2KEDA

Structure of sdf-1/cxcl12
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monomeric structure of the cardioprotective chemokine SDF-1/CXCL12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Stromal cell-derived factor 1-alpha
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kedA00
2B2WC 2K01A 2HCCA 3I8ZA 3Q6SA 3FDTA 3FPUB 1O7YA 1MSHA 1U4MA 2RSOA 2SDFA 2B2TA 1X32A 2X6GA 3I91A 4QUFA 1GUWA 2X69A 2KUMA 4O42A 4IUTA 1NAPA 4HAEA 1EIHA 4IUPA 3H91A 3KBXA 4RA8A 1JICA 4IURA 4HSVA 4OIJA 1Q3LA 1WTVA 2DY7A 1O80A 2B2TC 5EPLA 1NCVA 3QO2A 3I90A 1PFNA 1PLFA 3MWYW 1A15A 5D14A 1EIGA 1HFNA 2B2UC 2NWGA 1KNEA 1TVXA 1KNAA 3GV6A 3N52A 1WTOA 5COYA 2L12A 1DONA 4X3SA 2N88A 2L11A 3DEPA 1RTNA 2NZ1D 5CBAE 1X3PA 3IL8A 2BDNA 2H1EA 1HFGA 2JYOA 1EOTA 1B3AA 2N55A 2B2VA 4X3TA 4ZKCB 5CBEE 1C8CA 1CA5A 1G91A 2RA4A 3TN2A 2R3ZA 2RSNA 1WD0A 3DM1A 1DOKA 2KECA 1U4RA 1MSGA 2FINB 4R8IA 1U4LA 5JJZA 4ZAIA 1CA6A 5DNFA 4ZLTF 4CJ0B 1ESRA 1QNKA 3SVMA 4R9WA 4XDXA 2EPBA 2NYZD 1B4OA 1XX8A 1F2LA 2K1BA 1BNZA 2HUGA 1JE4A 1RHPA 1RODA 1S4ZA 2K28A 3HP3A 1M8AA 2L4NA 2VXWA 2XIWA 2MJ8A 3F2UA 2B2YC 2KVMA 4IUQA 1F9QA 5EQ0A 5E4XA 2MPMA 1EL0A 2B2YA 4ZKBB 1SDFA 5T1IA 4MN3A 1B50A 1IL8A 1G2TA 4HCSA 1ILQA 1VMCA 1NR4A 2D9UA 4RAUC 1DZ1A 1CM9A 1O7ZA 1X3QA 3MTSA 1BO0A 1B53A 1NR2A 1DOMA 1QE6A 3ONAB 1WTQA 1WTRA 1XYIA 1SAPA 1IKMA 1MI2A 1DOLA 4MHEA 2KEEA 4OIKA 1ICWA 1ML0D 4QUCA 4CJ2C 3R93A 1HRJA 4IUVA 2Q8RE 1E0BA 2HDLA 1IKLA 1EQTA 1ZXTA 4X3KA 4XT1B 5AFWA 2Q8TA 3LWEA 2JP1A 2K03A 2MP1A 3D6WA 1B2TA 4UAIA 3UI2A 1G2SA 4DN4M 5CORA 2FFKB 1J9OA 1F9PA 3G7LA 1J8IA 2KEDA 2K04A 5E4WC 1QG7A 2DY8A 1WTWA 2B2VC 2HCIA 2EOTA 3P7JA 1F9SA 4IUUA 2J7ZA 1PDQA 1AZQA 2L9HA 2L1BA 4HEDA 4U68A 5EPJA 1RTOA 1SSOA 2IL8A 5T1GA 1WVLA 2X6LA 3GV3A 2FHTA 1RJTA 5EPKA 1F9RA 1PFBA 2B2UA 1G6ZA 1HUNA 2KOLA 4NW2A 2FJ2A 5EJWA 5EKIA 1WTXA 1WD1A 2RVLA 4RWSC 4XT3B 2CVRA 3IFDA 3TZDA 2HDMA 5CMDA 1HHVA 1U4PA 2M2LA 4ZK9B 2EE1A 1HA6A 1MGSA 3I3CA 1LV9A 2FMMA 1BF4A 4X3UA 5D65A 4LMQD 1VMPA 3DEOA 1AZPA 1ILPA 1AP0A 1PFMA 1WTPA 2B2WA 3KUPA 1HUMA 4CJ1B 1BBXC 2MGSA 2K05A
chains in the Genus database with same CATH superfamily
2K32A 2B39A 4J1MA 3FDTA 3CCSA 1VQMA 2A73B 4B9XA 3HOZH 1WCMG 3I91A 1E3PA 1J5EQ 4HJAA 1SYDA 2RHQB 2NBFA 1L0XB 5CV7A 2CKZB 1HNWL 1MIUA 3BZDB 3A5ZB 2I46A 2DY7A 1SLJA 3I4MG 1A62A 5C3EG 2UUCQ 2QCPX 2N88A 2ICEC 2O5IC 1A6XA 3W3AA 4GNXC 2B8FA 2MUYA 1EOTA 4A3IH 2OTLA 1A3VA 4ID6A 4DNTB 2IX3A 1LM0A 1STEA 4X3TA 2JA7G 4A3GG 3D31A 4U673 4ZUIA 5J1ZA 2AWNA 3GQBA 1LTRD 1I4HA 2EZVA 2FINB 1WCMH 4C1NK 3CP0A 4EQ5A 4FVMA 2GVBA 4DR6Q 4ZLTF 2XWJB 1I6VC 3CXCA 2J4XA 1Y69U 2HUGA 1N8RC 1LTSD 3KLRA 3CMAA 1HTPA 1I94L 1GXDC 1CSPA 4ODGA 5FO7B 2ZJRA 3HOWB 1M4VA 3HOVG 4C3IH 1SRUA 3KOJA 1SR3A 4C3JB 1VMCA 5FJ8H 1IBMQ 2C9OA 3WOFA 1XNRQ 1L2FA 4IN3A 1QWYA 2ZXPA 1SEBD 1WTQA 2N8NA 2F0KA 1U5KA 1YHBA 1ICWA 1LABA 4CJ2C 2F0PA 4R4OA 5M5WB 1HTLD 5J39A 1BVSA 1F2ZA 1GOZA 1C9OA 4UAIA 2EJGC 3H6MA 5JPNC 4IUNA 3VDYA 4Q5VA 4IZ8A 3VYSA 1HR0W 3F8TA 4LUVA 4G57A 2HQLA 3GD7A 3RLNA 1VQ5A 3TS0A 1AZQA 2L1BA 2F0LA 5T1GA 3FPPA 3J7ZC 1RJTA 2BE5C 1PFBA 2KOLA 2RF4A 2E2JH 1TS2A 2R92G 4CKCA 4P75A 4IO9A 1D7QA 1XNRL 2NVTH 3TZDA 1A3TA 4DA2A 4UHVA 2UU9L 4JK1C 3DEOA 2B63G 2B2WC 2K14A 1S3OA 3HKZB 4LF7Q 2F0DA 3S15B 5K36H 5JJLA 5M5YB 1FGUA 5EKLA 1IYVA 4PZ6A 3GTKB 4IUTA 1YHQA 2PQAA 2PMZB 2YYZA 3PUYA 3D6CA 4IUPA 5CV8A 4IURA 4GKJQ 1SYGA 3P20A 4A3BB 2R92B 5IYBH 4A3LG 1TY0A 1CQVA 3PIPA 4A3KB 1GVPA 2BDNA 2H1EA 3UDGA 3RLOA 4X62Q 5IT9L 3J80E 2B63H 1DYQA 2CH4W 5M3MG 2F0WA 4A4IA 4CDFC 2LMCB 2F4VL 1TWGB 4P71A 2Y0SB 1EQVA 4OX9L 4FXGC 4OWTB 3GTJH 3ERQA 1QNKA 4V0BA 1B4OA 1TKWB 3J81i 2RDGA 1Q12A 1PV4A 3KF6A 2KCNA 3W5OA 4AH6A 4GOPC 1ZYRD 3K5MA 1PYWD 1VF7A 1X54A 1CKNA 2MPMA 4BS9A 4KY5A 4DNRB 2E2HB 1Q8IA 2QDLA 2NZOA 1ZYRC 5EBCA 2E8GA 1X3QA 2ZTDA 5LHY1 4JI7Q 3A8JE 1SAPA 3TDQA 3D0FA 4RHRA 3U9SA 4EQNA 3LGJA 1CHPD 2K33A 3K5OA 1CUKA 2RHSB 4KHVA 4K0KL 3RN2A 4DAPA 3KF6B 1AN8A 1F9PA 2UUCL 4HJ7A 1EFID 2AWOA 3GTQH 3HOYB 4HEDA 2IL8A 2E74C 1HNWQ 1B9MA 2OQKA 1F9RA 4KD3A 1HJPA 1JQYD 5EJWA 4RWSC 4S3SA 4L5SA 4APVA 3HFZB 4OO1I 4ALPA 3TSSA 3EFXD 4FO2A 1BF4A 1UAPA 2MNAA 4KY7A 1PFMA 2K5VA 4I7AA 1EL0A 4DAYB 3M4QA 4K5XA 4OX9Q 1E2VA 3UE1A 4AYBG 1Q7YC 4KJOA 2A68D 2LFNA 2J0TD 3J7AF 3G6EA 3KF8B 1NMFA 3Q23A 5C4XH 4ZYSA 1RKNA 2F0QA 2R93H 3DWAA 4HAEA 3P1HA 1JICA 1HPCA 4JV5L 5CV6A 5C4JB 1XWEA 2ZT9C 1T9HA 1DJRD 4JI8L 1JOOA 4WJWA 1TWHB 3K81C 4JW0A 1YHAA 1CFMA 4HCEA 1SMYD 1A2TA 4X66L 5I6YA 5I2YA 2HIVA 2NUCA 3H3VH 1SMYC 4ZKCB 4DK0A 1TWCB 1X65A 4H02A 1KDAA 3OSOA 1H9KA 3V2TA 1Q86C 3OIPA 4K8JA 3VR5A 3GDEA 1JWMD 3E0JA 4C2MB 4BBSG 1XX8A 3MXUA 1K3RA 1JC7A 5IYCH 1RHPA 1HR0Q 4PG3A 3KDFA 3H09A 2EXZA 3KBGA 5KNDA 4NXMQ 4P2CB 1P16A 4QY7A 3ULJA 1KABA 1F9QA 5M3MH 3R8BA 2D62A 1NR4A 4RAUC 1CM9A 5M5XB 3S16B 3ULPA 1A63A 1QE6A 3NWTA 1CI3M 1VQKA 1D6EC 2KEEA 3KYHC 3I4MB 2Q8RE 3TMEA 2KA7A 1TR5A 3CPFA 3NUCA 4QJFA 4K8IA 2BH2A 1P8LA 2ENBA 5A2QL 1J8IA 2B2VC 1ASYA 4GNXA 3P7JA 4FDBA 5IOCA 1C48A 2O4XA 4U68A 4CDDC 5FKAC 3TP7A 4A3MH 1R9TH 1WVLA 3M3YB 3GV3A 2FJ2A 2NN6I 1L1OA 2M00A 1QNUA 1GO3E 2CVRA 4KN7C 1PRTC 5JAVA 1B8AA 3SK4A 1HA6A 4FXKC 4K6DA 3K80C 1VF5C 5NUCA 2IY5B 5FJ8G 1BCPD 3HEJA 2YU9B 1PRTD 3M7GA 4B3RL 4QL5A 3AU7A 2BDOA 1Q81C 3E5SA 3TP5A 1EWHA 3K7AH 5AJ3L 4XQQA 4O42A 4HR7B 4B3TQ 2L5TA 3JC66 1FL0A 3NBHA 3H91A 1KHIA 4DXGA 4HSVA 4PMWA 4X66Q 3HOXB 3RZDH 1JORA 4P73A 1EUJA 4FF1A 3SXHA 3MWYW 1YBYA 5F2DA 3OWFA 1N33L 3N52A 3O13A 1LO5D 4JV5Q 4K2KA 3VYTA 2NZ1D 1A3UA 3G71A 2K6AA 1XPUA 5EAYA 1B3AA 1ONLA 1V1OA 1R4PB 2CFMA 1SMXA 2WAQB 1SJED 4IFDH 3SHLA 2KCCA 4ZAIA 5C3XA 4GKKQ 2I5MX 3SEBA 1H9MA 3G6JB 1D1KA 4LF4Q 1HA5A 4N9TA 1PHJA 1KRSA 1VQGA 3BDOA 2ZM6L 4DR6L 1WJJA 2LXKA 3K8AA 2OXPA 4ZKBB 1I5FA 1D1IA 1IW7C 3W2DA 2UUBQ 2VNUD 2JQOA 3GTOB 4OIKA 3R93A 4A3FB 5IP9G 4DR2Q 2FXQA 2Q8TA 4DAMA 2I07B 1DCZA 3CCQA 3S1MH 2K03A 4OHJA 4BXXH 2H4OA 1KL9A 4KHZA 2Y0SE 4H13C 5C4HA 4XTCS 1QG7A 3HGBA 4DR3L 5DLQE 1PDQA 3H94A 2VB3X 4GN3B 5M5WH 1E22A 4MNOA 4NKLA 2ZJQA 4BA1I 4B3RQ 2ALYB 2N49A 1K73C 2KHJA 1ZEQX 2RBMA 5CMDA 2EE1A 5K5PA 3I4NG 2NB0A 1PYSB 4K2LA 4DUYL 4M1UB 1AZPA 1PFSA 2N78A 4DV0L 1IBKL 2JXMB 4JBWA 2EVBA 2E2JB 2BE5D 2OQ0A 3W1GA 5L37A 1SYCA 2NVTB 2K4KA 2GVAA 5ELEA 1I4QA 4TVAB 2AQ1B 4KN4C 1DGSA 1S5DD 4IJLA 5C0XJ 1V1QA 4P74A 4OIJA 1W3SA 1JMCA 1PH5A 2MO0A 1EU4A 1WI5A 2A1AA 2B8GA 3I90A 4BBRB 1EIGA 3MC0B 5M9OA 4LFBQ 1QVFA 2O2LD 4ULLA 4DV5L 4EGVA 1I50B 1X3PA 1HFGA 3A5UA 5C3WA 2IHFA 2XN9C 4JI3L 4XXEA 2EIFA 3MXNB 4AQYQ 1NE3A 4KHPL 2ICIA 4C3IG 2ZM6Q 3CCMA 4G4KA 1ESRA 4KTAA 5CV5A 3AYHB 3KLSX 3NXWA 2JSOA 4M8AA 2HHHQ 4OO1H 4R1JA 2LS01 1YIJA 5C44B 1VQEA 4IUQA 2JA6G 1PZID 4KI0A 4ME5A 5EKKA 2DNCA 3E9HA 1IL8A 4JCVE 5IY0A 4GLVB 1NUCA 4TKOB 1SXTA 4RGOS 2RDFA 2NVYH 3EROA 1DOLA 4ME3A 3QR8A 3CD6A 2KCMA 4C3HG 1HRJA 4DR1L 3HS0C 5IP7H 4HJ8A 1CQFA 2JA8G 4A3GB 4LF6L 4POGA 1C4QA 2ID0A 1FD7D 2CW0D 3ITPA 4H44C 1I4PA 3HKZE 3OIQA 4BBSH 2F0EA 5JOBA 4A76A 1G291 2KHSA 3NP8A 4P72A 1Y1VG 5C5MA 2VQFQ 5EKIA 4OXPA 2RVLA 1H9JA 4KV6A 2R7ZB 1VS0A 1OO9B 1EZ6A 4AIMA 1GHJA 1X6OA 2ZXOA 3S1QB 4X3UA 5A35A 1TU2B 1TWFH 1FJGL 3M4YA 4C3HB 1X32A 1HNZQ 1BCPF 1J5EL 2Z4IA 3AFPA 2VW9A 2C35B 3VR4A 1LTID 4RCOA 1CTMA 5FO9B 1MSHA 4A3CG 4DAVA 1N36L 2NTTA 2VL6A 1STBA 1MJCA 2ZJPA 5IT9E 5IYDG 2OT2A 2EYHA 1WTVA 5EPLA 1OXVA 1A15A 4DV1Q 4FF4A 2L15A 4DV7L 5G3LD 1VQLA 4KKSA 2NZHA 2C5CA 2R93B 3GTGB 4LF5L 3NTIA 3DXJC 4IPCA 2Z6KA 1ZKOA 4DUZL 1C8CA 2A69C 4ZUJA 3M4PA 3PMFA 1O7IA 3E0EA 3OYYA 2OTJA 4MTKA 3MXNA 2A8VA 1JWSD 4BY1G 4OO1G 5ELBA 2A69D 2BCOA 3J81c 5BN5A 2NYZD 3U50C 3CRLC 1BNZA 1PRTF 1AW7A 2K28A 1YI2A 1TWCH 1K8AC 2CCZA 1N9WA 2L4NA 3SR1A 2MJ8A 4QQBX 1N32L 1SBBB 2WB1G 3DUZA 4NP5A 1SDFA 5LL6S 4MN3A 1G2TA 3S2HH 3WDNA 2HHHL 3OTOL 3I4LA 4DK3C 1O7ZA 3MTSA 3J80i 1LTBD 1SE8A 5CYUA 2ZXRA 2EJMA 4IUVA 3HOZB 5M3MB 1ZXTA 1GM5A 3CCEA 1K83H 4N8FA 2F52A 4JYAQ 3A8IE 1RDPD 3EJIA 1CKOA 3EVQA 2RKSA 5KEEA 1S5CD 3OHXC 4IUUA 2E5LQ 1FNWA 2PCFB 5EPJA 1JT8A 2JA7H 1IBLQ 5KRUA 4PZ8A 4WFN3 2D2CC 2IX0A 4DV0Q 1IBKQ 1LTAD 1EQRA 1TS4A 2B29A 2YTVA 1I4RA 2LSSA 3TS2A 3F2DA 1BBWA 4LF8Q 1SROA 2EYJA 5EBDA 1R9TB 4A3CH 3BYTB 3A54A 4CBVA 1MJEA 3L9AX 4J15A 2EYMA 5IGBA 1NSNS 2L55A 2UXDQ 1ASZA 4NB3A 1JJ2A 1UWVA 1OXTA 2CHBD 4FNFA 4RA8A 4RGNA 5ELCA 2SNSA 1BCPC 4G7HC 2B2TC 1CKNB 1NTGA 3IKJA 3GTMH 4LF9Q 1PLFA 2E2IH 2UUAL 2F0VA 1VQAA 4B3SQ 5FLXc 1BQQT 5I9OA 3GP7A 4DV1L 1IL2A 3E6ZX 2PW7A 4QGUA 1EIFA 1YNJC 4AYBB 4JI4Q 1MSGA 4KMUC 2IW3A 2VZAA 4LUOA 2YV5A 