2KEEA

Structure of sdf-1/cxcl12
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1-alpha
publication title Monomeric structure of the cardioprotective chemokine SDF-1/CXCL12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 11
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2keeA00
1ZXTA 1F9RA 1F9SA 3TN2A 1RTNA 2X6GA 2B2WC 1VMCA 1HFGA 4ZKCB 1EIHA 2K03A 3HP3A 2B2TA 3P7JA 1O7YA 2HDLA 2X6LA 3UI2A 3H91A 1IL8A 1RTOA 4IUUA 4MHEA 2K1BA 5CMDA 4QUCA 1F9PA 1HUNA 3QO2A 2J7ZA 3I3CA 4XT3B 1B53A 1J8IA 1DONA 1KNAA 2RA4A 4IURA 4OIKA 2EE1A 2KUMA 1B50A 1DZ1A 1X3PA 1X32A 2B2YC 2K04A 4IUVA 3GV3A 2KEEA 1G6ZA 1HHVA 2K01A 4X3KA 3N52A 4RA8A 2B2VA 2N88A 2FINB 3DEOA 1LV9A 3I91A 3Q6SA 5EJWA 2JP1A 1AZPA 2L12A 1F2LA 1Q3LA 1AZQA 5D65A 1HUMA 1MSGA 2KVMA 3MTSA 1PFBA 1ESRA 4X3TA 1QNKA 2JYOA 5D14A 5DNFA 4CJ1B 1HFNA 1RHPA 1MSHA 1NCVA 1U4PA 1PFNA 3F2UA 5AFWA 2L9HA 3TZDA 4QUFA 1WTOA 1WTQA 1A15A 1DOKA 1RJTA 4HEDA 2NYZD 1B2TA 3MWYW 1WTXA 2MGSA 3D6WA 4HAEA 4CJ0B 2FMMA 2EPBA 1PDQA 1HA6A 1PLFA 4CJ2C 2B2UC 2NZ1D 2IL8A 5EPLA 5T1GA 3FPUB 3G7LA 4RWSC 4ZKBB 1WTPA 5EPJA 1EQTA 1MI2A 2B2WA 3DM1A 3I8ZA 5EKIA 1G2TA 2FFKB 1BF4A 2HCIA 3GV6A 2BDNA 2M2LA 4HCSA 2NWGA 4O42A 1BNZA 4HSVA 2FHTA 4IUTA 1NR2A 1ILPA 2X69A 4UAIA 2SDFA 2CVRA 2VXWA 1SDFA 2XIWA 2K05A 1TVXA 2L4NA 2RVLA 1SAPA 2D9UA 2FJ2A 2RSNA 1EOTA 4DN4M 4OIJA 2B2TC 2HCCA 1VMPA 2KECA 1JE4A 1ILQA 2B2YA 2MP1A 1U4MA 1ML0D 1O7ZA 1XX8A 2MPMA 2K28A 4IUPA 1M8AA 3FDTA 5JJZA 2HDMA 1G2SA 3R93A 2KEDA 1KNEA 1ICWA 2R3ZA 2MJ8A 4U68A 1QE6A 5EQ0A 1F9QA 1S4ZA 4XDXA 1E0BA 3IFDA 3LWEA 4NW2A 1SSOA 2EOTA 4R9WA 1DOLA 1RODA 5CBEE 4XT1B 1WTRA 2Q8TA 1AP0A 1G91A 4MN3A 1U4LA 1U4RA 1J9OA 4ZK9B 2DY8A 1BO0A 2B2VC 1BBXC 1O80A 4X3SA 1X3QA 2H1EA 2Q8RE 5COYA 5E4XA 5CORA 1EL0A 1CM9A 4ZLTF 2N55A 4RAUC 1B4OA 1MGSA 2KOLA 1WTWA 1QG7A 1XYIA 1CA5A 4X3UA 3KBXA 2DY7A 1IKLA 5CBAE 2B2UA 2HUGA 1EIGA 3I90A 1WTVA 1WD0A 1B3AA 4IUQA 3SVMA 4ZAIA 4LMQD 2RSOA 1DOMA 4R8IA 5T1IA 1PFMA 1CA6A 1WVLA 1JICA 1C8CA 2L1BA 1GUWA 1WD1A 2L11A 1IKMA 1HRJA 1NR4A 3IL8A 3ONAB 5E4WC 5EPKA 3KUPA 3DEPA 1NAPA
chains in the Genus database with same CATH superfamily
3S14B 2Y0SE 4HMIA 2DNEA 3R2TA 2B2WC 4KHVA 1N8RC 1E3PA 1STAA 3CCRA 5M5YH 4LF8L 1NE3A 2HDLA 1LM0A 5CMDA 4HJ5A 4O2DA 4DR3Q 3C3LA 3PF4A 2NZHA 5C3WA 3H0GH 5FLMG 3T1HQ 5EKLA 4CDDC 4BY7H 2UXDQ 4J8QA 3CMEA 4JCVE 5J39A 1N9WA 3K6OA 2XGTA 3KLSX 3SK8A 2NN6G 3A0JA 5JJIA 3BVMA 4LF9Q 4NMZA 1HUMA 1YHBA 4QQBX 2F0QA 2OTLA 3AYHB 2QF7A 2PI2A 4MTNA 1MSHA 1YHAA 4TVAB 2ZM6Q 4X64L 1RJTA 5FO9B 2D2CC 4RGMA 1E2ZA 1IZ6A 4OONA 3VR3A 5C3XA 1PDQA 1I50B 5J22A 2OQ0A 2H4OA 4UHVA 3FPUB 3S16B 1EQTA 3JAML 3RZOH 2PMZE 1O7IA 2Z1CA 1R4QB 2BA0A 3S24A 