A;  4WFN 3;  3K7A H;  2NN6 I;  5K36 G;  3MZ5 A;  3KLS A;  3TEH B;  3CD6 A;  1PFM A;  1ASZ A;  1MHW C;  2J7Z A;  3NE5 B;  3SXH A;  3PUZ A;  4JI8 Q;  4NW2 A;  1DXM A;  1B4O A;  4A3L G;  5EBC A;  3NWT A;  4QIW E;  2KCC A;  1E22 A;  4DNR B;  1U4L A;  2V1C C;  1RL2 A;  2R93 B;  3ERO A;  3I4N G;  3CCQ A;  2ZJP A;  1X3F A;  1E3P A;  3KF8 B;  5KRU A;  4KY7 A;  2NWG A;  4ODG A;  3TRZ A;  1XNR Q;  3HP3 A;  4POF A;  1HA5 A;  1F77 A;  4ZAI A;  1XPO A;  3ERQ A;  1Q1B A;  4FDB A;  1ZXT A;  1SEB D;  1WFQ A;  3ND9 A;  4A3M G;  1VMP A;  3H0G G;  1WTO A;  4E6I A;  1YHQ A;  3D31 A;  4CDF C;  5AJ3 Q;  2MO0 A;  2BDN A;  5JJZ A;  3IFT A;  3J80 i;  2A8V A;  4JI2 Q;  1IXR A;  1WCM H;  4J15 A;  4OWT B;  3AMU A;  1EQQ A;  3Q0A A;  2QDB A;  2ZM6 L;  2YU9 B;  2EYL A;  1VQE A;  3NBH A;  2F0E A;  3NTH A;  2ZJQ A;  4DV7 L;  3E5S A;  4KHV A;  1AE3 A;  5KIX A;  1LT5 D;  3PO2 G;  1K3B C;  2PQE A;  2A6E C;  1EU3 A;  1SRU A;  2HCI A;  5GAD C;  2EJF C;  5C0X I;  2XIW A;  4FF3 A;  3S2D B;  5ELE A;  3A5Z B;  2XVS A;  1Y8P B;  3K80 C;  2CWP A;  1I4H A;  3A5U A;  2F52 A;  3BU2 A;  1PRT D;  1VQI A;  4ALP A;  4C3J H;  2Y0S B;  1N33 Q;  2JA6 B;  1ENF A;  4IFD I;  4FF1 A;  4LNQ A;  4BBS B;  1YNN D;  1E2V A;  5C4J H;  1LTG D;  1PZJ D;  3AYH B;  4DR7 L;  4IOC A;  1K28 A;  2NBF A;  2SOB A;  4R4I A;  5I9O A;  4XIG S;  1QWY A;  3M7G A;  1Y1W G;  5C4X H;  3LGJ A;  3PUY A;  4PZ6 A;  4LMQ D;  3NBI A;  4XYQ A;  5T1I A;  3GP7 A;  1BBW A;  3R2I A;  3S24 A;  3SK6 A;  3P20 A;  2C5C A;  1HUM A;  3DXJ C;  1TVX A;  5ELC A;  2KBN A;  4B3R L;  5DAU A;  4X3U A;  4MNO A;  2BDO A;  1PH3 A;  2DJF C;  1PH1 A;  3HZX A;  1YNJ C;  1FNU A;  1I4R A;  1Q8I A;  2EE1 A;  3GTO B;  3I73 A;  5T1G A;  3Q8D A;  5IT9 L;  4DUY Q;  5EKI A;  4A75 A;  3E3X A;  2CCZ A;  2R7Z B;  2WIN B;  4BY1 H;  1ICW A;  2PNR C;  1B7Y B;  4DV3 L;  2IJ0 A;  3GTM H;  4XTC S;  4L63 B;  1N32 Q;  3D6C A;  4B3M L;  4EQ5 A;  5K5P A;  2TMP A;  1IBK L;  4FXG C;  4LFC Q;  3MEF A;  3PIP 3;  4A93 G;  1M1K C;  3I7F A;  3S16 H;  2RA4 A;  1SND A;  3A7L A;  1Z9F A;  1W2B A;  1G6P A;  5CBA E;  3L0O A;  5G3L D;  4Y7N H;  3P75 A;  1X55 A;  1N34 L;  1B9N A;  2OCE A;  3S9W A;  1I94 L;  3CW2 C;  1B9M A;  1OXX K;  2NUC A;  4UPA A;  4A3J B;  3PSI A;  3QO2 A;  3CP0 A;  1G2T A;  3MXG A;  4R4C A;  3MAQ A;  4JI4 Q;  1V9P A;  4A3B B;  2WII B;  4A3D B;  4U68 A;  4A3K H;  3W3A A;  4JI7 Q;  1OXU A;  4DV1 L;  3C2P A;  4AIM A;  1HFN A;  1W6J A;  1QVG A;  1AH9 A;  3U4Z A;  2F0Q A;  3H3V C;  4DAY B;  3BVG A;  4DAM A;  4HJ8 A;  3H3V H;  1WTV A;  3BDL A;  3GDE A;  4C56 C;  4X62 Q;  1L0W A;  5IOD