3L3OC 5IGEA 3M7NA 3G4SA 1F2LA 4NMZA 4GS3A 1IBML 1JE4A 3HP3A 2WKCA 4GKKL 1VQDA 4JI4L 3T51B 3NBIA 2F0GA 3A56A 5EQ0A 3C1EA 2EYLA 1FJGQ 1L0YB 2G9HD 1Q82C 1NNXA 3CCUA 1Y1WH 1F77A 4QF4A 2IJ0A 1LTGD 1ENFA 3PIO3 3S15H 2XNAC 2Z8LA 2UUAQ 3MXPA 4DK1A 5M5YH 2HDLA 3BVZA 2QA4A 3S14B 3CCLA 3U4VA 2F3IA 2WIIB 1BBUA 4C1NI 3GTLH 1G2SA 1EIYB 3AB9A 1UEBA 2LKVA 1EZ8A 1JWUD 1J9OA 1KRTA 2PNRC 4B3TL 1GHKA 1HQRD 3ND8A 3NTHA 1I3QH 3PV0A 2HIXA 1KAWA 1UEAB 4LF6Q 5IGCA 1A8VA 4R4QA 3HOYG 4FYDA 2BA1A 1G6ZA 4A3KH 1WD1A 5IGFA 4HTHA 3FHWA 1TWGH 1YITA 1MBYA 5D65A 1XMOQ 4RHSA 2K5HA 2F03A 1GUGA 2K5NA 3KUPA 4KHPQ 4A3FG 2I0QA 2OEOA 4A3BG 4V190 1CKMA 4C56C 4HIMA 4YY3Q 3K5NA 2XWBB 4DV3Q 4A93G 3M85A 5IYBG 3RMHA 1K9MC 4ZCKA 5M3FG 1SNDA 3BJUA 5HGQA 3JAMi 2E2HH 1XNQL 5C0XH 5LL6X 1DM0B 2B2UC 2F0UA 1V43A 5BR8L 3H3VI 3RZOB 3HKSA 4DV6L 4KJNA 2WAQG 1BKBA 5M3FH 3UDIA 1PVOA 4JI1Q 2ATWA 4DU9A 3GTPH 5GAEC 2EXDA 3HG9A 1I4GA 3C1FA 1I50H 2F0OA 4LNQA 4F8MA 2BA0A 1TIID 1FYCA 4JOIC 4HSPA 3LWUA 1HZAA 1SNMA 3T4AC 2XRQD 1CZWA 1TQOA 3BZCA 3CC4A 2Q2TA 2Z0SA 4F87A 2F0FA 2E76C 3S17H 3OW2A 4LF5Q 2F0HA 1SJHD 1EYDA 5GAGC 1DOMA 1XYIA 1MI2A 1F2YA 1GKHA 3LNNA 4J6HA 4MHEA 5HGTA 4DXFA 3J81E 4DR4L 1PYBA 4DV2Q 1S40A 4KY6A 4JPBW 2PYKA 2EDGA 1E1TA 1XPRA 2F4IA 1GUTA 5C4JH 1MHWC 2NVYB 1TT2A 3NQTA 2NVXH 1HZ9A 1FNVA 3M9BA 2F3VA 2L9HA 4A3GH 4FF2A 4PV1C 4UY8C 4UP7A 4DNIA 4XYQA 4A3IG 5IWAL 3L7ZC 5FO8B 3HOVB 2NVQH 3ERSX 1Y1WG 3PIOA 3I4NH 1K28A 1PTOC 4YHHL 2K75A 2UUBL 1IXRA 1U4PA 3CU7A 3I3CA 1MGSA 1QJOA 3D4RA 2FMMA 5TSSA 2F0SA 5FLMH 3BS1A 3TRZA 3TP8A 3FMCA 1BBXC 1Z9FA 1X3EA 3EBEA 3TREA 1I94Q 2UXCL 4YIJA 2EYOA 1U4MA 4Q0FA 2RSOA 5C0XG 2R7ZH 1L1OB 3MZ5A 1T5EA 2CWPA 3BDCA 3RN5A 4A3JB 2VS1A 2GA4B 2QKIC 1HNXQ 5FOBB 4BXXG 4X64L 4TSSA 1KC8C 1Y8PB 1EWCA 4YCUA 2B3GA 4DKAC 4GN4B 5C3EB 4FF3A 5M5XH 4IFDG 4FXDA 3I4OA 3GV6A 1KNAA 4A93B 1HCZA 3I4MH 3QOJA 3S2DB 3OWEB 1KAAA 5KNCA 2PMZE 2Q2IA 4XQJA 2F0NA 2SOBA 3AQQA 4IOAA 1CA5A 5LMNQ 2R3ZA 1YNND 3KF8A 3DM1A 1J6QA 4NDXA 1B44D 2UXDL 1VQPA 1ICFB 4CHTB 3GTGH 4GNXB 1KD1C 3VA7A 2E2DC 1RODA 1EY6A 4O1NA 4DV4L 4XQNA 3J80L 2JA6B 5K36G 1RF2D 2FMCA 2HQEA 3RR5A 3HOUH 1TS3A 1VQJA 2OCEA 5E1FA 4IPHA 4B3MQ 1AEXA 3NBHB 1Y14B 1U0LA 1B53A 1LT4D 4DV2L 4A3LH 2R61A 4H0LC 3F2BA 3X3MA 3PO2H 4JYAL 1PH6A 2DUDA 1A2UA 2DGYA 3S1RH 3URYA 3Q24A 4YWKA 3S2HB 3RD4A 4A3MG 4QCLA 2OF1A 2BH8A 1ESFA 5CORA 2Z4HA 3D3RA 4X65L 3HOXH 4UDUC 2UXBQ 4IOCA 1LT6D 1T5XD 2DY8A 5E4WC 4BY1H 1FVIA 1LACA 1PXUA 2CW0C 2Q2UA 1XMQL 2SNMA 2X6LA 4JOIA 3SK6A 5LMUL 1LUZA 3AEVA 1HR0L 4BWGB 4GZYC 2HDMA 1HHVA 3CPWA 2M2LA 1IBLL 2RQXA 1S72A 4OELB 1VMPA 2D5DA 3NK9A 2SEBD 3JAME 4JI6Q 2JA7B 2B2WA 2WAQE 4CJ1B 2JN4A 3QOLA 1JJGA 3HKZG 5C0XI 4YCVA 3K5LA 2X69A 5CV4A 4MZ9A 4JI6L 1VQOA 3SE0A 2MFIA 3BVGA 1QZHA 3QO2A 2L0CA 1PFNA 4YCWA 4JI5L 5GROA 5I9PA 2QGQA 2XTIA 1X55A 1WTOA 3GTOH 2L12A 5FLXE 1DONA 3F1ZA 1RTNA 5CR3A 1WFQA 1ENAA 3PUVA 2AUKA 3S1MB 4A3KG 5C4ZA 3K0XA 1NMGA 3GTMB 1SE2A 3SGIA 4OONA 1HZBA 2KJXA 3NHHA 4N9PA 5JJZA 3MFYA 1Q8KA 1SE4A 3SVMA 3OTOQ 1ET6A 4XDXA 3VYUA 3LX0A 3QIAA 3V96A 1KLGD 4TRDA 1C7YA 2A5HA 2B2YA 3Q0AA 3QJYA 2A19A 2QEJC 4LK1C 5FLMG 4JBMA 1I6HB 3CC2A 1V1PB 5C6AA 4X65Q 4HJ5A 4G7ZC 3BVMA 2UXBL 1IKLA 3T53B 2JP1A 2VQEL 4A3EG 1Y1WB 1EYAA 2F1MA 4HIOA 1B2TA 3CCVA 5KYLA 4OWWB 2K5WA 4DR5L 2KEDA 2K04A 1B70B 1GUSA 5FK9C 2IPKD 5LMNW 4BBRH 1SFOB 3HOUG 3S14H 2F0IA 3A0JA 3FRPB 3NEMA 1CHQD 1V8QA 3GTLB 3ICEA 1QVGA 3AMUA 2K7VA 1OXSC 1D8LA 3IFDA 5ELDA 3EN2A 3UDFA 5HURA 3PO3G 2NN6G 4L5RC 1SNOA 3CHBD 5IGDA 5H1SE 4K5VA 4ZQ3A 3M4OB 2HCCA 4LJZC 2VUMB 1VDZA 2EJFC 3FPUB 1KTKA 4A75A 1HH2P 4A3EB 2JEBI 2M9VA 2PQEA 4EQPA 3I55A 4JI5Q 1QOHA 3QB3A 1ENCA 4DV5Q 2Z6BA 3Q8DA 3KBXA 2ZTCA 2QILA 4MTNA 4IFDI 4JVZA 3I2ZA 1XMQQ 2AQ3B 5D14A 3BDLA 4WRDA 3CF5A 4GKJL 1TVXA 2HT1A 1E2WA 2PI2E 5COYA 4NXNL 4K6LA 1VQFA 4LF8L 2N55A 5CBEE 1TXYA 4RH6A 1SNPA 5E7NA 4L8JA 1TWAB 2V1CC 5I2XA 2AMCB 1DOKA 4NXML 3VR2A 3RZOH 4BBSB 1FGBD 3TQYA 4R4IA 4ZRZA 4DUYQ 2EYFA 1D5ZC 2Z1CA 1OTCA 3OOCA 1UE7A 1PH2A 2CQOA 5M3FB 1X9NA 2WKDA 3BYYB 2A74C 4PNYA 4IQZA 1GD7A 3FVQA 2QW7A 4JI0Q 3HZXA 3GTPB 3R3OA 3S1QH 2JA8H 5KGUA 2K5DA 5JVG3 4KD4A 3ZJYC 4RG1A 1Z7TA 4C3HH 3CRKC 4QMGA 2F0JA 3NWSA 3ONAB 1PH7A 1STAA 1CT1D 5BN4A 2A6HD 4DFAA 1KXLA 3T56B 1JR0D 3EIVA 2RCFA 4B9WA 3CC7A 4DR3Q 1XTDA 4A3IB 3TEHB 2JA5B 2WINB 2R7FA 3S17B 5LMUQ 3GO5A 2D0OA 1BOSA 4L63B 2YTXA 1VQ9A 1PRTB 4DV7Q 3KJOA 2EOTA 3J7AV 4L5TA 3DMUA 1O78A 4CGYB 1EY7A 4POFA 1PTOB 1Q90A 1RTOA 1SSOA 5KNBA 3HRZC 4RKLA 4YWLA 3SDZA 1WTXA 2PZTA 3HOWH 4G7OC 3PO2G 5GAHC 3UE0A 4YY3L 3E9IA 5A2QE 4C3IB 1YJWA 2NVXB 1K0RA 4N8X1 4JBJA 1U9RA 4C3JH 5LMNL 2KHIA 1AP0A 1S5ED 1WOCA 1SNCA 1KQSA 1HUMA 2IT1A 2K05A 2KENA 1VQHA 3HOVH 2CQAA 2NVQB 1AE2A 4BY7B 1KDBA 4TQUS 3L2PA 3B6YA 2B2TA 1PH4A 4EVOA 1K3BC 1W6JA 1SE3A 2R93G 1XTCD 4DV6Q 4JC0A 3C2PA 1O80A 2TMPA 4NPSA 4ABNA 1YNJD 5IYDH 2BOSA 1FR3A 5IT9c 1PMRA 4HMJA 2WACA 3KK7A 1E2ZA 1H9SA 3K57A 4LAAA 4A3JH 1G51A 2L11A 4JI7L 5CBAE 4UPAA 3A7AB 1K83B 4JBKA 5C3EH 4DR2L 3OPOA 1ET9A 1GUNA 3KFUA 3PQIA 3FKIB 4R8IA 1N36Q 5IWAQ 4CJ0B 3S2DH 4R9WA 2LY7A 2JE6I 1JB3A 1Q1EA 2K1BA 2XRSD 1II3A 3GTKH 3F2UA 4IPDA 1BCPB 1D5XC 1AE3A 3SK8A 3PUWA 5EGTA 2ASBA 1IKMA 1IW7D 2JA6H 1ML0D 1EEID 3HOUB 1AH9A 1BUVT 5AFWA 4YWMA 4JI2Q 3DHQA 1E7ZA 5IYCG 1KIXA 3PIP3 2NTSA 3I72A 3STBD 1C0AA 1IYUA 3A74A 3RUZA 4LFBL 4XIGS 5ELNA 2HCIA 1LTLA 2Z6KC 3GTJB 2E2IB 3WOEA 1F9SA 3P75A 2IX1A 1PTOD 2WB1E 1UE5A 1Y1VB 3S1RB 5JJKA 3QWNA 1JCKB 4GLXA 3A8KE 1JOQA 3BU2A 4DGZA 2HD3A 4XT3B 4XYOA 4Y7NH 4BY1B 3I73A 4ZK9B 3OMCA 4EX5A 1YVCA 1Z47A 4KKUA 1STNA 2AUJD 1LTTD 2K01A 2JEAI 1PH1A 3K6OA 4RGTA 1UE6A 1O7YA 1QZGA 1YJ9A 2JK8A 5DAUA 1QUQA 1BDOA 2X6GA 4H7BA 1JJCB 3K58A 1GUWA 5CV9A 4WJ3M 4B3SL 4IJHA 4A3DH 1B7YB 1O7LA 3JAML 4DF7A 3S1NB 1NCVA 1PTOF 5DM73 3HOXG 4DV3L 4X62L 2DJGC 1X3GA 1HFNA 3HOYH 2V4DA 4CKEA 2G5DA 3MHBA 3PSIA 2EQSA 5KYIA 1PH8A 1YEZA 3NELA 3IL8A 2PQAB 3TBIB 2Q8IB 3I56A 2AQ2B 3F2CA 4K14A 4NXNQ 1U4RA 4JI0L 1U4LA 1F2MA 1I3QB 1VQBA 3I70A 1YNNC 1EY4A 4WORA 4QIWB 2PI2A 3PO3B 3D4DA 3CQZB 1NBWA 2K52A 1TY2A 1L1OC 5C4XB 3MFGA 2MQHA 3FKIG 1JB7A 5JEAJ 2DNEA 3Q22A 1QILA 1OXUA 2KQ3A 2F0TA 5G3LF 1TWHH 1NR2A 4R8NA 4JI8Q 2R6GA 4R4CA 5ELOA 3K59A 1UUPA 2ES2A 2IWHA 5IP9H 3CCJA 2F3WA 4DUZQ 3ZYYX 1G6PA 3D6WA 3JAMc 4DN4M 1XNQQ 2JA9A 2ZTEA 3DM3A 2FFKB 4FP5D 2QF7A 3J80c 3PGZA 1IYJB 2XSCA 3BZKA 1EOVA 3H0GH 4HIDA 5EPKA 2F0MA 4DR5Q 1HUNA 3K7UC 3VA5A 2R7ZG 4BY7G 2EY5A 2JJQA 2XGTA 1N32Q 2PW5A 4L5QA 1NJIC 4DV4Q 5D3DA 1B3QA 1IZ6A 1EU3A 1SFOH 2MO1A 5CC4A 4F7XA 1ILPA 3PF5A 4RGMA 1RL2A 2P5ZX 3QG1A 4YHHQ 1WTPA 3S16H 4F88A 1JE5A 1W2BA 3HOZG 1B1ZA 3TZUA 2F4VQ 3DLLA 2Y0SG 3Q6SA 5GQOA 3T13A 4PQXA 2SDFA 1PZJD 2PZUA 2WV6D 1RIPA 5DM63 1CK1A 3IRBA 2EY2A 4LF9L 2KUMA 1NAPA 3MVVA 1EY8A 3NQIA 1BR9A 2AHOB 4RCNA 3AFQA 3VR3A 5HY6A 4OEMB 4CDCC 1Q3LA 1S5BD 3M4OH 1VQIA 1Z6HA 2E5LL 3J81j 3DWQA 1SYFA 2VUMH 1X56A 5ISRA 4K5WA 5AJ3Q 4C3JG 4A3EH 3NPPA 3MEHA 4DR4Q 1WCMB 3W1BA 4X64Q 2OWOA 5JEAH 2EY6A 4K0KQ 1K8GA 3ULLA 2RA4A 4LF7L 1UNSA 3U58A 2WP8J 3T1YQ 2AKWB 3ER0A 5JPMC 1VQNA 3OW7A 1YNXA 3S24A 1EYGA 5DNFA 2GN5A 3IAYA 4KKTA 1W6KA 5J22A 3WWVA 4B08A 4O0AA 4O2DA 1TWAH 3A55A 3I4NB 2VXWA 3H0GG 3KDFB 2KVMA 1SYBA 1PZKD 1WTHA 2DJFC 5T1IA 3RZDB 3FP9A 1ILQA 1YZ6A 3G48A 2EYPA 4KLKA 3EQLC 5KIXA 3S9WA 3CAMA 5IP7G 3BG3A 5BR8Q 1E0BA 1XXGA 1EQTA 2I5LX 4X3KA 4XT1B 2QEXA 1WYDA 4DPGA 1M90C 2JA8B 1BXTA 1D2BA 3G7LA 4OWXB 3T16A 5JJIA 1PH9A 2VB2X 4RKBA 5I4DA 4A93H 1Y8NB 1VQ8A 1Y8OB 2JA5H 1OXXK 1LYLA 2E75C 1HQMC 1LV9A 1PTOH 1NY4A 4PZ7A 2G9DA 3T1YL 1EWIA 1E1OA 3U9OA 1STYA 3NENA 5C44G 2LXJA 3IFTA 1LT3D 4A3BH 4AQYL 2UU9Q 3RLFA 4A3FH 3T1HQ 3TP6A 2R92H 3N6RA 3PUZA 1EEFD 2EY1A 5CGKA 1LT5D 4LWCA 5IIFA 2RCNA 4IALA 1EIHA 2A68C 1VQ7A 1RD9D 3UDXA 1S5FD 2B63B 1RCVD 1Q46A 1K8MA 1K0SA 4BY7H 3OMGA 1XJVA 2RDHA 1G8ZD 1MD2D 1H9RA 4HN7A 3PO2B 4CDEC 1HNXL 1VQCA 1LLRD 1PH3A 5D3IB 3PF4A 1QB5D 3PCOB 2JYOA 3FEWX 4BA2I 2B2VA 1G91A 2Z9HA 3TN2A 2RSNA 2VY3A 5C4XG 2UXCQ 2XVSA 4BBRG 1YJNA 1SYEA 3DWPA 1L0WA 4RFBA 2EPBA 4LFCQ 4OGQC 4QB4A 4DAYA 1FNUA 3NSWA 2MHVA 3J7YW 1M8AA 1H9SB 3PUXA 1STGA 3FKIH 2VQFL 1JOKA 1QVCA 2WB1B 2A6HC 4LW1A 3EA6A 4GOPB 5JEAG 1DZ1A 4QIWE 3CCRA 1BO0A 1IHZA 1CZGA 3SK5A 3VR6A 4GOPA 4JG2A 4UP8A 3HOWG 1QCBD 1KLUD 2K50A 4JI3Q 2PNHA 3CW2C 3GTQB 1EY5A 4R4TA 4DR7L 3LWEA 2PPBC 1EYCA 3X3NA 2WFWA 4AYBE 3UI2A 5BN3A 3CKIB 3C3LA 3RNUA 1WTWA 3H3VC 1N34L 4WJ4A 2J7ZA 1V1PA 2VQEQ 3KLWA 4Z9CB 2D0PA 3I7FA 2O5JC 3D4WA 3MEFA 5C5LA 1SNQA 1N33Q 4X6AH 3STBC 5C44H 5J3BA 1AFPA 4A3DG 3C46A 1A0IA 4DR1Q 4LMQD 5FLXL 1Y1VH 2IHEA 4UP9A 1STHA 3NTKA 1X3FA 4HMIA 1H95A 4JI1L 3I8ZA 4KK7A 1XPOA 5E3FA 4DK6C 4LFCL 4Y7NB 2JA5G 4A3JG 1R4QB 3U4ZA 4QUFA 1VCIA 4IFDJ 1GJXA 4ILWA 5JVH3 4LFAQ 4GN5A 4J8QA 1CSQA 4I7ZC 5IE8A 2PO4A 1I6HH 1E24A 1Q1BA 2NWGA 1KNEA 4EQOA 4X3SA 3DEPA 4LFAL 4C2MH 4A3DB 2N3SA 1KDCA 2DN8A 1DXMA 3S1NH 1WD0A 2TSSA 1V9PA 2KECA 1TWFB 1K8OA 1CA6A 3J7A5 1XMOL 3T1HL 4Y52H 4PMCA 1TS5A 5IODA 1S4ZA 2QDBA 1UE1A 2K5QA 2XIWA 4GLAC 4PMBA 2B2YC 1VQ6A 5I6WA 5E4XA 1B9NA 3MXGA 1PA6A 1B50A 5GADC 1VQ4A 1DD2A 1EFWA 4LF4L 1EY9A 2CH4A 2KCTA 4HCSA 2D9UA 4E6IA 3PO3H 1MKHA 2A6ED 1WTRA 5ELFA 2I5HA 4MIUA 3CQZH 3K0YA 1HXYD 2KBNA 2R7DA 1QUQB 4QUCA 4HIKA 4HJ9A 4IPGA 3R2IA 1HZCA 3H15A 2A6EC 3V05A 2H5XA 3R2TA 4A3MB 3M3YH 2MP1A 1N34Q 1GUOA 5IGGA 3A7LA 3NE5B 1EQQA 1M1KC 3VYRA 1SN8A 4OL7A 4CKBA 4LUZA 2CWAA 1D5MC 2PZWA 4DR7Q 3MAQA 5DEHA 4JI2L 3J81L 1EY0A 2FHTA 2YU9H 2B2UA 3E3XA 2NN6H 3D8GA 3L0OA 4NW2A 2VUMG 1HNZL 3ND9A 2Q2HA 4RMFA 3K7AB 2YTYA 4I65A 3CMEA 4B3ML 1I4XA 3MA2B 4L6TB 3H0GB 3KJPA 3KLSA 2MGSA