4A3KH 2NZOA 3KOJA 5IT9L 4JI8L 3M4OH 3CHBD 3E0JA 1EQRA 2I5MX 2JA8H 1EU4A 1DGSA 1N33Q 4G4KA 4P74A 4QL5A 5I9PA 1FVIA 2XIWA 4K6LA 2XRSD 4I7AA 4FF3A 1ENAA 4A3IH 3TBIB 2R92G 1AE2A 4N8FA 5EBDA 4U68A 5IY0A 2V1CC 1KDCA 3ERSX 4LFAQ 4NDXA 5HY6A 3STBD 4NXMQ 1AP0A 3HOWH 3GTMB 4OWXB 1BOSA 1J9OA 1YBYA 2DY8A 1S5FD 5M3FH 3LX0A 3NXWA 5CORA 2A68C 4UY8C 3QWNA 1LACA 1JR0D 3I90A 4JI3Q 4R4TA 1G51A 1X6OA 4GOPB 1STEA 5T1IA 1QUQB 1JICA 2V4DA 4ILWA 1TWCB 1JWSD 1IBKQ 4B3MQ 1GHKA 4QB4A 4KKTA 4RGOS 2B63G 2A6HD 1HZBA 1UE1A 1BDOA 1SMYC 5TSSA 5FJ8G 5IGBA 2X6GA 3S17B 2WV6D 2F4VL 1VMCA 3J81L 1CHPD 4YY3Q 2CQAA 5EGTA 2MNAA 1H9KA 4MHEA 5HGTA 2DJGC 2R7DA 4BBSH 2R6GA 1EY8A 3EN2A 1NJIC 1E7ZA 3T13A 1B9MA 2JQOA 1V1QA 5JEAH 2RA4A 4IUNA 5IP9H 4A3GH 5J1ZA 1H9RA 2F52A 3NHHA 2IX3A 5DM63 5ELOA 2RCNA 3DEOA 3I91A 4DV7Q 2VUMH 2NBFA 1R4PB 1SE3A 5FLXL 2I0QA 2KVMA 3IAYA 4CJ1B 1IBMQ 1BQQT 5L37A 4DR4Q 2R7ZG 3VDYA 2JXMB 5JPMC 2K7VA 2MGSA 2C9OA 2HT1A 2QCPX 2OCEA 3X3MA 5LHY1 2UXBL 3MXNA 2PNHA 5LMNL 4ABNA 4DXGA 4HCSA 4X62Q 4HSVA 2DGYA 2Z6BA 3B6YA 1A0IA 2B29A 1SYDA 2X69A 1HJPA 1ICFB 5KYLA 1PYWD 1JC7A 2E2DC 2RSNA 2M00A 2KECA 2PW5A 4JI5L 3CP0A 1SN8A 2F0OA 2NVYH 3H3VC 1CSPA 2E74C 2GVBA 4IUPA 1T9HA 2E2JH 1QE6A 2E2IH 3ZYYX 4KN7C 1PTOB 4DK6C 4L6TB 1FJGQ 2VL6A 1ENCA 5C3EH 1I4QA 4L8JA 1VQFA 1A3TA 1JJGA 2WB1B 4DAYB 4A3CG 1CKNA 5IP7G 4IQZA 4X3UA 1SR3A 4G57A 3NBHB 1U0LA 4HMJA 3T56B 1V1PB 4RGNA 4DR5Q 1EY9A 4LMQD 1EYCA 4YWKA 1XTCD 2L11A 4BS9A 2FMCA 4EVOA 2EY6A 2F03A 3C1EA 3KUPA 5FLMH 2F0LA 1T5EA 4DK0A 2EJMA 1WCMG 1V9PA 2DJFC 3HP3A 3S2DB 2CKZB 1MKHA 3V05A 4IUUA 2EYFA 1JB7A 4QUCA 2J7ZA 1A8VA 1H9SA 3KLSA 2EY5A 5IGGA 2NTTA 5HURA 2UUAL 3K7AB 1GUSA 5DLQE 1EQVA 3CKIB 3TSSA 2K01A 4G7HC 1E2WA 3M9BA 2Z6KC 1EYGA 3U9OA 2HIVA 2QEJC 4DV0Q 1F2LA 4F88A 4YHHL 3RLFA 4DV1L 1G291 2LXKA 1U4PA 4KTAA 2L9HA 3OSOA 3S1NH 3F2BA 3CQZB 1K0RA 1TWGB 3U9SA 2OQKA 3E6ZX 1C9OA 4Q5VA 4CJ0B 1GVPA 2LXJA 3JAMc 2B2UC 4LFCL 3JAMi 2M9VA 1X55A 1LABA 3I8ZA 5JJLA 1TWFH 5IT9c 1Y8PB 2JK8A 5JAVA 1HR0Q 4J15A 2L0CA 2WACA 4UAIA 2SDFA 2B39A 1SMXA 1F2YA 3NELA 1K9MC 1IYJB 3LNNA 4C3JG 1AW7A 1MD2D 3NQIA 3HS0C 1BCPC 1O7ZA 5K5PA 2A1AA 3J7AV 4HIDA 1F9QA 5CV5A 2IT1A 1SFOH 4IPCA 4JV5L 2PNRC 1Z6HA 1RIPA 1VDZA 4MZ9A 5KRUA 1WJJA 2H5XA 1RODA 1S72A 2KCTA 2YTVA 3K59A 2EY2A 5JVG3 1NBWA 4X6AH 1EL0A 2ZXOA 2A73B 1Q46A 4JVZA 1J6QA 1SNMA 3K0YA 5FJ8H 5KIXA 5KNDA 1OXTA 1YVCA 3W2DA 1HQMC 3HOYG 4LF6L 3A7LA 4BWGB 3NTHA 3QIAA 1PFMA 3T16A 4Q0FA 1IKMA 1S40A 3R8BA 4A3DB 3M4QA 5E4WC 4UP8A 3HOXH 1XPOA 4LAAA 3CCUA 3J81c 3QG1A 1X3FA 3J81i 1ASYA 2EJGC 1LT4D 4ZKCB 1GO3E 2F1MA 1EIHA 2I46A 2NVTH 1VQLA 2QDLA 3RNUA 1FNVA 2RBMA 2CW0C 1E24A 4AQYQ 1VQ6A 1W3SA 2R93H 3ER0A 1CKOA 