A;  1BDO A;  3I56 A;  2AQ3 B;  3MHB A;  4HN7 A;  1DOM A;  4X65 L;  5M3M G;  1VQ5 A;  4FNF A;  1OTC A;  2A6E D;  3UI2 A;  2K75 A;  4KHZ A;  5BR8 L;  5CV4 A;  4BA1 I;  3D0F A;  4ZRZ A;  2AUK A;  4DR4 L;  2CH4 A;  4HIO A;  1XNQ Q;  1CZG A;  1PTO F;  3BZD B;  3D8G A;  2ICE C;  2EIF A;  3OHX C;  4M8A A;  4WJW A;  3F2D A;  3PO3 H;  2AWO A;  1KHI A;  2F3I A;  1Y14 B;  1Z47 A;  4DGZ A;  3HOX G;  2UXD Q;  3T1H Q;  1WCM G;  5IP7 H;  1HNW Q;  4HAE A;  1HRJ A;  2AHO B;  2K5D A;  3PF4 A;  2Y0S E;  4H44 C;  3MEH A;  1VQ7 A;  3PIO A;  2HDL A;  4DR3 L;  3JC6 6;  3KFU A;  1B50 A;  4IQZ A;  4YY3 L;  4DK3 C;  4JI1 L;  1YIJ A;  4CKC A;  1UNS A;  3KOJ A;  1F2L A;  5BN4 A;  2HHH L;  1HPC A;  5KYL A;  4JOI C;  3RZD H;  4X66 L;  2X6G A;  4YHH L;  1DZ1 A;  4DK6 C;  2B2W A;  1Y1V G;  4ZYS A;  1Z7T A;  2RBM A;  2KEC A;  1E2W A;  5GAG C;  3Q24 A;  2UU9 Q;  1QVC A;  1P8L A;  2F0T A;  3S1N H;  2Z9H A;  1KDC A;  3MFY A;  4R4Q A;  4B9X A;  5C6A A;  1K0S A;  1A3V A;  1WI5 A;  2K04 A;  2MP1 A;  3KBG A;  3VYS A;  1BF4 A;  2LS0 1;  1YNJ D;  3I4M G;  3A8I E;  3FVQ A;  3I4N B;  5M5X H;  1HTP A;  1LUZ A;  1I4Q A;  3J81 j;  1FL0 A;  1G29 1;  1VQK A;  4IUU A;  4LF5 Q;  1SFO B;  2B63 G;  4LFA Q;  3C1E A;  3QOJ A;  1VQ4 A;  3SGI A;  4JI3 Q;  4DV0 L;  3HRZ C;  4GNX C;  4FP5 D;  2MHV A;  2PZT A;  2VUM G;  2ZT9 C;  1GUS A;  3H0G B;  5I9P A;  2QGQ A;  3M3Y H;  3S15 B;  4LWC A;  1G91 A;  5H1S E;  4LJZ C;  5C44 H;  3FDT A;  3OMG A;  2OEO A;  4NXM L;  1O7I A;  2KHJ A;  3S1R H;  3KBX A;  4DU9 A;  5LL6 X;  1V1P A;  2O2L D;  2B2T C;  4TVA B;  2JA8 H;  1AE2 A;  2F4I A;  1BCP F;  5IT9 c;  3ERS X;  1QJO A;  1W6K A;  2A1A A;  4RG1 A;  3OOC A;  3TDQ A;  4C1N K;  3PO2 B;  1GVP A;  3I4O A;  1WTH A;  2K6A A;  4GLX A;  4ZQ3 A;  4CKB A;  4DXF A;  1QZG A;  4DR5 Q;  4C3H H;  2F1M A;  4Q5V A;  5CYU A;  4X64 L;  1CSP A;  2XTI A;  1VCI A;  3STB C;  1VQF A;  2NN6 H;  3IKJ A;  2ZTE A;  3TP5 A;  5FOB B;  2VQE L;  2OWO A;  4DR6 Q;  1EZ6 A;  4K2K A;  2KA7 A;  1XMQ L;  2Q2I A;  5ELO A;  2KCN A;  1K0R A;  1V1P B;  3M4Q A;  1A2T A;  3CKI B;  3E9H A;  1XX8 A;  3LNN A;  2F3W A;  2K4K A;  1S4Z A;  2R92 G;  1ENC A;  4CDE C;  4UP7 A;  4RKB A;  5CC4 A;  5DM6 3;  4A3G H;  4LUV A;  4A3F H;  3GTP B;  1Y1W B;  1S72 A;  2DY7 A;  2KCT A;  3KJO A;  2HQL A;  2CH4 W;  1SMY C;  4A3K G;  3NUC A;  5CV7 A;  1HNX Q;  1A63 A;  3GD7 A;  4FXK C;  1SE8 A;  2L12 A;  1PTO B;  4JI5 L;  3PUW A;  1YI2 A;  1PRT B;  4A3E B;  5D65 A;  1GD7 A;  1Q90 A;  1L0X B;  2R7D A;  3OWE B;  2SNM A;  4BXX H;  4ILW A;  1I3Q H;  3DHQ A;  3UE0 A;  4IAL A;  2J4X A;  5EKK A;  1XMO Q;  