chains in the Genus database with same CATH topology
2K32A 2B39A 4J1MA 3FDTA 2A73B 4B9XA 3I91A 1SYDA 2NBFA 1L0XB 5CV7A 3BZDB 2I46A 2DY7A 2QCPX 2N88A 2ICEC 2O5IC 1A6XA 3W3AA 2B8FA 2MUYA 1EOTA 1A3VA 4ID6A 4DNTB 2IX3A 4X3TA 1STEA 3D31A 4U673 4ZUIA 5J1ZA 2AWNA 3GQBA 1LTRD 1I4HA 2EZVA 2FINB 4C1NK 4FVMA 4ZLTF 2XWJB 1I6VC 2J4XA 1Y69U 2HUGA 1LTSD 3KLRA 1HTPA 1GXDC 3HOWB 4ODGA 5FO7B 1M4VA 4C3JB 1VMCA 2C9OA 3WOFA 4IN3A 1QWYA 2ZXPA 1SEBD 1WTQA 2F0KA 1ICWA 1LABA 4CJ2C 2F0PA 5M5WB 1HTLD 5J39A 1F2ZA 1GOZA 4UAIA 2EJGC 3H6MA 5JPNC 4IUNA 4Q5VA 4IZ8A 3VYSA 4G57A 3GD7A 1AZQA 2L1BA 2F0LA 5T1GA 3FPPA 1RJTA 2BE5C 1PFBA 2KOLA 1TS2A 4CKCA 3TZDA 1A3TA 4DA2A 4JK1C 3DEOA 2B2WC 3HKZB 2F0DA 3S15B 5K36H 5M5YB 5EKLA 1IYVA 3GTKB 4IUTA 2PMZB 2YYZA 3PUYA 3D6CA 4IUPA 5CV8A 4IURA 1SYGA 3P20A 4A3BB 2R92B 1TY0A 1CQVA 4A3KB 2BDNA 2H1EA 5IT9L 3J80E 1DYQA 2F0WA 2LMCB 1TWGB 2Y0SB 1EQVA 4FXGC 3ERQA 1QNKA 4V0BA 1B4OA 1TKWB 2RDGA 1Q12A 2KCNA 1ZYRD 3K5MA 1PYWD 1VF7A 2MPMA 4BS9A 4KY5A 4DNRB 2E2HB 1Q8IA 1ZYRC 5EBCA 1X3QA 5LHY1 3A8JE 1SAPA 3TDQA 4RHRA 3U9SA 4EQNA 1CHPD 2K33A 3K5OA 4KHVA 4DAPA 1AN8A 1F9PA 1EFID 2AWOA 3HOYB 4HEDA 2IL8A 2E74C 1B9MA 1F9RA 4KD3A 1JQYD 5EJWA 4RWSC 4S3SA 4OO1I 3TSSA 3EFXD 4FO2A 1BF4A 1UAPA 4KY7A 1PFMA 1EL0A 4K5XA 1E2VA 4KJOA 2A68D 2LFNA 2J0TD 3J7AF 3Q23A 4ZYSA 1RKNA 2F0QA 3DWAA 4HAEA 3P1HA 1JICA 1HPCA 5CV6A 5C4JB 1XWEA 2ZT9C 1DJRD 1JOOA 4WJWA 1TWHB 1CFMA 4HCEA 1SMYD 1A2TA 5I6YA 5I2YA 2NUCA 1SMYC 4ZKCB 4DK0A 1TWCB 1KDAA 3OSOA 1H9KA 3V2TA 3OIPA 4K8JA 3VR5A 1JWMD 3E0JA 4C2MB 1XX8A 3MXUA 1JC7A 1RHPA 3H09A 2EXZA 3KBGA 5KNDA 4P2CB 1KABA 1F9QA 3R8BA 2D62A 1NR4A 4RAUC 1CM9A 5M5XB 3S16B 1QE6A 3NWTA 1CI3M 1D6EC 2KEEA 3I4MB 2Q8RE 3TMEA 2KA7A 1TR5A 3NUCA 4K8IA 2ENBA 5A2QL 1J8IA 2B2VC 3P7JA 5IOCA 1C48A 2O4XA 4U68A 5FKAC 3TP7A 1WVLA 3M3YB 3GV3A 2FJ2A 2NN6I 2M00A 1QNUA 2CVRA 4KN7C 1PRTC 5JAVA 3SK4A 1HA6A 4FXKC 4K6DA 1VF5C 5NUCA 1BCPD 3HEJA 2YU9B 1PRTD 3M7GA 3AU7A 2BDOA 3E5SA 3TP5A 1EWHA 4XQQA 4O42A 4HR7B 2L5TA 3NBHA 3H91A 4DXGA 4HSVA 4PMWA 3HOXB 1JORA 4FF1A 3SXHA 3MWYW 5F2DA 3OWFA 3N52A 3O13A 1LO5D 4K2KA 3VYTA 2NZ1D 1A3UA 2K6AA 1B3AA 1ONLA 1V1OA 1R4PB 2WAQB 1SJED 4IFDH 3SHLA 2KCCA 4ZAIA 5C3XA 3SEBA 1H9MA 3G6JB 1D1KA 1HA5A 4N9TA 3BDOA 2OXPA 4ZKBB 1D1IA 1IW7C 3W2DA 2VNUD 3GTOB 4OIKA 3R93A 4A3FB 2Q8TA 2I07B 1DCZA 2K03A 4OHJA 2H4OA 4KHZA 4H13C 5C4HA 4XTCS 1QG7A 3HGBA 1PDQA 3H94A 2VB3X 4NKLA 4BA1I 1ZEQX 5CMDA 2RBMA 2EE1A 5K5PA 2NB0A 4K2LA 4M1UB 1AZPA 2JXMB 4JBWA 2EVBA 2E2JB 2BE5D 1SYCA 2NVTB 5ELEA 1I4QA 2AQ1B 4KN4C 1S5DD 5C0XJ 4OIJA 1EU4A 2B8GA 3I90A 4BBRB 1EIGA 3MC0B 5M9OA 2O2LD 4ULLA 4EGVA 1I50B 1X3PA 1HFGA 5C3WA 2XN9C 4XXEA 2ICIA 4C3IG 4G4KA 1ESRA 4KTAA 5CV5A 3KLSX 3NXWA 2JSOA 4M8AA 4OO1H 2LS01 5C44B 4IUQA 1PZID 4KI0A 4ME5A 5EKKA 2DNCA 1IL8A 1NUCA 4TKOB 1SXTA 4RGOS 2RDFA 3EROA 1DOLA 4C3HG 1HRJA 3HS0C 1CQFA 4A3GB 1C4QA 2ID0A 1FD7D 2CW0D 3ITPA 4H44C 1I4PA 3OIQA 2F0EA 5JOBA 1G291 2KHSA 3NP8A 5C5MA 5EKIA 2RVLA 1H9JA 4KV6A 2R7ZB 1OO9B 1EZ6A 3S1QB 1GHJA 2ZXOA 4X3UA 5A35A 1TU2B 3M4YA 4C3HB 1X32A 1BCPF 2Z4IA 3VR4A 1LTID 4RCOA 1CTMA 5FO9B 1MSHA 4DAVA 2NTTA 1STBA 5IT9E 2OT2A 2EYHA 1WTVA 5EPLA 1OXVA 1A15A 4FF4A 5G3LD 4KKSA 2C5CA 2R93B 3GTGB 3NTIA 3DXJC 1ZKOA 1C8CA 2A69C 4ZUJA 3PMFA 3MXNA 4OO1G 1JWSD 5ELBA 2A69D 2BCOA 5BN5A 2NYZD 3CRLC 1BNZA 1PRTF 1AW7A 2K28A 2L4NA 3SR1A 2MJ8A 1SBBB 3DUZA 4NP5A 1SDFA 5LL6S 4MN3A 1G2TA 3WDNA 3I4LA 1O7ZA 3MTSA 1LTBD 5CYUA 2ZXRA 2EJMA 4IUVA 3HOZB 5M3MB 1ZXTA 3A8IE 1RDPD 3EJIA 3EVQA 2RKSA 5KEEA 1S5CD 3OHXC 4IUUA 1FNWA 2PCFB 5EPJA 5KRUA 4WFN3 2D2CC 2IX0A 1LTAD 1TS4A 1I4RA 2EYJA 5EBDA 1R9TB 3BYTB 3A54A 4CBVA 3L9AX 2EYMA 5IGBA 1NSNS 2L55A 1OXTA 2CHBD 4FNFA 4RA8A 4RGNA 5ELCA 2SNSA 1BCPC 4G7HC 2B2TC 3IKJA 1PLFA 2F0VA 1BQQT 5I9OA 3GP7A 3E6ZX 2PW7A 1YNJC 4AYBB 1MSGA 4KMUC 2IW3A 3L3OC 5IGEA 3M7NA 1F2LA 4NMZA 1JE4A 3HP3A 2WKCA 3T51B 3NBIA 2F0GA 3A56A 5EQ0A 3C1EA 2EYLA 1L0YB 2G9HD 1F77A 4QF4A 2IJ0A 1LTGD 1ENFA 3PIO3 2XNAC 2Z8LA 3MXPA 4DK1A 2HDLA 3BVZA 3S14B 2WIIB 4C1NI 1G2SA 3AB9A 2LKVA 1EZ8A 1JWUD 1J9OA 2PNRC 1GHKA 1HQRD 3ND8A 3NTHA 3PV0A 1UEAB 5IGCA 4FYDA 2BA1A 1G6ZA 1WD1A 5IGFA 4HTHA 1MBYA 5D65A 4RHSA 2F03A 1GUGA 3KUPA 2OEOA 4V190 4C56C 3K5NA 2XWBB 3M85A 3RMHA 1SNDA 5C0XH 5LL6X 1DM0B 2B2UC 2F0UA 1V43A 3RZOB 4KJNA 4DU9A 3HG9A 1I4GA 3C1FA 2F0OA 4F8MA 2BA0A 1TIID 1FYCA 4HSPA 3LWUA 1SNMA 3T4AC 2XRQD 1CZWA 1TQOA 4F87A 2F0FA 2E76C 2F0HA 1SJHD 1EYDA 1XYIA 1DOMA 1MI2A 1F2YA 4J6HA 3LNNA 4MHEA 5HGTA 4DXFA 3J81E 4KY6A 2PYKA 2EDGA 2F4IA 1GUTA 2NVYB 1TT2A 3NQTA 1FNVA 2F3VA 2L9HA 4FF2A 4PV1C 4XYQA 3L7ZC 5FO8B 3HOVB 1PTOC 1U4PA 3CU7A 1MGSA 5TSSA 1QJOA 3BS1A 3D4RA 2FMMA 3I3CA 2F0SA 3TP8A 3FMCA 1BBXC 4YIJA 2EYOA 1U4MA 4Q0FA 2RSOA 5C0XG 3MZ5A 1T5EA 3BDCA 4A3JB 2GA4B 2QKIC 5FOBB 4TSSA 1Y8PB 1EWCA 4FF3A 5C3EB 4IFDG 4FXDA 3GV6A 1KNAA 4A93B 1HCZA 3QOJA 3S2DB 3OWEB 1KAAA 5KNCA 4XQJA 2F0NA 2SOBA 1CA5A 2R3ZA 1YNND 3KF8A 3DM1A 4NDXA 1B44D 4CHTB 3VA7A 2E2DC 1RODA 1EY6A 4O1NA 4XQNA 3J80L 2JA6B 5K36G 1RF2D 2FMCA 2HQEA 1TS3A 5E1FA 1AEXA 1B53A 1LT4D 2R61A 4H0LC 3X3MA 1A2UA 3URYA 3Q24A 3S2HB 3RD4A 4QCLA 2OF1A 1ESFA 5CORA 2Z4HA 3D3RA 4UDUC 1LT6D 1T5XD 2DY8A 5E4WC 1LACA 1PXUA 2CW0C 2SNMA 2X6LA 3SK6A 4BWGB 4GZYC 2HDMA 1HHVA 2M2LA 2RQXA 1VMPA 2D5DA 3NK9A 3JAME 2SEBD 2JA7B 2B2WA 4CJ1B 3QOLA 5C0XI 3K5LA 2X69A 5CV4A 3SE0A 3BVGA 3QO2A 2L0CA 1PFNA 5I9PA 1WTOA 2L12A 5FLXE 1DONA 1RTNA 5CR3A 1ENAA 3PUVA 2AUKA 3S1MB 5C4ZA 3GTMB 1SE2A 2KJXA 3NHHA 4N9PA 5JJZA 3MFYA 1SE4A 3SVMA 1ET6A 4XDXA 3VYUA 3LX0A 3QIAA 3V96A 1KLGD 4TRDA 2A5HA 2B2YA 3Q0AA 3QJYA 2QEJC 4LK1C 1I6HB 1V1PB 5C6AA 4G7ZC 3BVMA 1IKLA 3T53B 2JP1A 1Y1WB 1EYAA 2F1MA 1B2TA 5KYLA 2K5WA 2KEDA 2K04A 1GUSA 5FK9C 2IPKD 1SFOB 2F0IA 3FRPB 1CHQD 1V8QA 3GTLB 3AMUA 2K7VA 1OXSC 3IFDA 5ELDA 5HURA 2NN6G 1SNOA 3CHBD 5IGDA 4K5VA 4ZQ3A 3M4OB 2HCCA 4LJZC 2VUMB 1VDZA 2EJFC 3FPUB 1KTKA 4A3EB 2JEBI 2M9VA 2PQEA 4EQPA 1QOHA 3QB3A 1ENCA 3KBXA 2QILA 4IFDI 2AQ3B 5D14A 3BDLA 4WRDA 1TVXA 1E2WA 5COYA 4K6LA 2N55A 5CBEE 4RH6A 1SNPA 4L8JA 1TWAB 5I2XA 1DOKA 3VR2A 4BBSB 1FGBD 4ZRZA 2EYFA 1D5ZC 2Z1CA 3OOCA 5M3FB 2WKDA 3BYYB 2A74C 4PNYA 4IQZA 3FVQA 3HZXA 3GTPB 3R3OA 5KGUA 2K5DA 5JVG3 4KD4A 1Z7TA 3CRKC 4QMGA 2F0JA 3NWSA 3ONAB 1STAA 1CT1D 5BN4A 2A6HD 4DFAA 3T56B 1JR0D 4B9WA 4A3IB 2JA5B 2WINB 3S17B 3GO5A 1BOSA 4L63B 1PRTB 2EOTA 3J7AV 3DMUA 1O78A 4CGYB 1EY7A 1PTOB 1Q90A 1RTOA 1SSOA 5KNBA 3HRZC 4RKLA 3SDZA 1WTXA 2PZTA 4G7OC 2NVXB 5A2QE 4C3IB 1U9RA 1AP0A 1S5ED 1SNCA 1HUMA 2IT1A 2K05A 2CQAA 2NVQB 4BY7B 1KDBA 4TQUS 2B2TA 4EVOA 1W6JA 1SE3A 1XTCD 3C2PA 1O80A 2TMPA 4ABNA 1YNJD 2BOSA 1FR3A 1PMRA 4HMJA 2WACA 3KK7A 1E2ZA 1H9SA 3K57A 4LAAA 2L11A 5CBAE 3A7AB 1K83B 3OPOA 1ET9A 1GUNA 3FKIB 4R8IA 4CJ0B 4R9WA 2LY7A 2JE6I 1JB3A 1Q1EA 2K1BA 2XRSD 1II3A 3F2UA 1BCPB 1D5XC 3SK8A 3PUWA 5EGTA 1IKMA 1IW7D 1ML0D 1EEID 3HOUB 1BUVT 5AFWA 3DHQA 3PIP3 2NTSA 3I72A 1IYUA 3RUZA 4XIGS 2HCIA 3GTJB 2E2IB 3WOEA 1F9SA 3P75A 2IX1A 1PTOD 1Y1VB 3S1RB 3QWNA 1JCKB 3A8KE 1JOQA 4DGZA 4XT3B 4XYOA 4BY1B 3I73A 4ZK9B 3OMCA 1Z47A 4KKUA 1STNA 2AUJD 1LTTD 2K01A 2JEAI 3K6OA 4RGTA 1O7YA 5DAUA 1BDOA 2X6GA 4H7BA 3K58A 1GUWA 5CV9A 1O7LA 3JAML 4DF7A 3S1NB 1NCVA 1PTOF 5DM73 1HFNA 2V4DA 4CKEA 3MHBA 5KYIA 3IL8A 3TBIB 2Q8IB 2AQ2B 4K14A 1U4RA 1U4LA 1F2MA 1I3QB 3I70A 1YNNC 1EY4A 4WORA 4QIWB 3PO3B 3D4DA 3CQZB 1TY2A 5C4XB 3MFGA 5JEAJ 2DNEA 3Q22A 1QILA 