1X32A 1GOZA 3GV3A 1EYDA 2B2VA 2I5HA 2F0VA 2UU9Q 5D65A 3M4OB 3OMCA 3MTSA 2GVAA 1PFBA 4OEMB 1ESRA 2E75C 3WWVA 1HR0W 3CCJA 1LTBD 1WTOA 4IJHA 4QUFA 4A3BG 3ERQA 1K28A 5I6WA 3EA6A 4AIMA 3EJIA 4HAEA 4ZRZA 3I55A 5I6YA 4DK1A 1D5MC 2NZ1D 4A3MH 1AH9A 3OYYA 1DD2A 2PI2E 4WORA 1XMQQ 2B2WA 1Y14B 2FFKB 1C48A 1JOQA 1KRSA 1A3UA 2K5DA 3HOWB 5M3FB 3H0GG 4BY7G 4ZCKA 1KC8C 2RF4A 1YITA 4OIJA 2EIFA 3CCLA 1U4MA 1ML0D 4FXDA 1VQ4A 3T51B 4B3RQ 4A3CH 1PYSB 1ZYRC 4DR7L 1PYBA 3GTKB 4E6IA 1WTRA 3K5OA 4YCUA 3G6EA 3RLNA 4GN3B 5LMUL 1TWAB 4IO9A 3K5MA 4BBSB 1WCMH 2F0KA 1HNWL 4K6DA 3T1YL 1XMOQ 3HOVB 2JA7B 2UXCL 3Q8DA 2RSOA 2BE5C 4LK1C 4A3KG 3PIO3 2JA8G 2R61A 4KJNA 3SK5A 2RKSA 5C4XH 4KY7A 4CDCC 3RZDH 4A3IG 1OO9B 1YNND 1O78A 4PMWA 3G4SA 1BBUA 3PO2G 3KDFA 3MXUA 3PUWA 5FO7B 1WYDA 5CYUA 5DAUA 4CHTB 3HOUG 1D5XC 1J5EL 1LT5D 4UP7A 4M8AA 1LT3D 4XQNA 1JORA 4DV2Q 1B9NA 1QUQA 2AUJD 1FGUA 3J80L 2UUCQ 2WAQG 1ENFA 2I07B 5EJWA 1K8OA 2JP1A 1K8AC 5NUCA 2HHHQ 3Q24A 2JA6G 3A56A 2K5WA 3JC66 2BA1A 3HKZG 3OW7A 2XVSA 2Y0SB 4L5SA 1XNRQ 4RKLA 4BY1G 2F3VA 2VNUD 2NVXB 2NYZD 4R8NA 5C0XJ 2QA4A 1PMRA 1YEZA 2NVYB 3TZUA 3KF6A 1PLFA 5EPLA 5EBCA 4DUZL 4KI0A 2E2JB 2E2IB 4C3JH 4GNXC 4ME3A 2HIXA 1NSNS 1BF4A 2LY7A 1LTTD 1Z47A 5CV6A 2BDNA 4JI2L 3NEMA 2VQEQ 1UUPA 2VS1A 2EY1A 1Y1WB 3DWQA 5IGDA 2A74C 4FNFA 4A3GG 1TVXA 2L4NA 5FLXE 2D9UA 4IFDH 5JPNC 2RDFA 1PA6A 1R9TH 1RKNA 2OT2A 1M8AA 3R93A 2J0TD 2VUMG 1IBLL 4H02A 4DV5Q 1HNZQ 3HOYH 3IFDA 3A8KE 2PQEA 5I2YA 4EGVA 4WJWA 2SEBD 4JOIC 5CV4A 2D0OA 5COYA 2O4XA 1Q90A 3GD7A 2PMZB 1VQIA 3WDNA 2UUBQ 5C4JB 1QZGA 1WTWA 4RFBA 5IGFA 1QG7A 4KHPQ 2K14A 4J1MA 1X54A 3N6RA 1I3QH 2AHOB 1B3AA 2F0DA 1B7YB 4LUVA 4K5XA 4RHRA 4ZAIA 2VQFQ 3U58A 1DOMA 1KDAA 3OPOA 2LMCB 2XN9C 4C1NK 1WVLA 3AQQA 2K32A 1TR5A 2WINB 1UE5A 1N36L 4WJ3M 1IXRA 4JYAQ 3TN2A 1N34L 3GTQH 4LF5L 2DUDA 2XTIA 4IFDI 4JPBW 4XQQA 5ELEA 3UI2A 4DAYA 2JSOA 4LFBQ 1IL8A 3S1NB 3URYA 1F9PA 2L5TA 3I3CA 1HZCA 3NBHA 2EZVA 1VQ7A 1A2TA 1PH1A 1J8IA 4Z9CB 1PH2A 1QZHA 4Y52H 1EY7A 3CU7A 4A3LG 5IYDH 2B2YC 5C3EG 2F0TA 3FKIH 4BA2I 3W3AA 4X3KA 1HA5A 2N88A 2R92B 1Y69U 5IIFA 1AZPA 2A6EC 1B1ZA 3M7NA 3H94A 2Z9HA 3SGIA 1PFNA 2AQ1B 4P72A 5ELDA 3E0EA 5H1SE 1CT1D 5CGKA 2CH4A 1CZGA 3X3NA 1HA6A 1IHZA 3NQTA 2Z4IA 3SHLA 3ND8A 3QOLA 4TQUS 3DHQA 3PQIA 2MFIA 1SFOB 3OTOQ 1GUGA 5EKIA 3H6MA 3V96A 1Q81C 1VQDA 4B3SQ 1X3GA 4DR3L 3IFTA 2B63B 3EVQA 4K2LA 1FNUA 3T1HL 1Y8OB 1GD7A 2MO0A 2RVLA 4WFN3 2UXDL 4N9PA 2B2TC 3NE5B 5GADC 4EX5A 1FL0A 2MO1A 4QMGA 4X64Q 1EFWA 2Z6KA 2VW9A 3KF8B 2KEDA 2MJ8A 1AN8A 2E2HH 3BZDB 1EIYB 4A4IA 4LF9L 4OELB 2GN5A 4K14A 4A3EG 1VQEA 4C56C 4DV6Q 2ZM6L 3I70A 4BBRG 3HEJA 2Q8TA 1BO0A 1C4QA 4EQOA 1L0XB 2EVBA 2KOLA 2AUKA 3BDLA 4V0BA 