2XNA C;  3HOV H;  2O4X A;  3PUX A;  4YWL A;  4HIM A;  1F9R A;  1O78 A;  3K5M A;  4DFA A;  3L7Z C;  3GTQ H;  1TXY A;  3OWF A;  1N36 Q;  2VL6 A;  1LTT D;  1G8Z D;  3EVQ A;  3MC0 B;  3VR3 A;  4OO1 G;  3ULL A;  4GKJ L;  3PIO 3;  3I2Z A;  5C0X H;  3PO3 G;  1MKH A;  4TRD A;  4A93 B;  1JOK A;  1I6H B;  3M7N A;  3T56 B;  1FYC A;  5IP9 H;  1LT4 D;  1X6O A;  1YIT A;  3J80 L;  2IX3 A;  1X3P A;  4K6D A;  4IFD H;  5KNB A;  4KHP Q;  3SK8 A;  4K14 A;  4FVM A;  1JCK B;  4RA8 A;  5D14 A;  1VQ9 A;  3CAM A;  1PH8 A;  1CA5 A;  2QIL A;  3KLS X;  4CGY B;  1A62 A;  3J7A F;  4GLV B;  4R8N A;  1TS2 A;  1PV4 A;  1JMC A;  2I07 B;  1IBL L;  3K7A B;  4G7Z C;  3U4V A;  1SBB B;  3Q22 A;  1TWG H;  5GQO A;  1BO0 A;  2AKW B;  4P74 A;  4DV6 Q;  3F2B A;  1IBM L;  4IUP A;  4R1J A;  4KJO A;  5COR A;  3LWU A;  1YNX A;  1KQS A;  2UXB L;  2EZV A;  1HNZ Q;  2F0U A;  4JI8 L;  4HCE A;  3NEM A;  5ISR A;  2QDL A;  3NEN A;  3NPP A;  1U4R A;  2N3S A;  3HOU H;  3UDX A;  1FR3 A;  4RGN A;  3M85 A;  1NMG A;  1A0I A;  5M3M B;  5GAE C;  3R93 A;  1GJX A;  1GUG A;  2K52 A;  1CT1 D;  3PCO B;  4JYA Q;  2KVM A;  1SXT A;  1VQC A;  1LAB A;  2DGY A;  2D0O A;  1STA A;  3D4D A;  2B39 A;  3DWQ A;  3EFX D;  4FF4 A;  2N55 A;  2CW0 D;  1A2U A;  5HUR A;  1HXY D;  1NTG A;  2PW7 A;  1HQM C;  2PNH A;  3HOX B;  1EY6 A;  1O7L A;  3T53 B;  1WCM B;  1VQA A;  5AJ3 L;  1KAA A;  2N49 A;  2IY5 B;  2EVB A;  1EUJ A;  4IJH A;  2JA7 H;  1B3A A;  2K5W A;  3DUZ A;  4ZLT F;  2PMZ B;  2A19 A;  1U5K A;  4JI2 L;  2ZJR A;  2D2C C;  1EY8 A;  4CJ0 B;  5M3F G;  2RDG A;  1T5X D;  3J7Y W;  1DJR D;  3NEL A;  3S17 H;  1CSQ A;  2K33 A;  4C3H G;  1Q3L A;  1EQV A;  3UE1 A;  3AU7 A;  1SMY D;  5HGQ A;  3CCV A;  5C4Z A;  1QE6 A;  2EYP A;  3G4S A;  3U9S A;  1K8G A;  1ZKO A;  4YCV A;  3VA7 A;  4BY7 H;  1ILQ A;  2E2I H;  2EPB A;  5IOC A;  3BVZ A;  1F2M A;  2K7V A;  3ULJ A;  3I4M B;  5ELF A;  4JPB W;  1SYC A;  2F0D A;  5EGT A;  1N33 L;  3OSO A;  5C4J B;  3J7A 5;  5KGU A; 
#chains in the Genus database with same CATH homology
 2ZXO A;  4IUN A;  2F0S A;  3KK7 A;  3OIQ A;  5A2Q E;  1A3U A;  2B63 B;  3LWE A;  5C4X B;  1BR9 A;  3G6J B;  1YNN C;  3FMC A;  2MUY A;  2VUM B;  1S5D D;  2KOL A;  5CV9 A;  3J81 E;  1H9M A;  1KDB A;  1FNW A;  2KED A;  2O5J C;  5FK9 C;  3JAM L;  2QCP X;  1KLU D;  1EOT A;  4KKS A;  2RQX A;  1EY5 A;  4M1U B;  3A55 A;  2EDG A;  4K5X A;  2M9V A;  4K2L A;  3J7A V;  3I70 A;  1VF7 A;  3A7A B;  1JWM D;  3MA2 B;  1KTK A;  3A56 A;  1EY0 A;  1PXU A;  2LKV A;  2PCF B;  4ZKC B;  4X3S A;  1F9Q A;  2E75 C;  2R92 B;  2LFN A;  2WAC A;  1SYD A;  2EJM A;  2JP1 A;  