1OXUA 2KQ3A 2F0TA 5G3LF 1NR2A 4R8NA 2R6GA 3K59A 1UUPA 2IWHA 2F3WA 3ZYYX 3D6WA 4DN4M 2FFKB 4FP5D 2QF7A 2XSCA 5EPKA 2F0MA 1HUNA 3VA5A 2EY5A 2PW5A 5D3DA 1EU3A 5CC4A 4F7XA 1ILPA 4RGMA 3QG1A 1WTPA 4F88A 1B1ZA 3TZUA 3Q6SA 3T13A 4PQXA 2SDFA 1PZJD 2PZUA 2WV6D 5DM63 1CK1A 2EY2A 2KUMA 1NAPA 3MVVA 1EY8A 3NQIA 1BR9A 4RCNA 3VR3A 1Q3LA 1S5BD 1Z6HA 3DWQA 1SYFA 5ISRA 4K5WA 4C3JG 3NPPA 3MEHA 1WCMB 5JEAH 2EY6A 2RA4A 1UNSA 2WP8J 5JPMC 3OW7A 5DNFA 3IAYA 4KKTA 1W6KA 5J22A 4B08A 3A55A 3I4NB 2VXWA 2KVMA 1SYBA 1PZKD 5T1IA 3RZDB 1ILQA 2EYPA 3EQLC 5KIXA 3S9WA 3BG3A 1E0BA 1XXGA 1EQTA 4X3KA 4XT1B 2JA8B 1BXTA 1D2BA 3G7LA 3T16A 2VB2X 4RKBA 5I4DA 1Y8NB 1Y8OB 1OXXK 2E75C 1HQMC 1LV9A 1PTOH 2G9DA 3U9OA 1STYA 3IFTA 1LT3D 3RLFA 3TP6A 3N6RA 3PUZA 1EEFD 2EY1A 5CGKA 1LT5D 5IIFA 4IALA 1EIHA 2A68C 1RD9D 1S5FD 2B63B 1RCVD 1K8MA 3OMGA 2RDHA 1G8ZD 1MD2D 1H9RA 4HN7A 3PO2B 1LLRD 5D3IB 4BA2I 1QB5D 2JYOA 3FEWX 2B2VA 1G91A 3TN2A 2RSNA 2XVSA 1SYEA 3DWPA 4RFBA 2EPBA 4OGQC 4QB4A 4DAYA 1FNUA 3NSWA 2MHVA 3J7YW 1M8AA 1H9SB 3PUXA 1STGA 1JOKA 2WB1B 2A6HC 3EA6A 5JEAG 1DZ1A 1BO0A 1IHZA 1CZGA 3SK5A 3VR6A 1QCBD 1KLUD 3GTQB 1EY5A 3LWEA 2PPBC 1EYCA 3X3NA 3UI2A 5BN3A 3CKIB 3C3LA 1WTWA 3H3VC 2J7ZA 1V1PA 4Z9CB 2O5JC 3D4WA 5C5LA 1SNQA 1AFPA 3C46A 4LMQD 5FLXL 1STHA 3NTKA 4HMIA 3I8ZA 4KK7A 5E3FA 4Y7NB 1R4QB 4QUFA 1VCIA 4IFDJ 1GJXA 4ILWA 5JVH3 4J8QA 4I7ZC 2PO4A 1Q1BA 2NWGA 1KNEA 4EQOA 4X3SA 3DEPA 4A3DB 1KDCA 2DN8A 1DXMA 1WD0A 2TSSA 2KECA 1TWFB 1K8OA 1CA6A 4PMCA 1TS5A 5IODA 1S4ZA 2QDBA 2K5QA 2XIWA 4PMBA 2B2YC 5I6WA 5E4XA 1B9NA 3MXGA 1B50A 1DD2A 1EY9A 4HCSA 2D9UA 4E6IA 2A6ED 1WTRA 5ELFA 3K0YA 4MIUA 1HXYD 4QUCA 3R2IA 2A6EC 3V05A 3R2TA 4A3MB 2MP1A 1GUOA 5IGGA 3A7LA 3NE5B 3VYRA 4OL7A 4CKBA 1D5MC 2PZWA 3MAQA 5DEHA 3J81L 1EY0A 2FHTA 2B2UA 2NN6H 3D8GA 4NW2A 3ND9A 3K7AB 4I65A 1I4XA 3MA2B 4L6TB 3H0GB 3KLSA 2MGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2W C;  2K01 A;  2HCC A;  3I8Z A;  3Q6S A;  3FDT A;  3FPU B;  1O7Y A;  1MSH A;  1U4M A;  2RSO A;  2SDF A;  2B2T A;  1X32 A;  2X6G A;  3I91 A;  4QUF A;  1GUW A;  2X69 A;  2KUM A;  4O42 A;  4IUT A;  1NAP A;  4HAE A;  1EIH A;  4IUP A;  3H91 A;  3KBX A;  4RA8 A;  1JIC A;  4IUR A;  4HSV A;  4OIJ A;  1Q3L A;  1WTV A;  2DY7 A;  1O80 A;  2B2T C;  5EPL A;  1NCV A;  3QO2 A;  3I90 A;  1PFN A;  1PLF A;  3MWY W;  1A15 A;  5D14 A;  1EIG A;  1HFN A;  2B2U C;  2NWG A;  1KNE A;  1TVX A;  1KNA A;  3GV6 A;  3N52 A;  1WTO A;  5COY A;  2L12 A;  1DON A;  4X3S A;  2N88 A;  2L11 A;  3DEP A;  1RTN A;  2NZ1 D;  5CBA E;  1X3P A;  3IL8 A;  2BDN A;  2H1E A;  1HFG A;  2JYO A;  1EOT A;  1B3A A;  2N55 A;  2B2V A;  4X3T A;  4ZKC B;  5CBE E;  1C8C A;  1CA5 A;  1G91 A;  2RA4 A;  3TN2 A;  2R3Z A;  2RSN A;  1WD0 A;  3DM1 A;  1DOK A;  2KEC A;  1U4R A;  1MSG A;  2FIN B;  4R8I A;  1U4L A;  5JJZ A;  4ZAI A;  1CA6 A;  5DNF A;  4ZLT F;  4CJ0 B;  1ESR A;  1QNK A;  3SVM A;  4R9W A;  4XDX A;  2EPB A;  2NYZ D;  1B4O A;  1XX8 A;  1F2L A;  2K1B A;  1BNZ A;  2HUG A;  1JE4 A;  1RHP A;  1ROD A;  1S4Z A;  2K28 A;  3HP3 A;  1M8A A;  2L4N A;  2VXW A;  2XIW A;  2MJ8 A;  3F2U A;  2B2Y C;  2KVM A;  4IUQ A;  1F9Q A;  5EQ0 A;  5E4X A;  2MPM A;  1EL0 A;  2B2Y A;  4ZKB B;  1SDF A;  5T1I A;  4MN3 A;  1B50 A;  1IL8 A;  1G2T A;  4HCS A;  1ILQ A;  1VMC A;  1NR4 A;  2D9U A;  4RAU C;  1DZ1 A;  1CM9 A;  1O7Z A;  1X3Q A;  3MTS A;  1BO0 A;  1B53 A;  1NR2 A;  1DOM A;  1QE6 A;  3ONA B;  1WTQ A;  1WTR A;  1XYI A;  1SAP A;  1IKM A;  1MI2 A;  1DOL A;  4MHE A;  2KEE A;  4OIK A;  1ICW A;  1ML0 D;  4QUC A;  4CJ2 C;  3R93 A;  1HRJ A;  4IUV A;  2Q8R E;  1E0B A;  2HDL A;  1IKL A;  1EQT A;  1ZXT A;  4X3K A;  4XT1 B;  5AFW A;  2Q8T A;  3LWE A;  2JP1 A;  2K03 A;  2MP1 A;  3D6W A;  1B2T A;  4UAI A;  3UI2 A;  1G2S A;  4DN4 M;  5COR A;  2FFK B;  1J9O A;  1F9P A;  3G7L A;  1J8I A;  2KED A;  2K04 A;  5E4W C;  1QG7 A;  2DY8 A;  1WTW A;  2B2V C;  2HCI A;  2EOT A;  3P7J A;  1F9S A;  4IUU A;  2J7Z A;  1PDQ A;  1AZQ A;  2L9H A;  2L1B A;  4HED A;  4U68 A;  5EPJ A;  1RTO A;  1SSO A;  2IL8 A;  5T1G A;  1WVL A;  2X6L A;  3GV3 A;  2FHT A;  1RJT A;  5EPK A;  1F9R A;  1PFB A;  2B2U A;  1G6Z A;  1HUN A;  2KOL A;  4NW2 A;  2FJ2 A;  5EJW A;  5EKI A;  1WTX A;  1WD1 A;  2RVL A;  4RWS C;  4XT3 B;  2CVR A;  3IFD A;  3TZD A;  2HDM A;  5CMD A;  1HHV A;  1U4P A;  2M2L A;  4ZK9 B;  2EE1 A;  1HA6 A;  1MGS A;  3I3C A;  1LV9 A;  2FMM A;  1BF4 A;  4X3U A;  5D65 A;  4LMQ D;  1VMP A;  3DEO A;  1AZP A;  1ILP A;  1AP0 A;  1PFM A;  1WTP A;  2B2W A;  3KUP A;  1HUM A;  4CJ1 B;  1BBX C;  2MGS A;  2K05 A; 
#chains in the Genus database with same CATH topology
 2K32 A;  2B39 A;  4J1M A;  3FDT A;  3CCS A;  1VQM A;  2A73 B;  4B9X A;  3HOZ H;  1WCM G;  3I91 A;  1E3P A;  1J5E Q;  4HJA A;  1SYD A;  2RHQ B;  2NBF A;  1L0X B;  5CV7 A;  2CKZ B;  1HNW L;  1MIU A;  3BZD B;  3A5Z B;  2I46 A;  2DY7 A;  1SLJ A;  3I4M G;  1A62 A;  5C3E G;  2UUC Q;  2QCP X;  2N88 A;  2ICE C;  2O5I C;  1A6X A;  3W3A A;  4GNX C;  2B8F A;  2MUY A;  1EOT A;  4A3I H;  2OTL A;  1A3V A;  4ID6 A;  4DNT B;  2IX3 A;  1LM0 A;  1STE A;  4X3T A;  2JA7 G;  4A3G G;  3D31 A;  4U67 3;  4ZUI A;  5J1Z A;  2AWN A;  3GQB A;  1LTR D;  1I4H A;  2EZV A;  2FIN B;  1WCM H;  4C1N K;  3CP0 A;  4EQ5 A;  4FVM A;  2GVB A;  4DR6 Q;  4ZLT F;  2XWJ B;  1I6V C;  3CXC A;  2J4X A;  1Y69 U;  2HUG A;  1N8R C;  1LTS D;  3KLR A;  3CMA A;  1HTP A;  1I94 L;  1GXD C;  1CSP A;  4ODG A;  5FO7 B;  2ZJR A;  3HOW B;  1M4V A;  3HOV G;  4C3I H;  1SRU A;  3KOJ A;  1SR3 A;  4C3J B;  1VMC A;  5FJ8 H;  1IBM Q;  2C9O A;  3WOF A;  1XNR Q;  1L2F A;  4IN3 A;  1QWY A;  2ZXP A;  1SEB D;  1WTQ A;  2N8N A;  2F0K A;  1U5K A;  1YHB A;  1ICW A;  1LAB A;  4CJ2 C;  2F0P A;  4R4O A;  5M5W B;  1HTL D;  5J39 A;  1BVS A;  1F2Z A;  1GOZ A;  1C9O A;  4UAI A;  2EJG C;  3H6M A;  5JPN C;  4IUN A;  3VDY A;  4Q5V A;  4IZ8 A;  3VYS A;  1HR0 W;  3F8T A;  4LUV A;  4G57 A;  2HQL A;  3GD7 A;  3RLN A;  1VQ5 A;  3TS0 A;  1AZQ A;  2L1B A;  2F0L A;  5T1G A;  3FPP A;  3J7Z C;  1RJT A;  2BE5 C;  1PFB A;  2KOL A;  2RF4 A;  2E2J H;  1TS2 A;  2R92 G;  4CKC A;  4P75 A;  4IO9 A;  1D7Q A;  1XNR L;  2NVT H;  3TZD A;  1A3T A;  4DA2 A;  4UHV A;  2UU9 L;  4JK1 C;  3DEO A;  2B63 G;  2B2W C;  2K14 A;  1S3O A;  3HKZ B;  4LF7 Q;  2F0D A;  3S15 B;  5K36 H;  5JJL A;  5M5Y B;  1FGU A;  5EKL A;  1IYV A;  4PZ6 A;  3GTK B;  4IUT A;  1YHQ A;  2PQA A;  2PMZ B;  2YYZ A;  3PUY A;  3D6C A;  4IUP A;  5CV8 A;  4IUR A;  4GKJ Q;  1SYG A;  3P20 A;  4A3B B;  2R92 B;  5IYB H;  4A3L G;  1TY0 A;  1CQV A;  3PIP A;  4A3K B;  1GVP A;  2BDN A;  2H1E A;  3UDG A;  3RLO A;  4X62 Q;  5IT9 L;  3J80 E;  2B63 H;  1DYQ A;  2CH4 W;  5M3M G;  2F0W A;  4A4I A;  4CDF C;  2LMC B;  2F4V L;  1TWG B;  4P71 A;  2Y0S B;  1EQV A;  4OX9 L;  4FXG C;  4OWT B;  3GTJ H;  3ERQ A;  1QNK A;  4V0B A;  1B4O A;  1TKW B;  3J81 i;  2RDG A;  1Q12 A;  1PV4 A;  3KF6 A;  2KCN A;  3W5O A;  4AH6 A;  4GOP C;  1ZYR D;  3K5M A;  1PYW D;  1VF7 A;  1X54 A;  1CKN A;  2MPM A;  4BS9 A;  4KY5 A;  4DNR B;  2E2H B;  1Q8I A;  2QDL A;  2NZO A;  1ZYR C;  5EBC A;  2E8G A;  1X3Q A;  2ZTD A;  5LHY 1;  4JI7 Q;  3A8J E;  1SAP A;  3TDQ A;  3D0F A;  4RHR A;  3U9S A;  4EQN A;  3LGJ A;  1CHP D;  2K33 A;  3K5O A;  1CUK A;  2RHS B;  4KHV A;  4K0K L;  3RN2 A;  4DAP A;  3KF6 B;  1AN8 A;  1F9P A;  2UUC L;  4HJ7 A;  1EFI D;  2AWO A;  3GTQ H;  3HOY B;  4HED A;  2IL8 A;  2E74 C;  1HNW Q;  1B9M A;  2OQK A;  1F9R A;  4KD3 A;  1HJP A;  1JQY D;  5EJW A;  4RWS C;  4S3S A;  4L5S A;  4APV A;  3HFZ B;  4OO1 I;  4ALP A;  3TSS A;  3EFX D;  4FO2 A;  1BF4 A;  1UAP A;  2MNA A;  4KY7 A;  1PFM A;  2K5V A;  4I7A A;  1EL0 A;  4DAY B;  3M4Q A;  4K5X A;  4OX9 Q;  1E2V A;  3UE1 A;  4AYB G;  1Q7Y C;  4KJO A;  2A68 D;  2LFN A;  2J0T D;  3J7A F;  3G6E A;  3KF8 B;  1NMF A;  3Q23 A;  5C4X H;  4ZYS A;  1RKN A;  2F0Q A;  2R93 H;  3DWA A;  4HAE A;  3P1H A;  1JIC A;  1HPC A;  4JV5 L;  5CV6 A;  5C4J B;  1XWE A;  2ZT9 C;  1T9H A;  1DJR D;  4JI8 L;  1JOO A;  4WJW A;  1TWH B;  3K81 C;  4JW0 A;  1YHA A;  1CFM A;  4HCE A;  1SMY D;  1A2T A;  4X66 L;  5I6Y A;  5I2Y A;  2HIV A;  2NUC A;  3H3V H;  1SMY C;  4ZKC B;  4DK0 A;  1TWC B;  1X65 A;  4H02 A;  1KDA A;  3OSO A;  1H9K A;  3V2T A;  1Q86 C;  3OIP A;  4K8J A;  3VR5 A;  3GDE A;  1JWM D;  3E0J A;  4C2M B;  4BBS G;  1XX8 A;  3MXU A;  1K3R A;  1JC7 A;  5IYC H;  1RHP A;  1HR0 Q;  4PG3 A;  3KDF A;  3H09 A;  2EXZ A;  