1YHQA 2B2UA 4POGA 5EKKA 1VQCA 5GAEC 3GTLH 4A3JG 3I4NH 3KFUA 3PO2H 2R7ZB 3D6CA 1STHA 4H13C 3HOUH 1STBA 3FHWA 4PZ7A 2YU9B 2BH8A 4KY6A 3MXGA 2KCNA 1NAPA 1N33L 3S1QH 4QJFA 4GOPC 1DXMA 1F9SA 4C3IH 5A35A 3NUCA 2CH4W 1SE4A 3P7JA 1BR9A 4JI7Q 4R4CA 1RTOA 2JA6H 1B53A 3CW2C 4LFAL 1FNWA 1B8AA 1S5CD 5C4HA 3J80c 3CC2A 4KK7A 4BY1H 4NXML 3MEHA 2KBNA 3L2PA 3ICEA 4FF1A 2FINB 2IHEA 5CR3A 4L5QA 4K8IA 3K5LA 4QIWE 3SR1A 5E3FA 2A8VA 1OXUA 3E9IA 4YWLA 4M1UB 1EFID 2WFWA 2EXZA 3VR4A 1IBKL 4B3ML 1X9NA 1B2TA 3MWYW 3ITPA 3ND9A 1HTPA 1VQHA 3HOXG 4XQJA 2IL8A 4N8X1 4ZKBB 2RQXA 5I9OA 4PV1C 4YY3L 3KYHC 2HCIA 2G9DA 3TEHB 1KLUD 1BNZA 1E1OA 1PZJD 4JC0A 4LJZC 4DV3Q 2Q2TA 3BJUA 2R93G 3J7A5 1JB3A 2BOSA 4KKSA 1HHVA 3NPPA 1CUKA 3DMUA 3RN2A 1WCMB 1E1TA 3DM3A 2JN4A 1Q8KA 1TY0A 1Z7TA 3FDTA 2HDMA 4A75A 1G2SA 4DV7L 3S1RB 4R4QA 2ES2A 5C5LA 3FMCA 1S4ZA 5M3MG 5M5WH 2KCCA 1BUVT 1IBML 4DR4L 1HXYD 1IW7C 1HCZA 1YNJD 3WOFA 1PHJA 1DOLA 1SROA 4QCLA 1DZ1A 1BBXC 3K81C 1PTOC 5E4XA 1X3QA 1A62A 1M1KC 1MGSA 3HKSA 5IWAQ 4A3MG 3GQBA 1QCBD 1BVSA 4X65Q 2ZJQA 1LTID 3D8GA 4NKLA 4TSSA 2ZTDA 1GXDC 1EZ8A 4X62L 1SEBD 5IOCA 2O2LD 2CHBD 4DFAA 1EOVA 1M90C 2F0MA 2WP8J 3I72A 1XPUA 1RDPD 2NVQH 4BA1I 3BZCA 5FK9C 4A3LH 4IN3A 2ZJPA 2YYZA 5E1FA 1ASZA 2F0GA 5IODA 4OGQC 3NK9A 2K5QA 4DR6L 1TIID 4A93G 1MHWC 2IX0A 1I94Q 3A5UA 1XXGA 4CDFC 1FJGL 1T5XD 4ZUIA 3NTIA 4GKJQ 1FGBD 4LF7Q 2BDOA 2WIIB 5GAHC 4C3JB 2QILA 2RCFA 3BVZA 1Q12A 3PUYA 4RA8A 1KIXA 1LV9A 1XJVA 2B8FA 4JBJA 4IOAA 1MSGA 4A3FH 4OWTB 4OX9Q 4DR5L 1K8GA 1WTQA 4C2MH 1DOKA 1GUNA 4JI0Q 4LNQA 3CXCA 1KDBA 3D6WA 1R9TB 1EWCA 3S1MH 5ELFA 5KYIA 4HIMA 3A5ZB 2AMCB 4RWSC 4DR2Q 5AJ3L 2KCMA 3I73A 1WTPA 5C4XG 3HOYB 4APVA 1JOOA 2L15A 1VQNA 2XSCA 1VQKA 2AWNA 4OO1H 5C44G 4GLAC 4DKAC 1PH6A 4A3EH 2N8NA 1S3OA 4N9TA 1L1OC 5LMNW 1CQFA 4BBRH 3GTJH 3CF5A 4FF2A 4RG1A 3CC7A 2MP1A 2K28A 2A68D 2EYOA 1GKHA 2Q2IA 3OWFA 1MBYA 4FDBA 5C0XG 3E3XA 4DV0L 3O13A 4KY5A 1UWVA 2DNCA 4DUYQ 3HZXA 1E22A 1EEID 4KMUC 1L1OB 4A3JH 3GTQB 4HJ9A 4PG3A 1JJ2A 1U4RA 1HZ9A 1Q8IA 4KN4C 2ZTCA 1W6KA 2F3IA 3G48A 4WJ4A 4GNXA 1WTVA 2PZTA 4BXXH 1CSQA 2QKIC 1PH7A 4A3BB 1QJOA 1S5DD 1VF7A 3DLLA 1HR0L 2F0EA 4OO1I 3CPFA 4WRDA 3S14H 4UPAA 1Y1VG 1Y8NB 2JA9A 1RTNA 3D4WA 4B9XA 4IFDG 2N3SA 5IYBH 4B3TQ 1WI5A 5M5YB 5A2QE 5BN4A 3P20A 4I7ZC 2AKWB 5CV7A 2K33A 2C5CA 1ET9A 2JEBI 3H0GB 1KNAA 1D5ZC 4BY7B 4IURA 4DA2A 4AH6A 4IUVA 4OXPA 1K83H 1RD9D 3FRPB 2WB1E 4JOIA 2Q8IB 3MEFA 4YCWA 4CKCA 3F8TA 5IYCG 4GLXA 2JJQA 1IYVA 3PF5A 3ULPA 2MUYA 3E9HA 4OHJA 4JBWA 2ASBA 1VQPA 1IYUA 3I4MG 1BBWA 4NXNL 3C46A 2CCZA 1I50H 4ZUJA 2PQAA 1HNXQ 1GUTA 2RHSB 1YIJA 3S16H 2E2HB 1FR3A 3E5SA 1VQOA 2F4IA 3DXJC 3RZOB 1MJEA 1G8ZD 1WFQA 4JK1C 1EZ6A 