3P7J A;  3K0Y A;  3E6Z X;  1LTB D;  3FRP B;  1PMR A;  4A3K B;  2F0N A;  4RKL A;  2EJG C;  2WP8 J;  4RFB A;  5I4D A;  2B8G A;  2IWH A;  4YIJ A;  2NZ1 D;  1SNP A;  4C3I G;  2EYM A;  2FMC A;  2R61 A;  3NSW A;  2K32 A;  3VR6 A;  1U9R A;  4HCS A;  2RKS A;  2PW5 A;  4P2C B;  4HED A;  5TSS A;  4MN3 A;  1FD7 D;  2EYO A;  3PO3 B;  4J6H A;  2E2H B;  1CHQ D;  3DWA A;  2F0W A;  2KEE A;  5BN5 A;  3VYR A;  1JR0 D;  1D6E C;  5JPN C;  1CFM A;  3P1H A;  3HEJ A;  5JPM C;  4PQX A;  1PFB A;  2NVQ B;  3RZO B;  4TQU S;  1LAC A;  3RZD B;  3NHH A;  1WD1 A;  1TII D;  2RDH A;  4PMC A;  4KKU A;  3C3L A;  2A6H C;  3S1N B;  4UDU C;  1GUT A;  1MSH A;  3SE0 A;  2F0I A;  4OGQ C;  2B2T A;  2K5Q A;  5M5X B;  3I4L A;  1GHJ A;  1BBX C;  3SR1 A;  1IKL A;  4XYO A;  5C3W A;  1WTW A;  1K83 B;  1Y8O B;  1XWE A;  4KY6 A;  4J8Q A;  4H13 C;  4O42 A;  5C44 B;  3CRL C;  2BOS A;  1ESF A;  4L6T B;  1LTI D;  4OL7 A;  2FIN B;  2QKI C;  3SEB A;  4IUQ A;  4KJN A;  3QOL A;  1B44 D;  3S14 B;  2MJ8 A;  5M3F B;  3D6W A;  3URY A;  3I8Z A;  4DAV A;  1EU4 A;  2C9O A;  4C3H B;  1KDA A;  2FHT A;  1SNQ A;  1OXV A;  5CMD A;  5DEH A;  2AQ2 B;  1BOS A;  2IPK D;  2XRS D;  1GOZ A;  1UEA B;  4ME5 A;  1SAP A;  4XQN A;  4DA2 A;  5IGE A;  2EXZ A;  1WTQ A;  1BCP D;  3CQZ B;  1II3 A;  1JWU D;  3H94 A;  5CBE E;  2HQE A;  4A3F B;  2F0P A;  5FLX E;  5EPL A;  3K5L A;  1FNV A;  2KQ3 A;  4OHJ A;  1RF2 D;  2X6L A;  2MGS A;  1EYC A;  3L3O C;  1SNM A;  1I3Q B;  1PRT F;  2G9D A;  1JIC A;  2L11 A;  1DOK A;  4B9W A;  3GTQ B;  1SYE A;  5C3X A;  5IGF A;  3C1F A;  1ET6 A;  5E1F A;  2Z1C A;  5IGG A;  3TBI B;  3MXN A;  4CKE A;  1EYA A;  3TME A;  2A6H D;  1MSG A;  2F3V A;  3BDO A;  4ULL A;  2PZU A;  2EY5 A;  2ZXP A;  4HMJ A;  4XT3 B;  2KHS A;  5DNF A;  1SYG A;  4K5V A;  4C3J G;  2LY7 A;  1RCV D;  2F0V A;  4IUT A;  3V05 A;  4DK1 A;  1HUN A;  1CTM A;  1SSO A;  3VYU A;  5CV6 A;  1H9J A;  1SJH D;  3HOZ B;  2BE5 C;  5EBD A;  4WOR A;  4RAU C;  5JEA H;  5ELD A;  1JOO A;  1PZK D;  5EKL A;  4RGO S;  5IT9 E;  3HOU B;  4DXG A;  5JVG 3;  4C3I B;  1XXG A;  3ITP A;  4ZK9 B;  4CJ2 C;  3SDZ A;  1I4P A;  1SE4 A;  3D4R A;  3SVM A;  1EIH A;  2F0K A;  3GQB A;  2DNC A;  2XSC A;  2JXM B;  2A69 D;  3CU7 A;  1S5B D;  3X3M A;  3V2T A;  2A73 B;  3K6O A;  5I6Y A;  2HDM A;  2JA7 B;  1STY A;  2OT2 A;  2CW0 C;  1D1K A;  5KYI A;  1DOL A;  3DMU A;  3BS1 A;  2PZW A;  1SYB A;  3S17 B;  3I3C A;  4QF4 A;  4KN4 C;  1SYF A;  1TWA B;  2H4O A;  4JBW A;  3GTL B;  3K59 A;  2L4N A;  3NQI A;  3A8J E;  4G57 A;  4BY7 B;  2M00 A;  1A6X A;  2RSN A;  5COY A;  1ONL A;  5IIF A;  4FO2 A;  4ID6 A;  4XQJ A;  1F9P A;  2NB0 A;  2IX0 A;  2I46 A;  4WRD A;  4X3K A;  5F2D A;  2A74 C;  2F03 A;  2QF7 A;  2B2Y C;  1H9R A;  3MTS A;  3HOW B;  4XDX A;  3NP8 A;  2L0C A;  2F0F A;  4EVO A;  4J1M A;  1EEF D;  2K03 A;  3GO5 A;  4DAP A;  2CQA A;  3WOE A;  4QUC A;  1IKM A;  2F0J A;  1JB3 A;  1WTR A;  1L0Y B;  2N88 A;  1AZQ A;  4BA2 I;  3DEO A;  2JEB I;  4G4K A;  3GTK B;  1GUN A;  5M5W B;  4N9T A;  3KLR A;  4LK1 C;  3BYT B;  2PYK A;  2BE5 D;  1TU2 B;  5K36 H;  3VR4 A;  2D5D A;  1CHP D;  1VDZ A;  4IZ8 A;  3NQT A;  3IFD A;  3WOF A;  4BWG B;  2KJX A;  2ID0 A;  1CI3 M;  5J1Z A;  1JOR A;  3K58 A;  2EY1 A;  3QIA A;  2EYH A;  2E2D C;  4Z9C B;  1Q1E A;  1D5X C;  3VA5 A;  2L9H A;  4K8J A;  1STE A;  2F0L A;  3NK9 A;  1AW7 A;  2E76 C;  1J8I A;  4QIW B;  2VNU D;  3ZYY X;  3HG9 A;  2A5H A;  3OW7 A;  2Q8T A;  1D5M C;  2L5T A;  3MXP A;  2WKC A;  5J39 A;  4DF7 A;  4OO1 I;  2B2V C;  3TZU A;  1UAP A;  3QWN A;  3TP6 A;  2NN6 G;  2F0H A;  5D3I B;  5IGC A;  4DN4 M;  2EOT A;  4AYB B;  1KAB A;  4C3J B;  5HGT A;  1UUP A;  2H1E A;  1RDP D;  5NUC A;  4F8M A;  3HKZ B;  1VF5 C;  2NTS A;  1NSN S;  1J9O A;  1BNZ A;  3G7L A;  3MWY W;  1ZEQ X;  3M4Y A;  1CQV A;  1PTO H;  3I91 A;  1LLR D;  3NWS A;  1QOH A;  4IUR A;  4NKL A;  5JOB A;  1LT6 D;  2PO4 A;  4C2M B;  3N6R A;  4ABN A;  4IUV A;  4BY1 B;  4PNY A;  1AEX A;  1OXT A;  4CHT B;  4QB4 A;  3GTM B;  3J80 E;  3IAY A;  4MHE A;  3FKI B;  5C0X G;  4KTA A;  3D4W A;  4KV6 A;  5JVH 3;  1EWC A;  1NUC A;  5I6W A;  3S16 B;  5LHY 1;  3BYY B;  1QB5 D;  4Y7N B;  4GZY C;  1CQF A;  4IFD G;  2LMC B;  2R3Z A;  5JAV A;  3KF8 A;  4FF2 A;  3C46 A;  1I4X A;  2QEJ C;  4OIK A;  1F2Z A;  4OIJ A;  5IGB A;  2SDF A;  1R4P B;  4U67 3;  1H9S A;  1DM0 B;  1V43 A;  3N52 A;  2ICI A;  2B8F A;  2EYF A;  5C0X J;  1PDQ A;  5E4X A;  3EA6 A;  4RHS A;  5EJW A;  5EQ0 A;  4CJ1 B;  3A8K E;  1LTS D;  5IGD A;  1XTC D;  3TZD A;  1TS5 A;  2R6G A;  2J0T D;  3BG3 A;  3NXW A;  5CV5 A;  2CVR A;  1BCP C;  4IFD J;  1PZI D;  1ROD A;  2GA4 B;  4RCN A;  1NR4 A;  3HS0 C;  1EY9 A;  2F0G A;  3MXU A;  1H9S B;  1B1Z A;  3Q6S A;  5FLX L;  1GXD C;  4RGT A;  4RHR A;  1C48 A;  1ML0 D;  1G2S A;  1MI2 A;  1SJE D;  2AUJ D;  5ELB A;  2B2U C;  4FXD A;  4DNT B;  5FO7 B;  2WAQ B;  5FKA C;  3Q23 A;  4R9W A;  2HCC A;  1KNE A;  1I6V C;  2K28 A;  1TR5 A;  1JC7 A;  1E2Z A;  1LTR D;  3PUV A;  2YYZ A;  2NTT A;  1PTO D;  3W2D A;  1PYW D;  2L55 A;  5E3F A;  3DWP A;  4NDX A;  4G7H C;  3PMF A;  1PLF A;  2VB3 X;  1A3T A;  4DK0 A;  3H09 A;  2K05 A;  1I4G A;  5C5M A;  1HTL D;  4KD3 A;  4RH6 A;  4K6L A;  2EY6 A;  2IT1 A;  1ENA A;  2DN8 A;  