3KBG A;  5KND A;  4NXM Q;  4P2C B;  1P16 A;  4QY7 A;  3ULJ A;  1KAB A;  1F9Q A;  5M3M H;  3R8B A;  2D62 A;  1NR4 A;  4RAU C;  1CM9 A;  5M5X B;  3S16 B;  3ULP A;  1A63 A;  1QE6 A;  3NWT A;  1CI3 M;  1VQK A;  1D6E C;  2KEE A;  3KYH C;  3I4M B;  2Q8R E;  3TME A;  2KA7 A;  1TR5 A;  3CPF A;  3NUC A;  4QJF A;  4K8I A;  2BH2 A;  1P8L A;  2ENB A;  5A2Q L;  1J8I A;  2B2V C;  1ASY A;  4GNX A;  3P7J A;  4FDB A;  5IOC A;  1C48 A;  2O4X A;  4U68 A;  4CDD C;  5FKA C;  3TP7 A;  4A3M H;  1R9T H;  1WVL A;  3M3Y B;  3GV3 A;  2FJ2 A;  2NN6 I;  1L1O A;  2M00 A;  1QNU A;  1GO3 E;  2CVR A;  4KN7 C;  1PRT C;  5JAV A;  1B8A A;  3SK4 A;  1HA6 A;  4FXK C;  4K6D A;  3K80 C;  1VF5 C;  5NUC A;  2IY5 B;  5FJ8 G;  1BCP D;  3HEJ A;  2YU9 B;  1PRT D;  3M7G A;  4B3R L;  4QL5 A;  3AU7 A;  2BDO A;  1Q81 C;  3E5S A;  3TP5 A;  1EWH A;  3K7A H;  5AJ3 L;  4XQQ A;  4O42 A;  4HR7 B;  4B3T Q;  2L5T A;  3JC6 6;  1FL0 A;  3NBH A;  3H91 A;  1KHI A;  4DXG A;  4HSV A;  4PMW A;  4X66 Q;  3HOX B;  3RZD H;  1JOR A;  4P73 A;  1EUJ A;  4FF1 A;  3SXH A;  3MWY W;  1YBY A;  5F2D A;  3OWF A;  1N33 L;  3N52 A;  3O13 A;  1LO5 D;  4JV5 Q;  4K2K A;  3VYT A;  2NZ1 D;  1A3U A;  3G71 A;  2K6A A;  1XPU A;  5EAY A;  1B3A A;  1ONL A;  1V1O A;  1R4P B;  2CFM A;  1SMX A;  2WAQ B;  1SJE D;  4IFD H;  3SHL A;  2KCC A;  4ZAI A;  5C3X A;  4GKK Q;  2I5M X;  3SEB A;  1H9M A;  3G6J B;  1D1K A;  4LF4 Q;  1HA5 A;  4N9T A;  1PHJ A;  1KRS A;  1VQG A;  3BDO A;  2ZM6 L;  4DR6 L;  1WJJ A;  2LXK A;  3K8A A;  2OXP A;  4ZKB B;  1I5F A;  1D1I A;  1IW7 C;  3W2D A;  2UUB Q;  2VNU D;  2JQO A;  3GTO B;  4OIK A;  3R93 A;  4A3F B;  5IP9 G;  4DR2 Q;  2FXQ A;  2Q8T A;  4DAM A;  2I07 B;  1DCZ A;  3CCQ A;  3S1M H;  2K03 A;  4OHJ A;  4BXX H;  2H4O A;  1KL9 A;  4KHZ A;  2Y0S E;  4H13 C;  5C4H A;  4XTC S;  1QG7 A;  3HGB A;  4DR3 L;  5DLQ E;  1PDQ A;  3H94 A;  2VB3 X;  4GN3 B;  5M5W H;  1E22 A;  4MNO A;  4NKL A;  2ZJQ A;  4BA1 I;  4B3R Q;  2ALY B;  2N49 A;  1K73 C;  2KHJ A;  1ZEQ X;  2RBM A;  5CMD A;  2EE1 A;  5K5P A;  3I4N G;  2NB0 A;  1PYS B;  4K2L A;  4DUY L;  4M1U B;  1AZP A;  1PFS A;  2N78 A;  4DV0 L;  1IBK L;  2JXM B;  4JBW A;  2EVB A;  2E2J B;  2BE5 D;  2OQ0 A;  3W1G A;  5L37 A;  1SYC A;  2NVT B;  2K4K A;  2GVA A;  5ELE A;  1I4Q A;  4TVA B;  2AQ1 B;  4KN4 C;  1DGS A;  1S5D D;  4IJL A;  5C0X J;  1V1Q A;  4P74 A;  4OIJ A;  1W3S A;  1JMC A;  1PH5 A;  2MO0 A;  1EU4 A;  1WI5 A;  2A1A A;  2B8G A;  3I90 A;  4BBR B;  1EIG A;  3MC0 B;  5M9O A;  4LFB Q;  1QVF A;  2O2L D;  4ULL A;  4DV5 L;  4EGV A;  1I50 B;  1X3P A;  1HFG A;  3A5U A;  5C3W A;  2IHF A;  2XN9 C;  4JI3 L;  4XXE A;  2EIF A;  3MXN B;  4AQY Q;  1NE3 A;  4KHP L;  2ICI A;  4C3I G;  2ZM6 Q;  3CCM A;  4G4K A;  1ESR A;  4KTA A;  5CV5 A;  3AYH B;  3KLS X;  3NXW A;  2JSO A;  4M8A A;  2HHH Q;  4OO1 H;  4R1J A;  2LS0 1;  1YIJ A;  5C44 B;  1VQE A;  4IUQ A;  2JA6 G;  1PZI D;  4KI0 A;  4ME5 A;  5EKK A;  2DNC A;  3E9H A;  1IL8 A;  4JCV E;  5IY0 A;  4GLV B;  1NUC A;  4TKO B;  1SXT A;  4RGO S;  2RDF A;  2NVY H;  3ERO A;  1DOL A;  4ME3 A;  3QR8 A;  3CD6 A;  2KCM A;  4C3H G;  1HRJ A;  4DR1 L;  3HS0 C;  5IP7 H;  4HJ8 A;  1CQF A;  2JA8 G;  4A3G B;  4LF6 L;  4POG A;  1C4Q A;  2ID0 A;  1FD7 D;  2CW0 D;  3ITP A;  4H44 C;  1I4P A;  3HKZ E;  3OIQ A;  4BBS H;  2F0E A;  5JOB A;  4A76 A;  1G29 1;  2KHS A;  3NP8 A;  4P72 A;  1Y1V G;  5C5M A;  2VQF Q;  5EKI A;  4OXP A;  2RVL A;  1H9J A;  4KV6 A;  2R7Z B;  1VS0 A;  1OO9 B;  1EZ6 A;  4AIM A;  1GHJ A;  1X6O A;  2ZXO A;  3S1Q B;  4X3U A;  5A35 A;  1TU2 B;  1TWF H;  1FJG L;  3M4Y A;  4C3H B;  1X32 A;  1HNZ Q;  1BCP F;  1J5E L;  2Z4I A;  3AFP A;  2VW9 A;  2C35 B;  3VR4 A;  1LTI D;  4RCO A;  1CTM A;  5FO9 B;  1MSH A;  4A3C G;  4DAV A;  1N36 L;  2NTT A;  2VL6 A;  1STB A;  1MJC A;  2ZJP A;  5IT9 E;  5IYD G;  2OT2 A;  2EYH A;  1WTV A;  5EPL A;  1OXV A;  1A15 A;  4DV1 Q;  4FF4 A;  2L15 A;  4DV7 L;  5G3L D;  1VQL A;  4KKS A;  2NZH A;  2C5C A;  2R93 B;  3GTG B;  4LF5 L;  3NTI A;  3DXJ C;  4IPC A;  2Z6K A;  1ZKO A;  4DUZ L;  1C8C A;  2A69 C;  4ZUJ A;  3M4P A;  3PMF A;  1O7I A;  3E0E A;  3OYY A;  2OTJ A;  4MTK A;  3MXN A;  2A8V A;  1JWS D;  4BY1 G;  4OO1 G;  5ELB A;  2A69 D;  2BCO A;  3J81 c;  5BN5 A;  2NYZ D;  3U50 C;  3CRL C;  1BNZ A;  1PRT F;  1AW7 A;  2K28 A;  1YI2 A;  1TWC H;  1K8A C;  2CCZ A;  1N9W A;  2L4N A;  3SR1 A;  2MJ8 A;  4QQB X;  1N32 L;  1SBB B;  2WB1 G;  3DUZ A;  4NP5 A;  1SDF A;  5LL6 S;  4MN3 A;  1G2T A;  3S2H H;  3WDN A;  2HHH L;  3OTO L;  3I4L A;  4DK3 C;  1O7Z A;  3MTS A;  3J80 i;  1LTB D;  1SE8 A;  5CYU A;  2ZXR A;  2EJM A;  4IUV A;  3HOZ B;  5M3M B;  1ZXT A;  1GM5 A;  3CCE A;  1K83 H;  4N8F A;  2F52 A;  4JYA Q;  3A8I E;  1RDP D;  3EJI A;  1CKO A;  3EVQ A;  2RKS A;  5KEE A;  1S5C D;  3OHX C;  4IUU A;  2E5L Q;  1FNW A;  2PCF B;  5EPJ A;  1JT8 A;  2JA7 H;  1IBL Q;  5KRU A;  4PZ8 A;  4WFN 3;  2D2C C;  2IX0 A;  4DV0 Q;  1IBK Q;  1LTA D;  1EQR A;  1TS4 A;  2B29 A;  2YTV A;  1I4R A;  2LSS A;  3TS2 A;  3F2D A;  1BBW A;  4LF8 Q;  1SRO A;  2EYJ A;  5EBD A;  1R9T B;  4A3C H;  3BYT B;  3A54 A;  4CBV A;  1MJE A;  3L9A X;  4J15 A;  2EYM A;  5IGB A;  1NSN S;  2L55 A;  2UXD Q;  1ASZ A;  4NB3 A;  1JJ2 A;  1UWV A;  1OXT A;  2CHB D;  4FNF A;  4RA8 A;  4RGN A;  5ELC A;  2SNS A;  1BCP C;  4G7H C;  2B2T C;  1CKN B;  1NTG A;  3IKJ A;  3GTM H;  4LF9 Q;  1PLF A;  2E2I H;  2UUA L;  2F0V A;  1VQA A;  4B3S Q;  5FLX c;  1BQQ T;  5I9O A;  3GP7 A;  4DV1 L;  1IL2 A;  3E6Z X;  2PW7 A;  4QGU A;  1EIF A;  1YNJ C;  4AYB B;  4JI4 Q;  1MSG A;  4KMU C;  2IW3 A;  2VZA A;  4LUO A;  2YV5 A;  3L3O C;  5IGE A;  3M7N A;  3G4S A;  1F2L A;  4NMZ A;  4GS3 A;  1IBM L;  1JE4 A;  3HP3 A;  2WKC A;  4GKK L;  1VQD A;  4JI4 L;  3T51 B;  3NBI A;  2F0G A;  3A56 A;  5EQ0 A;  3C1E A;  2EYL A;  1FJG Q;  1L0Y B;  2G9H D;  1Q82 C;  1NNX A;  3CCU A;  1Y1W H;  1F77 A;  4QF4 A;  2IJ0 A;  1LTG D;  1ENF A;  3PIO 3;  3S15 H;  2XNA C;  2Z8L A;  2UUA Q;  3MXP A;  4DK1 A;  5M5Y H;  2HDL A;  3BVZ A;  2QA4 A;  3S14 B;  3CCL A;  3U4V A;  2F3I A;  2WII B;  1BBU A;  4C1N I;  3GTL H;  1G2S A;  1EIY B;  3AB9 A;  1UEB A;  2LKV A;  1EZ8 A;  1JWU D;  1J9O A;  1KRT A;  2PNR C;  4B3T L;  1GHK A;  1HQR D;  3ND8 A;  3NTH A;  1I3Q H;  3PV0 A;  2HIX A;  1KAW A;  1UEA B;  4LF6 Q;  5IGC A;  1A8V A;  4R4Q A;  3HOY G;  4FYD A;  2BA1 A;  1G6Z A;  4A3K H;  1WD1 A;  5IGF A;  4HTH A;  3FHW A;  1TWG H;  1YIT A;  1MBY A;  5D65 A;  1XMO Q;  4RHS A;  2K5H A;  2F03 A;  1GUG A;  2K5N A;  3KUP A;  4KHP Q;  4A3F G;  2I0Q A;  2OEO A;  4A3B G;  4V19 0;  1CKM A;  4C56 C;  4HIM A;  4YY3 Q;  3K5N A;  2XWB B;  4DV3 Q;  4A93 G;  3M85 A;  5IYB G;  3RMH A;  1K9M C;  4ZCK A;  5M3F G;  1SND A;  3BJU A;  5HGQ A;  3JAM i;  2E2H H;  1XNQ L;  5C0X H;  5LL6 X;  1DM0 B;  2B2U C;  2F0U A;  1V43 A;  5BR8 L;  3H3V I;  3RZO B;  3HKS A;  4DV6 L;  4KJN A;  2WAQ G;  1BKB A;  5M3F H;  3UDI A;  1PVO A;  4JI1 Q;  2ATW A;  4DU9 A;  3GTP H;  5GAE C;  2EXD A;  3HG9 A;  1I4G A;  3C1F A;  1I50 H;  2F0O A;  4LNQ A;  4F8M A;  2BA0 A;  1TII D;  1FYC A;  4JOI C;  4HSP A;  3LWU A;  1HZA A;  1SNM A;  3T4A C;  2XRQ D;  1CZW A;  1TQO A;  3BZC A;  3CC4 A;  2Q2T A;  2Z0S A;  4F87 A;  2F0F A;  2E76 C;  3S17 H;  3OW2 A;  4LF5 Q;  2F0H A;  1SJH D;  1EYD A;  5GAG C;  1DOM A;  1XYI A;  1MI2 A;  1F2Y A;  1GKH A;  3LNN A;  4J6H A;  4MHE A;  5HGT A;  4DXF A;  3J81 E;  4DR4 L;  1PYB A;  4DV2 Q;  1S40 A;  4KY6 A;  4JPB W;  2PYK A;  2EDG A;  1E1T A;  1XPR A;  2F4I A;  1GUT A;  5C4J H;  1MHW C;  2NVY B;  1TT2 A;  3NQT A;  2NVX H;  1HZ9 A;  1FNV A;  3M9B A;  2F3V A;  2L9H A;  4A3G H;  4FF2 A;  4PV1 C;  4UY8 C;  4UP7 A;  4DNI A;  4XYQ A;  4A3I G;  5IWA L;  3L7Z C;  5FO8 B;  3HOV B;  2NVQ H;  3ERS X;  1Y1W G;  3PIO A;  3I4N H;  1K28 A;  1PTO C;  4YHH L;  2K75 A;  2UUB L;  1IXR A;  1U4P A;  3CU7 A;  3I3C A;  1MGS A;  1QJO A;  3D4R A;  2FMM A;  5TSS A;  2F0S A;  5FLM H;  3BS1 A;  3TRZ A;  3TP8 A;  3FMC A;  1BBX C;  1Z9F A;  1X3E A;  3EBE A;  3TRE A;  1I94 Q;  2UXC L;  4YIJ A;  2EYO A;  1U4M A;  4Q0F A;  2RSO A;  5C0X G;  2R7Z H;  1L1O B;  3MZ5 A;  1T5E A;  2CWP A;  3BDC A;  3RN5 A;  4A3J B;  2VS1 A;  2GA4 B;  2QKI C;  1HNX Q;  5FOB B;  4BXX G;  4X64 L;  4TSS A;  1KC8 C;  1Y8P B;  1EWC A;  4YCU A;  2B3G A;  4DKA C;  4GN4 B;  5C3E B;  4FF3 A;  5M5X H;  4IFD G;  4FXD A;  3I4O A;  3GV6 A;  1KNA A;  4A93 B;  1HCZ A;  3I4M H;  3QOJ A;  3S2D B;  3OWE B;  1KAA A;  5KNC A;  2PMZ E;  2Q2I A;  4XQJ A;  2F0N A;  2SOB A;  3AQQ A;  4IOA A;  1CA5 A;  5LMN Q;  2R3Z A;  1YNN D;  3KF8 A;  3DM1 A;  1J6Q A;  4NDX A;  1B44 D;  2UXD L;  1VQP A;  1ICF B;  4CHT B;  3GTG H;  4GNX B;  1KD1 C;  3VA7 A;  2E2D C;  1ROD A;  1EY6 A;  4O1N A;  4DV4 L;  4XQN A;  3J80 L;  2JA6 B;  5K36 G;  1RF2 D;  2FMC A;  2HQE A;  3RR5 A;  3HOU H;  1TS3 A;  1VQJ A;  2OCE A;  5E1F A;  4IPH A;  4B3M Q;  1AEX A;  3NBH B;  1Y14 B;  1U0L A;  1B53 A;  1LT4 D;  4DV2 L;  4A3L H;  2R61 A;  4H0L C;  3F2B A;  3X3M A;  3PO2 H;  4JYA L;  1PH6 A;  2DUD A;  1A2U A;  2DGY A;  3S1R H;  3URY A;  3Q24 A;  4YWK A;  3S2H B;  3RD4 A;  4A3M G;  4QCL A;  2OF1 A;  2BH8 A;  1ESF A;  5COR A;  2Z4H A;  3D3R A;  4X65 L;  3HOX H;  4UDU C;  2UXB Q;  4IOC A;  1LT6 D;  1T5X D;  2DY8 A;  5E4W C;  4BY1 H;  1FVI A;  1LAC A;  1PXU A;  2CW0 C;  2Q2U A;  1XMQ L;  2SNM A;  2X6L A;  4JOI A;  3SK6 A;  5LMU L;  1LUZ A;  3AEV A;  1HR0 L;  4BWG B;  4GZY C;  2HDM A;  1HHV A;  3CPW A;  2M2L A;  1IBL L;  2RQX A;  1S72 A;  4OEL B;  1VMP A;  2D5D A;  3NK9 A;  2SEB D;  3JAM E;  4JI6 Q;  2JA7 B;  2B2W A;  2WAQ E;  4CJ1 B;  2JN4 A;  3QOL A;  1JJG A;  3HKZ G;  5C0X I;  4YCV A;  3K5L A;  2X69 A;  5CV4 A;  4MZ9 A;  4JI6 L;  1VQO A;  3SE0 A;  2MFI A;  3BVG A;  1QZH A;  3QO2 A;  2L0C A;  1PFN A;  4YCW A;  4JI5 L;  5GRO A;  5I9P A;  2QGQ A;  2XTI A;  1X55 A;  1WTO A;  3GTO H;  2L12 A;  5FLX E;  1DON A;  3F1Z A;  1RTN A;  5CR3 A;  1WFQ A;  1ENA A;  3PUV A;  2AUK A;  3S1M B;  4A3K G;  5C4Z A;  3K0X A;  1NMG A;  3GTM B;  1SE2 A;  3SGI A;  4OON A;  1HZB A;  2KJX A;  3NHH A;  4N9P A;  5JJZ A;  3MFY A;  1Q8K A;  1SE4 A;  3SVM A;  3OTO Q;  1ET6 A;  4XDX A;  3VYU A;  3LX0 A;  3QIA A;  3V96 A;  1KLG D;  4TRD A;  1C7Y A;  2A5H A;  2B2Y A;  3Q0A A;  3QJY A;  2A19 A;  2QEJ C;  4LK1 C;  5FLM G;  4JBM A;  1I6H B;  3CC2 A;  1V1P B;  5C6A A;  4X65 Q;  4HJ5 A;  4G7Z C;  3BVM A;  2UXB L;  1IKL A;  3T53 B;  2JP1 A;  2VQE L;  4A3E G;  1Y1W B;  1EYA A;  2F1M A;  4HIO A;  1B2T A;  3CCV A;  5KYL A;  4OWW B;  2K5W A;  4DR5 L;  2KED A;  2K04 A;  1B70 B;  1GUS A;  5FK9 C;  2IPK D;  5LMN W;  4BBR H;  1SFO B;  3HOU G;  3S14 H;  2F0I A;  3A0J A;  3FRP B;  3NEM A;  1CHQ D;  1V8Q A;  3GTL B;  3ICE A;  1QVG A;  3AMU A;  2K7V A;  1OXS C;  1D8L A;  3IFD A;  5ELD A;  3EN2 A;  3UDF A;  5HUR A;  3PO3 G;  2NN6 G;  4L5R C;  1SNO A;  3CHB D;  5IGD A;  5H1S E;  4K5V A;  4ZQ3 A;  3M4O B;  2HCC A;  4LJZ C;  2VUM B;  1VDZ A;  2EJF C;  3FPU B;  1KTK A;  4A75 A;  1HH2 P;  4A3E B;  2JEB I;  2M9V A;  2PQE A;  4EQP A;  3I55 A;  4JI5 Q;  1QOH A;  3QB3 A;  1ENC A;  4DV5 Q;  2Z6B A;  3Q8D A;  3KBX A;  2ZTC A;  2QIL A;  4MTN A;  4IFD I;  4JVZ A;  3I2Z A;  1XMQ Q;  2AQ3 B;  5D14 A;  3BDL A;  4WRD A;  3CF5 A;  4GKJ L;  1TVX A;  2HT1 A;  1E2W A;  2PI2 E;  5COY A;  4NXN L;  4K6L A;  1VQF A;  4LF8 L;  2N55 A;  5CBE E;  1TXY A;  4RH6 A;  1SNP A;  5E7N A;  4L8J A;  1TWA B;  2V1C C;  5I2X A;  2AMC B;  1DOK A;  4NXM L;  3VR2 A;  3RZO H;  4BBS B;  1FGB D;  3TQY A;  4R4I A;  4ZRZ A;  4DUY Q;  2EYF A;  1D5Z C;  2Z1C A;  1OTC A;  3OOC A;  1UE7 A;  1PH2 A;  2CQO A;  5M3F B;  1X9N A;  2WKD A;  3BYY B;  2A74 C;  4PNY A;  4IQZ A;  1GD7 A;  3FVQ A;  2QW7 A;  4JI0 Q;  3HZX A;  3GTP B;  3R3O A;  3S1Q H;  2JA8 H;  5KGU A;  2K5D A;  5JVG 3;  4KD4 A;  3ZJY C;  4RG1 A;  1Z7T A;  4C3H H;  3CRK C;  4QMG A;  2F0J A;  3NWS A;  3ONA B;  1PH7 A;  1STA A;  1CT1 D;  5BN4 A;  2A6H D;  4DFA A;  1KXL A;  3T56 B;  1JR0 D;  3EIV A;  2RCF A;  4B9W A;  3CC7 A;  4DR3 Q;  1XTD A;  4A3I B;  3TEH B;  2JA5 B;  2WIN B;  2R7F A;  3S17 B;  5LMU Q;  3GO5 A;  2D0O A;  1BOS A;  4L63 B;  2YTX A;  1VQ9 A;  1PRT B;  4DV7 Q;  3KJO A;  2EOT A;  3J7A V;  4L5T A;  3DMU A;  1O78 A;  4CGY B;  1EY7 A;  4POF A;  1PTO B;  1Q90 A;  1RTO A;  1SSO A;  5KNB A;  3HRZ C;  4RKL A;  4YWL A;  3SDZ A;  1WTX A;  2PZT A;  3HOW H;  4G7O C;  3PO2 G;  5GAH C;  3UE0 A;  4YY3 L;  3E9I A;  5A2Q E;  4C3I B;  1YJW A;  2NVX B;  1K0R A;  4N8X 1;  4JBJ A;  1U9R A;  4C3J H;  5LMN L;  2KHI A;  1AP0 A;  1S5E D;  1WOC A;  1SNC A;  1KQS A;  1HUM A;  2IT1 A;  2K05 A;  2KEN A;  1VQH A;  3HOV H;  2CQA A;  2NVQ B;  1AE2 A;  4BY7 B;  1KDB A;  4TQU S;  3L2P A;  3B6Y A;  2B2T A;  1PH4 A;  4EVO A;  1K3B C;  1W6J A;  1SE3 A;  2R93 G;  1XTC D;  4DV6 Q;  4JC0 A;  3C2P A;  1O80 A;  2TMP A;  4NPS A;  4ABN A;  1YNJ D;  5IYD H;  2BOS A;  1FR3 A;  5IT9 c;  1PMR A;  4HMJ A;  2WAC A;  3KK7 A;  1E2Z A;  1H9S A;  3K57 A;  4LAA A;  4A3J H;  1G51 A;  2L11 A;  4JI7 L;  5CBA E;  4UPA A;  3A7A B;  1K83 B;  4JBK A;  5C3E H;  4DR2 L;  3OPO A;  1ET9 A;  1GUN A;  3KFU A;  3PQI A;  3FKI B;  4R8I A;  1N36 Q;  5IWA Q;  4CJ0 B;  3S2D H;  4R9W A;  2LY7 A;  2JE6 I;  1JB3 A;  1Q1E A;  2K1B A;  2XRS D;  1II3 A;  3GTK H;  3F2U A;  4IPD A;  1BCP B;  1D5X C;  1AE3 A;  3SK8 A;  3PUW A;  5EGT A;  2ASB A;  1IKM A;  1IW7 D;  2JA6 H;  1ML0 D;  1EEI D;  3HOU B;  1AH9 A;  1BUV T;  5AFW A;  4YWM A;  4JI2 Q;  3DHQ A;  1E7Z A;  5IYC G;  1KIX A;  3PIP 3;  2NTS A;  3I72 A;  3STB D;  1C0A A;  1IYU A;  3A74 A;  3RUZ A;  4LFB L;  4XIG S;  5ELN A;  2HCI A;  1LTL A;  2Z6K C;  3GTJ B;  2E2I B;  3WOE A;  1F9S A;  3P75 A;  2IX1 A;  1PTO D;  2WB1 E;  1UE5 A;  1Y1V B;  3S1R B;  5JJK A;  3QWN A;  1JCK B;  4GLX A;  3A8K E;  1JOQ A;  3BU2 A;  4DGZ A;  2HD3 A;  4XT3 B;  4XYO A;  4Y7N H;  4BY1 B;  3I73 A;  4ZK9 B;  3OMC A;  4EX5 A;  1YVC A;  1Z47 A;  4KKU A;  1STN A;  2AUJ D;  1LTT D;  2K01 A;  2JEA I;  1PH1 A;  3K6O A;  4RGT A;  1UE6 A;  1O7Y A;  1QZG A;  1YJ9 A;  2JK8 A;  5DAU A;  1QUQ A;  1BDO A;  2X6G A;  4H7B A;  1JJC B;  3K58 A;  1GUW A;  5CV9 A;  4WJ3 M;  4B3S L;  4IJH A;  4A3D H;  1B7Y B;  1O7L A;  3JAM L;  4DF7 A;  3S1N B;  1NCV A;  1PTO F;  5DM7 3;  3HOX G;  4DV3 L;  4X62 L;  2DJG C;  1X3G A;  1HFN A;  3HOY H;  2V4D A;  4CKE A;  2G5D A;  3MHB A;  3PSI A;  2EQS A;  5KYI A;  1PH8 A;  1YEZ A;  3NEL A;  3IL8 A;  2PQA B;  3TBI B;  2Q8I B;  3I56 A;  2AQ2 B;  3F2C A;  4K14 A;  4NXN Q;  1U4R A;  4JI0 L;  1U4L A;  1F2M A;  1I3Q B;  1VQB A;  3I70 A;  1YNN C;  1EY4 A;  4WOR A;  4QIW B;  2PI2 A;  3PO3 B;  3D4D A;  3CQZ B;  1NBW A;  2K52 A;  1TY2 A;  1L1O C;  5C4X B;  3MFG A;  2MQH A;  3FKI G;  1JB7 A;  5JEA J;  2DNE A;  3Q22 A;  1QIL A;  1OXU A;  2KQ3 A;  2F0T A;  5G3L F;  1TWH H;  1NR2 A;  4R8N A;  4JI8 Q;  2R6G A;  4R4C A;  5ELO A;  3K59 A;  1UUP A;  2ES2 A;  2IWH A;  5IP9 H;  3CCJ A;  2F3W A;  4DUZ Q;  3ZYY X;  1G6P A;  3D6W A;  3JAM c;  4DN4 M;  1XNQ Q;  2JA9 A;  2ZTE A;  3DM3 A;  2FFK B;  4FP5 D;  2QF7 A;  3J80 c;  3PGZ A;  1IYJ B;  2XSC A;  3BZK A;  1EOV A;  3H0G H;  4HID A;  5EPK A;  2F0M A;  4DR5 Q;  1HUN A;  3K7U C;  3VA5 A;  2R7Z G;  4BY7 G;  2EY5 A;  2JJQ A;  2XGT A;  1N32 Q;  2PW5 A;  4L5Q A;  1NJI C;  4DV4 Q;  5D3D A;  1B3Q A;  1IZ6 A;  1EU3 A;  1SFO H;  2MO1 A;  5CC4 A;  4F7X A;  1ILP A;  3PF5 A;  4RGM A;  1RL2 A;  2P5Z X;  3QG1 A;  4YHH Q;  1WTP A;  3S16 H;  4F88 A;  1JE5 A;  1W2B A;  3HOZ G;  1B1Z A;  3TZU A;  2F4V Q;  3DLL A;  2Y0S G;  3Q6S A;  5GQO A;  3T13 A;  4PQX A;  2SDF A;  1PZJ D;  2PZU A;  2WV6 D;  1RIP A;  5DM6 3;  1CK1 A;  3IRB A;  2EY2 A;  4LF9 L;  2KUM A;  1NAP A;  3MVV A;  1EY8 A;  3NQI A;  1BR9 A;  2AHO B;  4RCN A;  3AFQ A;  3VR3 A;  5HY6 A;  4OEM B;  4CDC C;  1Q3L A;  1S5B D;  3M4O H;  1VQI A;  1Z6H A;  2E5L L;  3J81 j;  3DWQ A;  1SYF A;  2VUM H;  1X56 A;  5ISR A;  4K5W A;  5AJ3 Q;  4C3J G;  4A3E H;  3NPP A;  3MEH A;  4DR4 Q;  1WCM B;  3W1B A;  4X64 Q;  2OWO A;  5JEA H;  2EY6 A;  4K0K Q;  1K8G A;  3ULL A;  2RA4 A;  4LF7 L;  1UNS A;  3U58 A;  2WP8 J;  3T1Y Q;  2AKW B;  3ER0 A;  5JPM C;  1VQN A;  3OW7 A;  1YNX A;  3S24 A;  1EYG A;  5DNF A;  2GN5 A;  3IAY A;  4KKT A;  1W6K A;  5J22 A;  3WWV A;  4B08 A;  4O0A A;  4O2D A;  1TWA H;  3A55 A;  3I4N B;  2VXW A;  3H0G G;  3KDF B;  2KVM A;  1SYB A;  1PZK D;  1WTH A;  2DJF C;  5T1I A;  3RZD B;  3FP9 A;  1ILQ A;  1YZ6 A;  3G48 A;  2EYP A;  4KLK A;  3EQL C;  5KIX A;  3S9W A;  3CAM A;  5IP7 G;  3BG3 A;  5BR8 Q;  1E0B A;  1XXG A;  1EQT A;  2I5L X;  4X3K A;  4XT1 B;  2QEX A;  1WYD A;  4DPG A;  1M90 C;  2JA8 B;  1BXT A;  1D2B A;  3G7L A;  4OWX B;  3T16 A;  5JJI A;  1PH9 A;  2VB2 X;  4RKB A;  5I4D A;  4A93 H;  1Y8N B;  1VQ8 A;  1Y8O B;  2JA5 H;  1OXX K;  1LYL A;  2E75 C;  1HQM C;  1LV9 A;  1PTO H;  1NY4 A;  4PZ7 A;  2G9D A;  