3PIP3 4A3KB 3PO3G 4AQYL 5M3MH 1NR2A 3A7AB 2NUCA 1XNQQ 2JA8B 2AWOA 2VXWA 3PIOA 1FD7D 2F0FA 1PRTF 1LTAD 3OMGA 2FJ2A 5IYDG 4X66Q 3FKIG 3DWAA 1JE4A 2B2YA 3BZKA 3HRZC 5KGUA 4A3IB 3NWTA 2MPMA 3K57A 4JI4Q 1AE3A 3GTLB 3MFGA 3PO2B 1VQJA 2CQOA 3C2PA 2CWPA 3OOCA 4GZYC 1C0AA 2R3ZA 3SDZA 1F2MA 3HOUB 4LF4Q 1X65A 3M7GA 1YNXA 1L2FA 1WTHA 4YIJA 2UU9L 3S1QB 2P5ZX 4ME5A 1K3RA 4P71A 3GTMH 4MN3A 2OWOA 3PSIA 2F0WA 4GKKQ 2WAQB 4KLKA 4J6HA 3S2HH 3F1ZA 1N32Q 3OIQA 3S15H 2CFMA 2JA6B 1I4XA 1XMQL 1EQQA 3OIPA 1I4GA 3L3OC 4IUQA 3MXNB 3HKZB 1H9JA 3CCEA 4BY1B 1LTSD 2E5LQ 4A93H 4R1JA 2OTJA 5JVH3 2K50A 5BN5A 3TDQA 1F77A 3JAME 2B2TA 4K5VA 4RGTA 3EQLC 3I4OA 1VQBA 3KJPA 2X6LA 4B3RL 3H91A 1RL2A 2IJ0A 1SNOA 5IT9E 1NMGA 4R4OA 4JI1Q 2EE1A 1LYLA 1X3PA 4YWMA 4A3GB 4MNOA 4HIKA 4RKBA 4A76A 4V190 4U673 1A63A 2VUMB 1K8MA 1TKWB 1UEAB 1XMOL 1CKNB 1TWHH 1S5ED 1Q1EA 3NBIA 3I4NG 1EWHA 5C44H 3BDCA 3MVVA 1I6VC 5IGEA 2Z8LA 4GOPA 1OTCA 1XTDA 1SYBA 4C3IG 3T53B 3VA5A 5M5XH 2YTXA 4FYDA 1STNA 1BCPD 1PV4A 2LKVA 1TU2B 2NWGA 2Q2UA 1TS2A 5KEEA 1RCVD 5C0XH 4IUTA 2HQLA 1JCKB 4CBVA 4I65A 4RMFA 1SNCA 3BYTB 3A74A 4KV6A 4DV2L 5CV8A 3J81E 1PFSA 3UDGA 4GLVB 2UUCL 1XX8A 3J7ZC 4O0AA 1PH5A 3KLRA 3VYUA 1KNEA 1ICWA 2HHHL 1P16A 5C6AA 2NVQB 1SSOA 1NNXA 5CBEE 4XT1B 1P8LA 4PMCA 1XNRL 4P75A 5C3EB 2KQ3A 1D8LA 2F3WA 2H1EA 2IY5B 3H3VH 5CV9A 3A54A 1Y1VH 2N55A 1TS5A 1STYA 2DY7A 2DN8A 2HUGA 2F0SA 1QILA 3D4DA 1QVCA 1SJHD 3STBC 3GP7A 3ULLA 4R8IA 1C8CA 1QWYA 2A19A 2L1BA 2VQEL 1WD1A 5C0XI 1DYQA 3IL8A 5FKAC 5EPKA 1CTMA 3CAMA 3DEPA 3K0XA 1PZKD 1LTGD 3UE0A 1HFGA 3W1GA 4K0KQ 1Q82C 3M3YH 2FXQA 3S2DH 1KAAA 3Q22A 4DV4Q 2IPKD 4RCNA 5IYCH 4C2MB 4DV5L 1HNZL 2A6HC 4LUOA 1KAWA 1DONA 3S1MB 2I5LX 1LT6D 2PO4A 2KUMA 3K7AH 2N78A 3MXPA 2ICIA 3I7FA 3RD4A 2D0PA 3N52A 4TKOB 5BR8Q 1VQGA 3I4MH 3H3VI 2WKDA 3PGZA 2UUBL 1B44D 3MHBA 3U50C 1PVOA 3M4PA 1Q3LA 2E8GA 2EYLA 4A3EB 3NP8A 3FP9A 2VQFL 1HTLD 4BBRB 3GTJB 3VYRA 1TS3A 3PO3H 2OXPA 2JA5G 5ELCA 4JG2A 1SYFA 1V1PA 4DNRB 4DAVA 4JYAL 2K75A 4QY7A 5T1GA 4DR1Q 2LS01 2BH2A 2A69D 1G2TA 4G7OC 4A3JB 1TWFB 2M2LA 4LFBL 4O1NA 4O42A 4JI6Q 3KJOA 4HJAA 1ZYRD 1GHJA 3VR6A 1ILPA 1SE8A 4CKBA 2PCFB 4L5TA 3SEBA 4ALPA 1SDFA 1L0YB 4DNTB 4FXKC 3PUVA 1QB5D 1LLRD 4LF8Q 1QVFA 1K0SA 1MIUA 3CCMA 1KD1C 3BYYB 3L0OA 2F0JA 2VB3X 2F0IA 4A3FG 5I4DA 3CCQA 3GDEA 3HG9A 1SXTA 3FPPA 2AQ2B 4R9WA 1UE7A 4AYBG 1ESFA 1I4PA 1NTGA 2BE5D 2AQ3B 3BG3A 4XYOA 2TMPA 3HOZG 1SNQA 3MFYA 3GTOH 1LO5D 3UDXA 4C3HG 5DM73 1WD0A 3OTOL 3MC0B 1B70B 2ENBA 1GUWA 4B3SL 3SK6A 2Z4HA 2OF1A 4A3DH 1K83B 4OO1G 1JWMD 1NY4A 3P75A 3HOXB 4QF4A 1I5FA 1ZXTA 1L1OA 4L63B 4DXFA 3TMEA 4JBKA 1RF2D 4AYBE 1O7LA 2J4XA 3K80C 1SE2A 2LSSA 5IGCA 4NPSA 2NVTB 2F0HA 4H44C 