1EFI D;  1SE2 A;  3JAM E;  2FMM A;  3M3Y B;  3RLF A;  1M8A A;  2A68 C;  3S1R B;  1GUW A;  2JA8 B;  2SNS A;  4V0B A;  4QCL A;  4KK7 A;  5FO8 B;  1IL8 A;  3SK4 A;  4RGM A;  3X3N A;  1AZP A;  3TP8 A;  1LTA D;  1STB A;  4F88 A;  3EJI A;  1TKW B;  3DM1 A;  1HFG A;  3GV6 A;  4L8J A;  2OXP A;  1DD2 A;  3DEP A;  3WDN A;  4KKT A;  1T5E A;  2A69 C;  1IYV A;  1RJT A;  2IL8 A;  4DAY A;  3K57 A;  1TWH B;  2V4D A;  5E4W C;  5EPK A;  1TT2 A;  1H9K A;  2L1B A;  2BCO A;  2SEB D;  4KY5 A;  1QNU A;  4A3G B;  1ET9 A;  3LX0 A;  2B2Y A;  4O1N A;  3QB3 A;  4N9P A;  1U4M A;  3TSS A;  1G6Z A;  5C4H A;  1HA6 A;  3RD4 A;  3SK5 A;  1D5Z C;  2JSO A;  4IN3 A;  1ZYR C;  3FPP A;  4ZUI A;  3QG1 A;  4K8I A;  3HOV B;  1WTP A;  3HGB A;  1HCZ A;  3R2T A;  2Z8L A;  2KUM A;  2JE6 I;  2WB1 B;  3T51 B;  4OO1 H;  1WTX A;  1EEI D;  3VR5 A;  2XN9 C;  3RUZ A;  1F2Y A;  4I7Z C;  1TS3 A;  1ILP A;  1TS4 A;  4HMI A;  3ND8 A;  3R3O A;  1OO9 B;  4EQO A;  5D3D A;  2BA1 A;  4BS9 A;  3I90 A;  3MVV A;  1SDF A;  4KI0 A;  4V19 0;  3OMC A;  1EL0 A;  2DY8 A;  1NCV A;  4PV1 C;  3K5N A;  1TWG B;  3D3R A;  1Y8N B;  1EZ8 A;  2A68 D;  1M4V A;  4EQN A;  1DYQ A;  1QNK A;  4S3S A;  3IL8 A;  4K5W A;  2XWJ B;  5G3L F;  3M4O B;  3CHB D;  3R8B A;  5FO9 B;  3GV3 A;  1DON A;  1A15 A;  1IW7 C;  2B2V A;  4A3M B;  1LT3 D;  1MGS A;  1JQY D;  3T13 A;  3V96 A;  1STN A;  3K5O A;  2XRQ D;  4HR7 B;  4KMU C;  1V8Q A;  2D62 A;  3U9O A;  4QUF A;  2IW3 A;  1NAP A;  4Q0F A;  2G9H D;  1RD9 D;  1JOQ A;  2FFK B;  2WV6 D;  2VB2 X;  2WKD A;  3L9A X;  5A35 A;  1R4Q B;  5M9O A;  1WVL A;  4BBR B;  1MBY A;  1R9T B;  1K8M A;  1CZW A;  1STG A;  1K8O A;  3NTI A;  1GHK A;  3BVM A;  3RMH A;  5I2X A;  2CHB D;  1STH A;  4NMZ A;  1JE4 A;  1EQT A;  4EQP A;  3VYT A;  4F7X A;  1V1O A;  3A54 A;  1RKN A;  1X3Q A;  1S5C D;  1ZYR D;  2E2I B;  1IYU A;  2MPM A;  3GTG B;  3SHL A;  1XYI A;  1TY2 A;  2Z4I A;  2RVL A;  1BXT A;  1JWS D;  3T4A C;  5CR3 A;  3S1M B;  1C8C A;  4PMW A;  3PV0 A;  3T16 A;  1AFP A;  5CGK A;  1D2B A;  2RDF A;  1DCZ A;  4TKO B;  5A2Q L;  1B2T A;  4TSS A;  3S1Q B;  4HSP A;  2Z4H A;  1KNA A;  4MIU A;  1O80 A;  1AP0 A;  4PMB A;  2Q8I B;  2ENB A;  3E0J A;  3J81 L;  3H91 A;  3FEW X;  2IX1 A;  1BUV T;  3FPU B;  4R8I A;  1O7Y A;  3I72 A;  1F9S A;  3F2U A;  1AN8 A;  5KEE A;  1OXS C;  1NR2 A;  2AWN A;  4H7B A;  1EY7 A;  2BA0 A;  5C5L A;  4KD4 A;  1TWF B;  1FGB D;  1EYD A;  1BQQ T;  1ESR A;  1QG7 A;  1QIL A;  1IW7 D;  1QCB D;  1CK1 A;  1EY4 A;  1SNO A;  1RHP A;  2B2W C;  4C1N I;  3HOY B;  1TWC B;  5EPJ A;  5JEA G;  4HSV A;  1U4P A;  2B2U A;  5AFW A;  2PPB C;  