3T1Y L;  1EWI A;  1E1O A;  3U9O A;  1STY A;  3NEN A;  5C44 G;  2LXJ A;  3IFT A;  1LT3 D;  4A3B H;  4AQY L;  2UU9 Q;  3RLF A;  4A3F H;  3T1H Q;  3TP6 A;  2R92 H;  3N6R A;  3PUZ A;  1EEF D;  2EY1 A;  5CGK A;  1LT5 D;  4LWC A;  5IIF A;  2RCN A;  4IAL A;  1EIH A;  2A68 C;  1VQ7 A;  1RD9 D;  3UDX A;  1S5F D;  2B63 B;  1RCV D;  1Q46 A;  1K8M A;  1K0S A;  4BY7 H;  3OMG A;  1XJV A;  2RDH A;  1G8Z D;  1MD2 D;  1H9R A;  4HN7 A;  3PO2 B;  4CDE C;  1HNX L;  1VQC A;  1LLR D;  1PH3 A;  5D3I B;  3PF4 A;  1QB5 D;  3PCO B;  2JYO A;  3FEW X;  4BA2 I;  2B2V A;  1G91 A;  2Z9H A;  3TN2 A;  2RSN A;  2VY3 A;  5C4X G;  2UXC Q;  2XVS A;  4BBR G;  1YJN A;  1SYE A;  3DWP A;  1L0W A;  4RFB A;  2EPB A;  4LFC Q;  4OGQ C;  4QB4 A;  4DAY A;  1FNU A;  3NSW A;  2MHV A;  3J7Y W;  1M8A A;  1H9S B;  3PUX A;  1STG A;  3FKI H;  2VQF L;  1JOK A;  1QVC A;  2WB1 B;  2A6H C;  4LW1 A;  3EA6 A;  4GOP B;  5JEA G;  1DZ1 A;  4QIW E;  3CCR A;  1BO0 A;  1IHZ A;  1CZG A;  3SK5 A;  3VR6 A;  4GOP A;  4JG2 A;  4UP8 A;  3HOW G;  1QCB D;  1KLU D;  2K50 A;  4JI3 Q;  2PNH A;  3CW2 C;  3GTQ B;  1EY5 A;  4R4T A;  4DR7 L;  3LWE A;  2PPB C;  1EYC A;  3X3N A;  2WFW A;  4AYB E;  3UI2 A;  5BN3 A;  3CKI B;  3C3L A;  3RNU A;  1WTW A;  3H3V C;  1N34 L;  4WJ4 A;  2J7Z A;  1V1P A;  2VQE Q;  3KLW A;  4Z9C B;  2D0P A;  3I7F A;  2O5J C;  3D4W A;  3MEF A;  5C5L A;  1SNQ A;  1N33 Q;  4X6A H;  3STB C;  5C44 H;  5J3B A;  1AFP A;  4A3D G;  3C46 A;  1A0I A;  4DR1 Q;  4LMQ D;  5FLX L;  1Y1V H;  2IHE A;  4UP9 A;  1STH A;  3NTK A;  1X3F A;  4HMI A;  1H95 A;  4JI1 L;  3I8Z A;  4KK7 A;  1XPO A;  5E3F A;  4DK6 C;  4LFC L;  4Y7N B;  2JA5 G;  4A3J G;  1R4Q B;  3U4Z A;  4QUF A;  1VCI A;  4IFD J;  1GJX A;  4ILW A;  5JVH 3;  4LFA Q;  4GN5 A;  4J8Q A;  1CSQ A;  4I7Z C;  5IE8 A;  2PO4 A;  1I6H H;  1E24 A;  1Q1B A;  2NWG A;  1KNE A;  4EQO A;  4X3S A;  3DEP A;  4LFA L;  4C2M H;  4A3D B;  2N3S A;  1KDC A;  2DN8 A;  1DXM A;  3S1N H;  1WD0 A;  2TSS A;  1V9P A;  2KEC A;  1TWF B;  1K8O A;  1CA6 A;  3J7A 5;  1XMO L;  3T1H L;  4Y52 H;  4PMC A;  1TS5 A;  5IOD A;  1S4Z A;  2QDB A;  1UE1 A;  2K5Q A;  2XIW A;  4GLA C;  4PMB A;  2B2Y C;  1VQ6 A;  5I6W A;  5E4X A;  1B9N A;  3MXG A;  1PA6 A;  1B50 A;  5GAD C;  1VQ4 A;  1DD2 A;  1EFW A;  4LF4 L;  1EY9 A;  2CH4 A;  2KCT A;  4HCS A;  2D9U A;  4E6I A;  3PO3 H;  1MKH A;  2A6E D;  1WTR A;  5ELF A;  2I5H A;  4MIU A;  3CQZ H;  3K0Y A;  1HXY D;  2KBN A;  2R7D A;  1QUQ B;  4QUC A;  4HIK A;  4HJ9 A;  4IPG A;  3R2I A;  1HZC A;  3H15 A;  2A6E C;  3V05 A;  2H5X A;  3R2T A;  4A3M B;  3M3Y H;  2MP1 A;  1N34 Q;  1GUO A;  5IGG A;  3A7L A;  3NE5 B;  1EQQ A;  1M1K C;  3VYR A;  1SN8 A;  4OL7 A;  4CKB A;  4LUZ A;  2CWA A;  1D5M C;  2PZW A;  4DR7 Q;  3MAQ A;  5DEH A;  4JI2 L;  3J81 L;  1EY0 A;  2FHT A;  2YU9 H;  2B2U A;  3E3X A;  2NN6 H;  3D8G A;  3L0O A;  4NW2 A;  2VUM G;  1HNZ L;  3ND9 A;  2Q2H A;  4RMF A;  3K7A B;  2YTY A;  4I65 A;  3CME A;  4B3M L;  1I4X A;  3MA2 B;  4L6T B;  3H0G B;  3KJP A;  3KLS A;  2MGS A; 
#chains in the Genus database with same CATH homology
 2K32 A;  2B39 A;  4J1M A;  3FDT A;  2A73 B;  4B9X A;  3I91 A;  1SYD A;  2NBF A;  1L0X B;  5CV7 A;  3BZD B;  2I46 A;  2DY7 A;  2QCP X;  2N88 A;  2ICE C;  2O5I C;  1A6X A;  3W3A A;  2B8F A;  2MUY A;  1EOT A;  1A3V A;  4ID6 A;  4DNT B;  2IX3 A;  4X3T A;  1STE A;  3D31 A;  4U67 3;  4ZUI A;  5J1Z A;  2AWN A;  3GQB A;  1LTR D;  1I4H A;  2EZV A;  2FIN B;  4C1N K;  4FVM A;  4ZLT F;  2XWJ B;  1I6V C;  2J4X A;  1Y69 U;  2HUG A;  1LTS D;  3KLR A;  1HTP A;  1GXD C;  3HOW B;  4ODG A;  5FO7 B;  1M4V A;  4C3J B;  1VMC A;  2C9O A;  3WOF A;  4IN3 A;  1QWY A;  2ZXP A;  1SEB D;  1WTQ A;  2F0K A;  1ICW A;  1LAB A;  4CJ2 C;  2F0P A;  5M5W B;  1HTL D;  5J39 A;  1F2Z A;  1GOZ A;  4UAI A;  2EJG C;  3H6M A;  5JPN C;  4IUN A;  4Q5V A;  4IZ8 A;  3VYS A;  4G57 A;  3GD7 A;  1AZQ A;  2L1B A;  2F0L A;  5T1G A;  3FPP A;  1RJT A;  2BE5 C;  1PFB A;  2KOL A;  1TS2 A;  4CKC A;  3TZD A;  1A3T A;  4DA2 A;  4JK1 C;  3DEO A;  2B2W C;  3HKZ B;  2F0D A;  3S15 B;  5K36 H;  5M5Y B;  5EKL A;  1IYV A;  3GTK B;  4IUT A;  2PMZ B;  2YYZ A;  3PUY A;  3D6C A;  4IUP A;  5CV8 A;  4IUR A;  1SYG A;  3P20 A;  4A3B B;  2R92 B;  1TY0 A;  1CQV A;  4A3K B;  2BDN A;  2H1E A;  5IT9 L;  3J80 E;  1DYQ A;  2F0W A;  2LMC B;  1TWG B;  2Y0S B;  1EQV A;  4FXG C;  3ERQ A;  1QNK A;  4V0B A;  1B4O A;  1TKW B;  2RDG A;  1Q12 A;  2KCN A;  1ZYR D;  3K5M A;  1PYW D;  1VF7 A;  2MPM A;  4BS9 A;  4KY5 A;  4DNR B;  2E2H B;  1Q8I A;  1ZYR C;  5EBC A;  1X3Q A;  5LHY 1;  3A8J E;  1SAP A;  3TDQ A;  4RHR A;  3U9S A;  4EQN A;  1CHP D;  2K33 A;  3K5O A;  4KHV A;  4DAP A;  1AN8 A;  1F9P A;  1EFI D;  2AWO A;  3HOY B;  4HED A;  2IL8 A;  2E74 C;  1B9M A;  1F9R A;  4KD3 A;  1JQY D;  5EJW A;  4RWS C;  4S3S A;  4OO1 I;  3TSS A;  3EFX D;  4FO2 A;  1BF4 A;  1UAP A;  4KY7 A;  1PFM A;  1EL0 A;  4K5X A;  1E2V A;  4KJO A;  2A68 D;  2LFN A;  2J0T D;  3J7A F;  3Q23 A;  4ZYS A;  1RKN A;  2F0Q A;  3DWA A;  4HAE A;  3P1H A;  1JIC A;  1HPC A;  5CV6 A;  5C4J B;  1XWE A;  2ZT9 C;  1DJR D;  1JOO A;  4WJW A;  1TWH B;  1CFM A;  4HCE A;  1SMY D;  1A2T A;  5I6Y A;  5I2Y A;  2NUC A;  1SMY C;  4ZKC B;  4DK0 A;  1TWC B;  1KDA A;  3OSO A;  1H9K A;  3V2T A;  3OIP A;  4K8J A;  3VR5 A;  1JWM D;  3E0J A;  4C2M B;  1XX8 A;  3MXU A;  1JC7 A;  1RHP A;  3H09 A;  2EXZ A;  3KBG A;  5KND A;  4P2C B;  1KAB A;  1F9Q A;  3R8B A;  2D62 A;  1NR4 A;  4RAU C;  1CM9 A;  5M5X B;  3S16 B;  1QE6 A;  3NWT A;  1CI3 M;  1D6E C;  2KEE A;  3I4M B;  2Q8R E;  3TME A;  2KA7 A;  1TR5 A;  3NUC A;  4K8I A;  2ENB A;  5A2Q L;  1J8I A;  2B2V C;  3P7J A;  5IOC A;  1C48 A;  2O4X A;  4U68 A;  5FKA C;  3TP7 A;  1WVL A;  3M3Y B;  3GV3 A;  2FJ2 A;  2NN6 I;  2M00 A;  1QNU A;  2CVR A;  4KN7 C;  1PRT C;  5JAV A;  3SK4 A;  1HA6 A;  4FXK C;  4K6D A;  1VF5 C;  5NUC A;  1BCP D;  3HEJ A;  2YU9 B;  1PRT D;  3M7G A;  3AU7 A;  2BDO A;  3E5S A;  3TP5 A;  1EWH A;  4XQQ A;  4O42 A;  4HR7 B;  2L5T A;  3NBH A;  3H91 A;  4DXG A;  4HSV A;  4PMW A;  3HOX B;  1JOR A;  4FF1 A;  3SXH A;  3MWY W;  5F2D A;  3OWF A;  3N52 A;  3O13 A;  1LO5 D;  4K2K A;  3VYT A;  2NZ1 D;  1A3U A;  2K6A A;  1B3A A;  1ONL A;  1V1O A;  1R4P B;  2WAQ B;  1SJE D;  4IFD H;  3SHL A;  2KCC A;  4ZAI A;  5C3X A;  3SEB A;  1H9M A;  3G6J B;  1D1K A;  1HA5 A;  4N9T A;  3BDO A;  2OXP A;  4ZKB B;  1D1I A;  1IW7 C;  3W2D A;  2VNU D;  3GTO B;  4OIK A;  3R93 A;  4A3F B;  2Q8T A;  2I07 B;  1DCZ A;  2K03 A;  4OHJ A;  2H4O A;  4KHZ A;  4H13 C;  5C4H A;  4XTC S;  1QG7 A;  3HGB A;  1PDQ A;  3H94 A;  2VB3 X;  4NKL A;  4BA1 I;  1ZEQ X;  5CMD A;  2RBM A;  2EE1 A;  5K5P A;  2NB0 A;  4K2L A;  4M1U B;  1AZP A;  2JXM B;  4JBW A;  2EVB A;  2E2J B;  2BE5 D;  1SYC A;  2NVT B;  5ELE A;  1I4Q A;  2AQ1 B;  4KN4 C;  1S5D D;  5C0X J;  4OIJ A;  1EU4 A;  2B8G A;  3I90 A;  4BBR B;  1EIG A;  3MC0 B;  5M9O A;  2O2L D;  4ULL A;  4EGV A;  1I50 B;  1X3P A;  1HFG A;  5C3W A;  2XN9 C;  4XXE A;  2ICI A;  4C3I G;  4G4K A;  1ESR A;  4KTA A;  5CV5 A;  3KLS X;  3NXW A;  2JSO A;  4M8A A;  4OO1 H;  2LS0 1;  5C44 B;  4IUQ A;  1PZI D;  4KI0 A;  4ME5 A;  5EKK A;  2DNC A;  1IL8 A;  1NUC A;  4TKO B;  1SXT A;  4RGO S;  2RDF A;  3ERO A;  1DOL A;  4C3H G;  1HRJ A;  3HS0 C;  1CQF A;  4A3G B;  1C4Q A;  2ID0 A;  1FD7 D;  2CW0 D;  3ITP A;  4H44 C;  1I4P A;  3OIQ A;  2F0E A;  5JOB A;  1G29 1;  2KHS A;  3NP8 A;  5C5M A;  5EKI A;  2RVL A;  1H9J A;  4KV6 A;  2R7Z B;  1OO9 B;  1EZ6 A;  3S1Q B;  1GHJ A;  2ZXO A;  4X3U A;  5A35 A;  1TU2 B;  3M4Y A;  4C3H B;  1X32 A;  1BCP F;  2Z4I A;  3VR4 A;  1LTI D;  4RCO A;  1CTM A;  5FO9 B;  1MSH A;  4DAV A;  2NTT A;  1STB A;  5IT9 E;  2OT2 A;  2EYH A;  1WTV A;  5EPL A;  1OXV A;  1A15 A;  4FF4 A;  5G3L D;  4KKS A;  2C5C A;  2R93 B;  3GTG B;  3NTI A;  3DXJ C;  1ZKO A;  1C8C A;  2A69 C;  4ZUJ A;  3PMF A;  3MXN A;  4OO1 G;  1JWS D;  5ELB A;  2A69 D;  2BCO A;  5BN5 A;  2NYZ D;  3CRL C;  1BNZ A;  1PRT F;  1AW7 A;  2K28 A;  2L4N A;  3SR1 A;  2MJ8 A;  1SBB B;  3DUZ A;  4NP5 A;  1SDF A;  5LL6 S;  4MN3 A;  1G2T A;  3WDN A;  3I4L A;  1O7Z A;  3MTS A;  1LTB D;  5CYU A;  2ZXR A;  2EJM A;  4IUV A;  3HOZ B;  5M3M B;  1ZXT A;  3A8I E;  1RDP D;  3EJI A;  3EVQ A;  2RKS A;  5KEE A;  1S5C D;  3OHX C;  4IUU A;  1FNW A;  2PCF B;  5EPJ A;  5KRU A;  4WFN 3;  2D2C C;  2IX0 A;  1LTA D;  1TS4 A;  1I4R A;  2EYJ A;  5EBD A;  