4JI8Q 2KA7A 4S3SA 1HUNA 2ID0A 4LUZA 3AEVA 4KKUA 3EBEA 4DNIA 2R93B 2WKCA 4ULLA 1VQAA 3ULJA 4DV6L 4XIGS 5JOBA 2K5HA 4MIUA 4EQNA 1G6ZA 3BS1A 3L7ZC 1TT2A 4PMBA 1EEFD 3F2DA 3Q6SA 3CRLC 2QDBA 5M3MB 5EAYA 2K4KA 1HFNA 1OXXK 4ODGA 4BXXG 1II3A 3F2CA 4FP5D 4HEDA 2ZT9C 2KHSA 2JEAI 4FO2A 1YI2A 2CWAA 2RDHA 1TQOA 4Y7NH 1I4HA 1G6PA 4F8MA 4CJ2C 4A3MB 3J80i 2K5NA 3NWSA 2IW3A 5IYBG 1DJRD 1F2ZA 4JI7L 2FHTA 3NENA 4F87A 3PUZA 1CFMA 1KHIA 3A8JE 3KDFB 4IPHA 1PRTD 3S2HB 4JI3L 1PH3A 4QGUA 3FVQA 2F4VQ 3S15B 2N49A 4HN7A 1MJCA 3EROA 2HQEA 4OL7A 3GTKH 2VY3A 1E0BA 1SYEA 4A93B 3TRZA 1K73C 4NW2A 2RHQB 1H9MA 3D4RA 2SNSA 1BCPF 1Q86C 1G91A 4RHSA 1CI3M 1CK1A 1AEXA 1EY4A 1TWAH 1LTLA 3Q23A 2JA7H 3HOVH 3KF6B 2ICEC 4UP9A 1CA6A 1HRJA 4DV3L 4L5RC 1X3EA 5F2DA 4P73A 2UXBQ 5JEAJ 2GA4B 1OXSC 5C4XB 1OXVA 5LMNQ 3RZDB 1TWHB 1UEBA 2A6ED 3PV0A 2O5IC 5GAGC 5C44B 1BKBA 3DUZA 1D2BA 2KEEA 2NTSA 4JI5Q 3D3RA 5M5XB 2JA5H 3J7YW 1VQ9A 5G3LF 1D7QA 4HIOA 5IWAL 1AZQA 3DWPA 3AU7A 5E7NA 4X65L 2BCOA 2JYOA 5DNFA 1YJWA 3F2UA 2NVXH 2EYJA 3AFQA 2ZXRA 1Q1BA 4DR6Q 3A55A 5D3DA 3DM1A 3PMFA 3IKJA 4KD3A 4JBMA 1Y1WH 1STGA 3GTPH 3EIVA 1E2VA 2PZWA 4H0LC 4GN5A 1I94L 1UAPA 4LWCA 1Y1VB 1CQVA 4GKJL 1BXTA 1EOTA 1KRTA 3VYTA 4LF7L 2HCCA 2KJXA 4G7ZC 1GUOA 1UNSA 2G5DA 1VQ8A 3OHXC 3HOZH 2TSSA 4KD4A 4C3HH 5FOBB 3PUXA 2QW7A 1PH4A 3UDIA 4IPGA 2UUAQ 4OX9L 5AJ3Q 3GTGH 1U4LA 4ZK9B 2KHJA 5IE8A 4JI0L 3J80E 5I2XA 3M3YB 2PYKA 3K5NA 5C4JH 1Q7YC 1CM9A 2NN6H 4ZLTF 1B4OA 3G6JB 3K8AA 1I6HH 4MTKA 2Z0SA 4YHHQ 4DV1Q 1EYAA 4DR2L 1EIGA 2QEXA 1XPRA 3NSWA 4PNYA 4DK3C 4POFA 3SVMA 1I3QB 4ZQ3A 1PZID 4KHZA 1KL9A 1VQ5A 1CHQD 1SBBB 3I4MB 3U4ZA 3Q0AA 3AMUA 4LFCQ 2R7FA 4CDEC 1LUZA 2K03A 4HR7B 4HCEA 4GN4B 1SMYD 2KENA 5C5MA 3PO3B 3PIPA 1YJ9A 4DUYL 1B50A 1SNPA 2XWJB 1XWEA 4HJ8A 3FKIB 1YNNC 1PXUA 3L9AX 2WB1G 2R92H 1WOCA 5KNCA 2NN6I 2A5HA 3IRBA 1JMCA 1U5KA 3HFZB 3W1BA 4JV5Q 4X3TA 5D14A 1C7YA 3J7AF 1CKMA 4K2KA 2EPBA 1EWIA 3TS2A 3UDFA 5K36G 3G7LA 4LF6Q 1MI2A 3VR5A 1YJNA 2ATWA 1KLGD 4B3TL 3T4AC 3GV6A 5CC4A 1VF5C 2JE6I 3H09A 2B63H 1BCPB 3CCSA 1JE5A 1ET6A 2CVRA 1IW7D 5ISRA 2K05A 1SAPA 3SXHA 3QB3A 3GTOB 1VMPA 2QGQA 1JJCB 1QNUA 1PTOD 3CC4A 2EDGA 3EFXD 2IX1A 1I4RA 3BU2A 3BDOA 3CPWA 4NXNQ 4XTCS 3VA7A 1U9RA 3C1FA 3LWEA 3RUZA 1EY0A 4UDUC 2EJFC 1O80A 3A8IE 2Q8RE 3TP6A 3TREA 3OW2A 2Q2HA 1HNXL 3KBXA 3D31A 1JWUD 1ZKOA 5CBAE 3MA2B 3AFPA 1HQRD 2E76C 2F0NA 2R7ZH 1W2BA 3I4NB 5GQOA 3TP7A 3V2TA 3R3OA 2YU9H 2NB0A 5FLXc 5ELNA 1GJXA 1XNQL 1F9RA 1GM5A 1JOKA 1LTRD 3TP8A 1KQSA 4DF7A 4X66L 1HPCA 4C3IB 3CCVA 3MZ5A 2EYMA 1O7YA 2ALYB 4JI4L 2K1BA 1ONLA 3QO2A 1V43A 2K52A 4XT3B 4LW1A 4PZ8A 4LF4L 2EXDA 3QJYA 4DAMA 3LGJA 4Y7NB 5ELBA 1A6XA 3VR2A 3RLOA 3RN5A 4RH6A 1D6EC 