5KND A;  5KNC A;  1EWH A;  4XT1 B;  3CRK C;  1BCP B;  1IHZ A;  4X3T A;  5CV8 A;  3QJY A;  2D9U A;  1RTO A;  1CA6 A;  1S5E D;  3AB9 A;  1KLG D;  2AQ1 B;  4XQQ A;  2OF1 A;  2ZXR A;  4JK1 C;  1I50 B;  4HTH A;  1WD0 A;  4XXE A;  1EIG A;  4ZUJ A;  2X69 A;  3NTK A;  5JEA J;  3EQL C;  1RTN A;  1X32 A;  3KUP A;  2O5I C;  5I2Y A;  1LO5 D;  2NYZ D;  3OIP A;  5J22 A;  2VXW A;  2DNE A;  3OPO A;  2JA5 B;  1SE3 A;  2EYJ A;  3TP7 A;  1Y1V B;  2NVT B;  1B53 A;  3BDC A;  4LAA A;  3VR2 A;  5DM7 3;  5M5Y B;  2NVY B;  2NVX B;  2F0M A;  3H6M A;  3O13 A;  4B08 A;  1Z6H A;  1VMC A;  1O7Z A;  1PTO C;  1TQO A;  2K01 A;  1PRT C;  2F0O A;  4F87 A;  2E2J B;  2RSO A;  1Y69 U;  1CM9 A;  2E74 C;  4QMG A;  1LV9 A;  2M2L A;  1Q12 A;  3ONA B;  4EGV A;  4RCO A;  2K1B A;  1D1I A;  4CBV A;  4KN7 C;  4A3I B;  1TY0 A;  4H0L C;  3GTJ B;  1HQR D;  1S5F D;  2JYO A;  1C4Q A;  4ZKB B;  5BN3 A;  4RWS C;  2JEA I;  1E0B A;  4G7O C;  4I65 A;  1MD2 D;  2EY2 A;  4NP5 A;  5LL6 S;  2TSS A;  3MFG A;  3TN2 A;  2FJ2 A;  3S2H B;  1SNC A;  4UAI A;  1HHV A;  5C3E B;  1GUO A;  2HUG A;  2Q8R E;  2XWB B;  1PFN A;  4FYD A;  4WFN 3;  2NN6 I;  5K36 G;  3MZ5 A;  3KLS A;  1PFM A;  3NE5 B;  2J7Z A;  3SXH A;  3PUZ A;  4NW2 A;  1DXM A;  1B4O A;  5EBC A;  3NWT A;  2KCC A;  4DNR B;  1U4L A;  2R93 B;  3ERO A;  5KRU A;  4KY7 A;  2NWG A;  4ODG A;  3HP3 A;  1HA5 A;  1F77 A;  4ZAI A;  3ERQ A;  1Q1B A;  1ZXT A;  1SEB D;  3ND9 A;  1VMP A;  1WTO A;  4E6I A;  3D31 A;  2BDN A;  5JJZ A;  3IFT A;  3AMU A;  3Q0A A;  2QDB A;  2YU9 B;  2EYL A;  3NBH A;  2F0E A;  3NTH A;  3E5S A;  4KHV A;  5KIX A;  1LT5 D;  2PQE A;  2A6E C;  1EU3 A;  2HCI A;  2EJF C;  5C0X I;  2XIW A;  4FF3 A;  3S2D B;  5ELE A;  2XVS A;  1Y8P B;  1I4H A;  1PRT D;  2Y0S B;  2JA6 B;  1ENF A;  4IFD I;  4FF1 A;  4BBS B;  1YNN D;  1E2V A;  1LTG D;  1PZJ D;  2NBF A;  2SOB A;  5I9O A;  4XIG S;  1QWY A;  3M7G A;  3PUY A;  4LMQ D;  3NBI A;  4XYQ A;  5T1I A;  3GP7 A;  3R2I A;  3SK6 A;  3P20 A;  2C5C A;  1HUM A;  3DXJ C;  1TVX A;  5ELC A;  5DAU A;  4X3U A;  2BDO A;  3HZX A;  1YNJ C;  1FNU A;  1I4R A;  1Q8I A;  2EE1 A;  3GTO B;  3I73 A;  5T1G A;  5IT9 L;  5EKI A;  2R7Z B;  2WIN B;  1ICW A;  2PNR C;  2IJ0 A;  4XTC S;  4L63 B;  3D6C A;  5K5P A;  2TMP A;  4FXG C;  3PIP 3;  2RA4 A;  1SND A;  3A7L A;  5CBA E;  5G3L D;  3P75 A;  1B9N A;  3S9W A;  1B9M A;  1OXX K;  2NUC A;  4A3J B;  3QO2 A;  1G2T A;  3MXG A;  3MAQ A;  4A3B B;  2WII B;  4A3D B;  4U68 A;  3W3A A;  1OXU A;  3C2P A;  1HFN A;  1W6J A;  2F0Q A;  3H3V C;  3BVG A;  1WTV A;  3BDL A;  4C56 C;  5IOD A;  1BDO A;  2AQ3 B;  3MHB A;  4HN7 A;  1DOM