1R9T B;  3BYT B;  3A54 A;  4CBV A;  3L9A X;  2EYM A;  5IGB A;  1NSN S;  2L55 A;  1OXT A;  2CHB D;  4FNF A;  4RA8 A;  4RGN A;  5ELC A;  2SNS A;  1BCP C;  4G7H C;  2B2T C;  3IKJ A;  1PLF A;  2F0V A;  1BQQ T;  5I9O A;  3GP7 A;  3E6Z X;  2PW7 A;  1YNJ C;  4AYB B;  1MSG A;  4KMU C;  2IW3 A;  3L3O C;  5IGE A;  3M7N A;  1F2L A;  4NMZ A;  1JE4 A;  3HP3 A;  2WKC A;  3T51 B;  3NBI A;  2F0G A;  3A56 A;  5EQ0 A;  3C1E A;  2EYL A;  1L0Y B;  2G9H D;  1F77 A;  4QF4 A;  2IJ0 A;  1LTG D;  1ENF A;  3PIO 3;  2XNA C;  2Z8L A;  3MXP A;  4DK1 A;  2HDL A;  3BVZ A;  3S14 B;  2WII B;  4C1N I;  1G2S A;  3AB9 A;  2LKV A;  1EZ8 A;  1JWU D;  1J9O A;  2PNR C;  1GHK A;  1HQR D;  3ND8 A;  3NTH A;  3PV0 A;  1UEA B;  5IGC A;  4FYD A;  2BA1 A;  1G6Z A;  1WD1 A;  5IGF A;  4HTH A;  1MBY A;  5D65 A;  4RHS A;  2F03 A;  1GUG A;  3KUP A;  2OEO A;  4V19 0;  4C56 C;  3K5N A;  2XWB B;  3M85 A;  3RMH A;  1SND A;  5C0X H;  5LL6 X;  1DM0 B;  2B2U C;  2F0U A;  1V43 A;  3RZO B;  4KJN A;  4DU9 A;  3HG9 A;  1I4G A;  3C1F A;  2F0O A;  4F8M A;  2BA0 A;  1TII D;  1FYC A;  4HSP A;  3LWU A;  1SNM A;  3T4A C;  2XRQ D;  1CZW A;  1TQO A;  4F87 A;  2F0F A;  2E76 C;  2F0H A;  1SJH D;  1EYD A;  1XYI A;  1DOM A;  1MI2 A;  1F2Y A;  4J6H A;  3LNN A;  4MHE A;  5HGT A;  4DXF A;  3J81 E;  4KY6 A;  2PYK A;  2EDG A;  2F4I A;  1GUT A;  2NVY B;  1TT2 A;  3NQT A;  1FNV A;  2F3V A;  2L9H A;  4FF2 A;  4PV1 C;  4XYQ A;  3L7Z C;  5FO8 B;  3HOV B;  1PTO C;  1U4P A;  3CU7 A;  1MGS A;  5TSS A;  1QJO A;  3BS1 A;  3D4R A;  2FMM A;  3I3C A;  2F0S A;  3TP8 A;  3FMC A;  1BBX C;  4YIJ A;  2EYO A;  1U4M A;  4Q0F A;  2RSO A;  5C0X G;  3MZ5 A;  1T5E A;  3BDC A;  4A3J B;  2GA4 B;  2QKI C;  5FOB B;  4TSS A;  1Y8P B;  1EWC A;  4FF3 A;  5C3E B;  4IFD G;  4FXD A;  3GV6 A;  1KNA A;  4A93 B;  1HCZ A;  3QOJ A;  3S2D B;  3OWE B;  1KAA A;  5KNC A;  4XQJ A;  2F0N A;  2SOB A;  1CA5 A;  2R3Z A;  1YNN D;  3KF8 A;  3DM1 A;  4NDX A;  1B44 D;  4CHT B;  3VA7 A;  2E2D C;  1ROD A;  1EY6 A;  4O1N A;  4XQN A;  3J80 L;  2JA6 B;  5K36 G;  1RF2 D;  2FMC A;  2HQE A;  1TS3 A;  5E1F A;  1AEX A;  1B53 A;  1LT4 D;  2R61 A;  4H0L C;  3X3M A;  1A2U A;  3URY A;  3Q24 A;  3S2H B;  3RD4 A;  4QCL A;  2OF1 A;  1ESF A;  5COR A;  2Z4H A;  3D3R A;  4UDU C;  1LT6 D;  1T5X D;  2DY8 A;  5E4W C;  1LAC A;  1PXU A;  2CW0 C;  2SNM A;  2X6L A;  3SK6 A;  4BWG B;  4GZY C;  2HDM A;  1HHV A;  2M2L A;  2RQX A;  1VMP A;  2D5D A;  3NK9 A;  3JAM E;  2SEB D;  2JA7 B;  2B2W A;  4CJ1 B;  3QOL A;  5C0X I;  3K5L A;  2X69 A;  5CV4 A;  3SE0 A;  3BVG A;  3QO2 A;  2L0C A;  1PFN A;  5I9P A;  1WTO A;  2L12 A;  5FLX E;  1DON A;  1RTN A;  5CR3 A;  1ENA A;  3PUV A;  2AUK A;  3S1M B;  5C4Z A;  3GTM B;  1SE2 A;  2KJX A;  3NHH A;  4N9P A;  5JJZ A;  3MFY A;  1SE4 A;  3SVM A;  1ET6 A;  4XDX A;  3VYU A;  3LX0 A;  3QIA A;  3V96 A;  1KLG D;  4TRD A;  2A5H A;  2B2Y A;  3Q0A A;  3QJY A;  2QEJ C;  4LK1 C;  1I6H B;  1V1P B;  5C6A A;  4G7Z C;  3BVM A;  1IKL A;  3T53 B;  2JP1 A;  1Y1W B;  1EYA A;  2F1M A;  1B2T A;  5KYL A;  2K5W A;  2KED A;  2K04 A;  1GUS A;  5FK9 C;  2IPK D;  1SFO B;  2F0I A;  3FRP B;  1CHQ D;  1V8Q A;  3GTL B;  3AMU A;  2K7V A;  1OXS C;  3IFD A;  5ELD A;  5HUR A;  2NN6 G;  1SNO A;  3CHB D;  5IGD A;  4K5V A;  4ZQ3 A;  3M4O B;  2HCC A;  4LJZ C;  2VUM B;  1VDZ A;  2EJF C;  3FPU B;  1KTK A;  4A3E B;  2JEB I;  2M9V A;  2PQE A;  4EQP A;  1QOH A;  3QB3 A;  1ENC A;  3KBX A;  2QIL A;  4IFD I;  2AQ3 B;  5D14 A;  3BDL A;  4WRD A;  1TVX A;  1E2W A;  5COY A;  4K6L A;  2N55 A;  5CBE E;  4RH6 A;  1SNP A;  4L8J A;  1TWA B;  5I2X A;  1DOK A;  3VR2 A;  4BBS B;  1FGB D;  4ZRZ A;  2EYF A;  1D5Z C;  2Z1C A;  3OOC A;  5M3F B;  2WKD A;  3BYY B;  2A74 C;  4PNY A;  4IQZ A;  3FVQ A;  3HZX A;  3GTP B;  3R3O A;  5KGU A;  2K5D A;  5JVG 3;  4KD4 A;  1Z7T A;  3CRK C;  4QMG A;  2F0J A;  3NWS A;  3ONA B;  1STA A;  1CT1 D;  5BN4 A;  2A6H D;  4DFA A;  3T56 B;  1JR0 D;  4B9W A;  4A3I B;  2JA5 B;  2WIN B;  3S17 B;  3GO5 A;  1BOS A;  4L63 B;  1PRT B;  2EOT A;  3J7A V;  3DMU A;  1O78 A;  4CGY B;  1EY7 A;  1PTO B;  1Q90 A;  1RTO A;  1SSO A;  5KNB A;  3HRZ C;  4RKL A;  3SDZ A;  1WTX A;  2PZT A;  4G7O C;  2NVX B;  5A2Q E;  4C3I B;  1U9R A;  1AP0 A;  1S5E D;  1SNC A;  1HUM A;  2IT1 A;  2K05 A;  2CQA A;  2NVQ B;  4BY7 B;  1KDB A;  4TQU S;  2B2T A;  4EVO A;  1W6J A;  1SE3 A;  1XTC D;  3C2P A;  1O80 A;  2TMP A;  4ABN A;  1YNJ D;  2BOS A;  1FR3 A;  1PMR A;  4HMJ A;  2WAC A;  3KK7 A;  1E2Z A;  1H9S A;  3K57 A;  4LAA A;  2L11 A;  5CBA E;  3A7A B;  1K83 B;  3OPO A;  1ET9 A;  1GUN A;  3FKI B;  4R8I A;  4CJ0 B;  4R9W A;  2LY7 A;  2JE6 I;  1JB3 A;  1Q1E A;  2K1B A;  2XRS D;  1II3 A;  3F2U A;  1BCP B;  1D5X C;  3SK8 A;  3PUW A;  5EGT A;  1IKM A;  1IW7 D;  1ML0 D;  1EEI D;  3HOU B;  1BUV T;  5AFW A;  3DHQ A;  3PIP 3;  2NTS A;  3I72 A;  1IYU A;  3RUZ A;  4XIG S;  2HCI A;  3GTJ B;  2E2I B;  3WOE A;  1F9S A;  3P75 A;  2IX1 A;  1PTO D;  1Y1V B;  3S1R B;  3QWN A;  1JCK B;  3A8K E;  1JOQ A;  4DGZ A;  4XT3 B;  4XYO A;  4BY1 B;  3I73 A;  4ZK9 B;  3OMC A;  1Z47 A;  4KKU A;  1STN A;  2AUJ D;  1LTT D;  2K01 A;  2JEA I;  3K6O A;  4RGT A;  1O7Y A;  5DAU A;  1BDO A;  2X6G A;  4H7B A;  3K58 A;  1GUW A;  5CV9 A;  1O7L A;  3JAM L;  4DF7 A;  3S1N B;  1NCV A;  1PTO F;  5DM7 3;  1HFN A;  2V4D A;  4CKE A;  3MHB A;  5KYI A;  3IL8 A;  3TBI B;  2Q8I B;  2AQ2 B;  4K14 A;  1U4R A;  1U4L A;  1F2M A;  1I3Q B;  3I70 A;  1YNN C;  1EY4 A;  4WOR A;  4QIW B;  3PO3 B;  3D4D A;  3CQZ B;  1TY2 A;  5C4X B;  3MFG A;  5JEA J;  2DNE A;  3Q22 A;  1QIL A;  1OXU A;  2KQ3 A;  2F0T A;  5G3L F;  1NR2 A;  4R8N A;  2R6G A;  3K59 A;  1UUP A;  2IWH A;  2F3W A;  3ZYY X;  3D6W A;  4DN4 M;  2FFK B;  4FP5 D;  2QF7 A;  2XSC A;  5EPK A;  2F0M A;  1HUN A;  3VA5 A;  2EY5 A;  2PW5 A;  5D3D A;  1EU3 A;  5CC4 A;  4F7X A;  1ILP A;  4RGM A;  3QG1 A;  1WTP A;  4F88 A;  1B1Z A;  3TZU A;  3Q6S A;  3T13 A;  4PQX A;  2SDF A;  1PZJ D;  2PZU A;  2WV6 D;  5DM6 3;  1CK1 A;  2EY2 A;  2KUM A;  1NAP A;  3MVV A;  1EY8 A;  3NQI A;  1BR9 A;  4RCN A;  3VR3 A;  1Q3L A;  1S5B D;  1Z6H A;  3DWQ A;  1SYF A;  5ISR A;  4K5W A;  4C3J G;  3NPP A;  3MEH A;  1WCM B;  5JEA H;  2EY6 A;  2RA4 A;  1UNS A;  2WP8 J;  5JPM C;  3OW7 A;  5DNF A;  3IAY A;  4KKT A;  1W6K A;  5J22 A;  4B08 A;  3A55 A;  3I4N B;  2VXW A;  2KVM A;  1SYB A;  1PZK D;  5T1I A;  3RZD B;  1ILQ A;  2EYP A;  3EQL C;  5KIX A;  3S9W A;  3BG3 A;  1E0B A;  1XXG A;  1EQT A;  4X3K A;  4XT1 B;  2JA8 B;  1BXT A;  1D2B A;  3G7L A;  3T16 A;  2VB2 X;  4RKB A;  5I4D A;  1Y8N B;  1Y8O B;  1OXX K;  2E75 C;  1HQM C;  1LV9 A;  1PTO H;  2G9D A;  3U9O A;  1STY A;  3IFT A;  1LT3 D;  3RLF A;  3TP6 A;  3N6R A;  3PUZ A;  1EEF D;  2EY1 A;  5CGK A;  1LT5 D;  5IIF A;  4IAL A;  1EIH A;  2A68 C;  1RD9 D;  1S5F D;  2B63 B;  1RCV D;  1K8M A;  3OMG A;  2RDH A;  1G8Z D;  1MD2 D;  1H9R A;  4HN7 A;  3PO2 B;  1LLR D;  5D3I B;  4BA2 I;  1QB5 D;  2JYO A;  3FEW X;  2B2V A;  1G91 A;  3TN2 A;  2RSN A;  2XVS A;  1SYE A;  3DWP A;  4RFB A;  2EPB A;  4OGQ C;  4QB4 A;  4DAY A;  1FNU A;  3NSW A;  2MHV A;  3J7Y W;  1M8A A;  1H9S B;  3PUX A;  1STG A;  1JOK A;  2WB1 B;  2A6H C;  3EA6 A;  5JEA G;  1DZ1 A;  1BO0 A;  1IHZ A;  1CZG A;  3SK5 A;  3VR6 A;  1QCB D;  1KLU D;  3GTQ B;  1EY5 A;  3LWE A;  2PPB C;  1EYC A;  3X3N A;  3UI2 A;  5BN3 A;  3CKI B;  3C3L A;  1WTW A;  3H3V C;  2J7Z A;  1V1P A;  4Z9C B;  2O5J C;  3D4W A;  5C5L A;  1SNQ A;  1AFP A;  3C46 A;  4LMQ D;  5FLX L;  1STH A;  3NTK A;  4HMI A;  3I8Z A;  4KK7 A;  5E3F A;  4Y7N B;  1R4Q B;  4QUF A;  1VCI A;  4IFD J;  1GJX A;  4ILW A;  5JVH 3;  4J8Q A;  4I7Z C;  2PO4 A;  1Q1B A;  2NWG A;  1KNE A;  4EQO A;  4X3S A;  3DEP A;  4A3D B;  1KDC A;  2DN8 A;  1DXM A;  1WD0 A;  2TSS A;  2KEC A;  1TWF B;  1K8O A;  1CA6 A;  4PMC A;  1TS5 A;  5IOD A;  1S4Z A;  2QDB A;  2K5Q A;  2XIW A;  4PMB A;  2B2Y C;  5I6W A;  5E4X A;  1B9N A;  3MXG A;  1B50 A;  1DD2 A;  1EY9 A;  4HCS A;  2D9U A;  4E6I A;  2A6E D;  1WTR A;  5ELF A;  3K0Y A;  4MIU A;  1HXY D;  4QUC A;  3R2I A;  2A6E C;  3V05 A;  3R2T A;  4A3M B;  2MP1 A;  1GUO A;  5IGG A;  3A7L A;  3NE5 B;  3VYR A;  4OL7 A;  4CKB A;  1D5M C;  2PZW A;  3MAQ A;  5DEH A;  3J81 L;  1EY0 A;  2FHT A;  2B2U A;  2NN6 H;  3D8G A;  4NW2 A;  3ND9 A;  3K7A B;  4I65 A;  1I4X A;  3MA2 B;  4L6T B;  3H0G B;  3KLS A;  2MGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...