1TWCH 3KF8A 4P2CB 3W5OA 3SE0A 4GKKL 1DCZA 2ZJRA 1VCIA 1HZAA 4DR7Q 3S17H 4NB3A 1Z9FA 1UE6A 1N32L 2RDGA 2VB2X 4IJLA 5LL6S 1JT8A 3RR5A 1QNKA 1EY6A 1NCVA 2IWHA 5AFWA 2KHIA 1SNDA 2A69C 1A15A 3QOJA 4A3DG 4R4IA 1CZWA 2E5LL 3KK7A 5C4ZA 5J3BA 5LMUQ 2FMMA 4IOCA 5IP7H 1QOHA 2SNMA 1HNWQ 2XRQD 3T1YQ 5BN3A 5EPJA 1D1IA 2UXCQ 1W6JA 3I4LA 4DAPA 1L0WA 4XYQA 3J81j 1VS0A 4H7BA 1X56A 4HSPA 4FVMA 4JI1L 4DN4M 3UE1A 4PQXA 2XWBB 2B8GA 3S1RH 2PW7A 2SOBA 3PCOB 4CGYB 4GS3A 4HTHA 4B9WA 4XDXA 1M4VA 3VYSA 4EQ5A 2MQHA 4K8JA 1J5EQ 5M5WB 3D0FA 3R2IA 5D3IB 5GROA 2EOTA 2D5DA 4RCOA 2ZXPA 1TXYA 4X3SA 4F7XA 3P1HA 5M9OA 1PH8A 1XYIA 4NP5A 2EQSA 3GO5A 1IKLA 1H9SB 2C35B 2PPBC 2VZAA 3OWEB 1NUCA 3HGBA 3BVGA 5HGQA 4K5WA 4EQPA 1V1OA 4PZ6A 5M3FG 3HOWG 1EU3A 1PTOH 4ID6A 2JA5B 1SLJA 1K3BC 4DUZQ 4DPGA 1KTKA 3I2ZA 1QVGA 4YCVA 4JI2Q 4OWWB 1SRUA 1EUJA 3WOEA 3U4VA 4FF4A 5DEHA 3CRKC 3TP5A 2B3GA 4OIKA 1YZ6A 3AB9A 2K04A 2WAQE 4IALA 2CW0D 1PH9A 1EY5A 2K6AA 1TY2A 1ZEQX 5G3LD 3K7UC 1IBLQ 2L12A 4BBSG 3TS0A 4DU9A 3GTPB 5K36H 1EIFA 2JA7G 3HOVG 2PZUA 5JEAG 3HKZE 3I56A 1RHPA 5IP9G 4A3FB 1HH2P 3TZDA 1D1KA 1TS4A 1H95A 2F0PA 4AYBB 4GNXB 3G71A 5JJKA 1WTXA 1B3QA 2YTYA 2D62A 1A3VA 3NTKA 3HOZB 2MHVA 2K5VA 3H15A 1A2UA 3MAQA 2F0UA 4C3HB 5FO8B 3S9WA 4K0KL 1PRTC 4IFDJ 4DV4L 5A2QL 4IPDA 2OEOA 1DM0B 3GTGB 1IL2A 1SJED 2L55A 4KHPL 3KBGA 1N36Q 3CD6A 3KLWA 4TRDA 3TQYA 1VQMA 1N34Q 1V8QA 4LF5Q 2EYPA 1SYCA 1I6HB 3LWUA 1JQYD 3CQZH 2G9HD 3CMAA 1TWGH 1ILQA 1SYGA 3FEWX 5BR8L 1PRTB 5KNBA 5JJZA 4DGZA 1FYCA 2XNAC 5EQ0A 1AFPA 3SK4A 4IZ8A 2YV5A 4FXGC 4CKEA 2EYHA 4HJ7A 2Y0SG 1S5BD 3M4YA 5LL6X 2IHFA 4C1NI 3K58A 1KABA 4KJOA 2O5JC 4ZYSA 2B2VC 4RAUC 4XXEA 1CA5A 3M85A 3ZJYC 3RMHA 4DR1L 3QR8A 4QIWB 2PQAB 1YNJC 1PTOF 2ZTEA 4A3BH 2LFNA 4JW0A 1Y1WG 4JI6L 1KXLA 4B08A 1NR4A 2HD3A 1NMFA 3ONAB
chains in the Genus database with same CATH topology
3S14B 4HMIA 2DNEA 3R2TA 2B2WC 4KHVA 1STAA 2HDLA 5CMDA 3C3LA 5C3WA 5EKLA 4J8QA 5J39A 3K6OA 3KLSX 3SK8A 2NN6G 3BVMA 4NMZA 1HUMA 2F0QA 2QF7A 1MSHA 1RJTA 5FO9B 2D2CC 4RGMA 1E2ZA 3VR3A 5C3XA 1PDQA 1I50B 5J22A 2H4OA 3FPUB 3S16B 1EQTA 3JAML 2Z1CA 1R4QB 2BA0A 5IT9L 3CHBD 3E0JA 1EU4A 4G4KA 5I9PA 2XIWA 4K6LA 2XRSD 4FF3A 1ENAA 3TBIB 5EBDA 4U68A 1KDCA 4NDXA 1AP0A 3GTMB 1BOSA 1J9OA 2DY8A 1S5FD 3LX0A 3NXWA 5CORA 2A68C 3QWNA 1LACA 1JR0D 3I90A 1STEA 5T1IA 1JICA 2V4DA 4ILWA 1TWCB 1JWSD 1GHKA 4QB4A 4KKTA 4RGOS 2A6HD 1BDOA 1SMYC 5TSSA 5IGBA 2X6GA 3S17B 2WV6D 1VMCA 3J81L 1CHPD 2CQAA 5EGTA 1H9KA 4MHEA 5HGTA 2R6GA 1EY8A 3T13A 1B9MA 5JEAH 2RA4A 4IUNA 5J1ZA 1H9RA 3NHHA 2IX3A 5DM63 3DEOA 3I91A 2NBFA 1R4PB 1SE3A 5FLXL 2KVMA 3IAYA 4CJ1B 1BQQT 2JXMB 5JPMC 2K7VA 2MGSA 2C9OA 2QCPX 3X3MA 5LHY1 3MXNA 4ABNA 