A;  4FNF A;  2A6E D;  3UI2 A;  4KHZ A;  5CV4 A;  4BA1 I;  4ZRZ A;  2AUK A;  1CZG A;  1PTO F;  3BZD B;  3D8G A;  2ICE C;  3OHX C;  4M8A A;  4WJW A;  2AWO A;  1Z47 A;  4DGZ A;  4HAE A;  1HRJ A;  2K5D A;  4H44 C;  3MEH A;  2HDL A;  1B50 A;  4IQZ A;  4CKC A;  1UNS A;  1F2L A;  5BN4 A;  1HPC A;  5KYL A;  2X6G A;  1DZ1 A;  2B2W A;  4ZYS A;  1Z7T A;  2RBM A;  2KEC A;  1E2W A;  3Q24 A;  2F0T A;  1KDC A;  3MFY A;  5C6A A;  4B9X A;  1A3V A;  2K04 A;  3VYS A;  2MP1 A;  3KBG A;  1BF4 A;  2LS0 1;  1YNJ D;  3A8I E;  3FVQ A;  3I4N B;  1HTP A;  1I4Q A;  1G29 1;  4IUU A;  1SFO B;  3C1E A;  3QOJ A;  3HRZ C;  4FP5 D;  2MHV A;  2PZT A;  2ZT9 C;  1GUS A;  3H0G B;  5I9P A;  3S15 B;  1G91 A;  4LJZ C;  3FDT A;  3OMG A;  2OEO A;  3KBX A;  4DU9 A;  5LL6 X;  1V1P A;  2O2L D;  2B2T C;  2F4I A;  1BCP F;  1QJO A;  1W6K A;  3OOC A;  3TDQ A;  4C1N K;  3PO2 B;  2K6A A;  4ZQ3 A;  4CKB A;  4DXF A;  2F1M A;  4Q5V A;  5CYU A;  1VCI A;  2NN6 H;  3IKJ A;  3TP5 A;  5FOB B;  1EZ6 A;  4K2K A;  2KA7 A;  2KCN A;  1V1P B;  1A2T A;  3CKI B;  1XX8 A;  3LNN A;  2F3W A;  1S4Z A;  1ENC A;  4RKB A;  5CC4 A;  5DM6 3;  3GTP B;  1Y1W B;  2DY7 A;  1SMY C;  3NUC A;  5CV7 A;  3GD7 A;  4FXK C;  2L12 A;  1PTO B;  3PUW A;  1PRT B;  4A3E B;  5D65 A;  1Q90 A;  1L0X B;  3OWE B;  2SNM A;  4ILW A;  3DHQ A;  4IAL A;  2J4X A;  5EKK A;  2XNA C;  2O4X A;  3PUX A;  1F9R A;  1O78 A;  3K5M A;  4DFA A;  3L7Z C;  3OWF A;  1LTT D;  1G8Z D;  3EVQ A;  3MC0 B;  3VR3 A;  4OO1 G;  3PIO 3;  5C0X H;  4TRD A;  4A93 B;  1JOK A;  1I6H B;  3M7N A;  3T56 B;  1FYC A;  1LT4 D;  3J80 L;  2IX3 A;  1X3P A;  4K6D A;  4IFD H;  5KNB A;  3SK8 A;  4K14 A;  4FVM A;  1JCK B;  4RA8 A;  5D14 A;  1CA5 A;  2QIL A;  3KLS X;  4CGY B;  3J7A F;  4R8N A;  1TS2 A;  2I07 B;  3K7A B;  4G7Z C;  1SBB B;  3Q22 A;  1BO0 A;  4IUP A;  4KJO A;  5COR A;  3LWU A;  2EZV A;  2F0U A;  4HCE A;  5ISR A;  3NPP A;  1U4R A;  1FR3 A;  4RGN A;  3M85 A;  5M3M B;  3R93 A;  1GJX A;  1GUG A;  1CT1 D;  2KVM A;  1SXT A;  1LAB A;  1STA A;  3D4D A;  2B39 A;  3DWQ A;  3EFX D;  4FF4 A;  2N55 A;  2CW0 D;  1A2U A;  5HUR A;  1HXY D;  2PW7 A;  1HQM C;  3HOX B;  1EY6 A;  1O7L A;  3T53 B;  1WCM B;  1KAA A;  2EVB A;  1B3A A;  2K5W A;  3DUZ A;  4ZLT F;  2PMZ B;  2D2C C;  1EY8 A;  4CJ0 B;  2RDG A;  1T5X D;  3J7Y W;  1DJR D;  2K33 A;  4C3H G;  1Q3L A;  1EQV A;  3AU7 A;  1SMY D;  5C4Z A;  1QE6 A;  2EYP A;  3U9S A;  1ZKO A;  3VA7 A;  1ILQ A;  2EPB A;  5IOC A;  3BVZ A;  1F2M A;  2K7V A;  3I4M B;  5ELF A;  1SYC A;  2F0D A;  5EGT A;  3OSO A;  5C4J B;  5KGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...