4DXGA 4HCSA 4HSVA 1SYDA 2X69A 5KYLA 1PYWD 1JC7A 2E2DC 2RSNA 2M00A 2KECA 2PW5A 2F0OA 3H3VC 2E74C 4IUPA 1QE6A 3ZYYX 4KN7C 1PTOB 4L6TB 1ENCA 1I4QA 4L8JA 1A3TA 2WB1B 4IQZA 4X3UA 4G57A 4HMJA 3T56B 1V1PB 4RGNA 1EY9A 4LMQD 1EYCA 1XTCD 2L11A 4BS9A 2FMCA 4EVOA 2EY6A 2F03A 3C1EA 3KUPA 2F0LA 1T5EA 4DK0A 2EJMA 3HP3A 3S2DB 3V05A 4IUUA 2EYFA 4QUCA 2J7ZA 1H9SA 3KLSA 2EY5A 5IGGA 2NTTA 5HURA 3K7AB 1GUSA 1EQVA 3CKIB 3TSSA 2K01A 4G7HC 1E2WA 3U9OA 2QEJC 1F2LA 4F88A 3RLFA 1G291 1U4PA 4KTAA 2L9HA 3OSOA 3CQZB 1TWGB 3U9SA 3E6ZX 4Q5VA 4CJ0B 2B2UC 2M9VA 1LABA 3I8ZA 1Y8PB 5JAVA 2L0CA 2WACA 4UAIA 2SDFA 2B39A 1F2YA 3LNNA 4C3JG 1AW7A 1MD2D 3NQIA 3HS0C 1BCPC 1O7ZA 5K5PA 3J7AV 1F9QA 5CV5A 2IT1A 2PNRC 1Z6HA 5KRUA 1VDZA 1RODA 3K59A 2EY2A 5JVG3 1EL0A 2ZXOA 2A73B 3K0YA 1SNMA 5KIXA 5KNDA 1OXTA 3W2DA 1HQMC 3A7LA 4BWGB 3NTHA 3QIAA 1PFMA 3T16A 4Q0FA 1IKMA 3R8BA 4A3DB 5E4WC 4LAAA 3QG1A 2EJGC 1LT4D 4ZKCB 2F1MA 1EIHA 2I46A 1FNVA 2RBMA 2CW0C 1X32A 1GOZA 3GV3A 1EYDA 2B2VA 2F0VA 5D65A 3M4OB 3OMCA 3MTSA 1PFBA 1ESRA 2E75C 1LTBD 1WTOA 4QUFA 3ERQA 5I6WA 3EA6A 3EJIA 4HAEA 4ZRZA 5I6YA 4DK1A 1D5MC 2NZ1D 1DD2A 4WORA 2B2WA 2FFKB 1C48A 1JOQA 1A3UA 2K5DA 3HOWB 5M3FB 4OIJA 1U4MA 1ML0D 4FXDA 3T51B 1ZYRC 3GTKB 4E6IA 1WTRA 3K5OA 1TWAB 3K5MA 4BBSB 2F0KA 4K6DA 3HOVB 2JA7B 2RSOA 2BE5C 4LK1C 3PIO3 2R61A 4KJNA 3SK5A 2RKSA 4KY7A 1OO9B 1YNND 1O78A 4PMWA 3MXUA 5FO7B 3PUWA 5CYUA 5DAUA 4CHTB 1D5XC 1LT5D 4M8AA 1LT3D 4XQNA 1JORA 1B9NA 2AUJD 3J80L 1ENFA 2I07B 5EJWA 1K8OA 2JP1A 5NUCA 3Q24A 3A56A 2K5WA 2BA1A 3OW7A 2XVSA 2Y0SB 4RKLA 2F3VA 2VNUD 2NVXB 2NYZD 4R8NA 5C0XJ 1PMRA 2NVYB 3TZUA 1PLFA 5EPLA 5EBCA 4KI0A 2E2JB 2E2IB 1NSNS 1BF4A 2LY7A 1LTTD 1Z47A 5CV6A 2BDNA 1UUPA 1Y1WB 2EY1A 3DWQA 5IGDA 2A74C 4FNFA 1TVXA 2L4NA 5FLXE 2D9UA 4IFDH 5JPNC 2RDFA 1RKNA 2OT2A 1M8AA 3R93A 2J0TD 3IFDA 3A8KE 2PQEA 5I2YA 4EGVA 4WJWA 2SEBD 5CV4A 5COYA 2O4XA 1Q90A 3GD7A 2PMZB 3WDNA 5C4JB 1WTWA 4RFBA 5IGFA 1QG7A 4J1MA 3N6RA 2F0DA 1B3AA 4RHRA 4K5XA 4ZAIA 1DOMA 1KDAA 3OPOA 2LMCB 2XN9C 4C1NK 1WVLA 2K32A 1TR5A 2WINB 3TN2A 4IFDI 4XQQA 5ELEA 3UI2A 4DAYA 2JSOA 1IL8A 3S1NB 3URYA 1F9PA 2L5TA 3I3CA 3NBHA 2EZVA 1A2TA 1J8IA 4Z9CB 1EY7A 3CU7A 2B2YC 2F0TA 4BA2I 3W3AA 4X3KA 1HA5A 2N88A 2R92B 1Y69U 5IIFA 1AZPA 2A6EC 1B1ZA 3M7NA 3H94A 1PFNA 2AQ1B 5ELDA 1CT1D 5CGKA 1CZGA 3X3NA 1HA6A 1IHZA 3NQTA 2Z4IA 3SHLA 3ND8A 3QOLA 4TQUS 3DHQA 1SFOB 1GUGA 5EKIA 3H6MA 3V96A 3IFTA 2B63B 3EVQA 4K2LA 1FNUA 1Y8OB 4WFN3 2RVLA 4N9PA 2B2TC 3NE5B 4QMGA 2KEDA 2MJ8A 1AN8A 3BZDB 4K14A 4C56C 3I70A 3HEJA 2Q8TA 1BO0A 1C4QA 4EQOA 1L0XB 2EVBA 2KOLA 2AUKA 3BDLA 4V0BA 2B2UA 5EKKA 2R7ZB 3D6CA 1STHA 4H13C 1STBA 2YU9B 4KY6A 3MXGA 2KCNA 1NAPA 1DXMA 1F9SA 5A35A 3NUCA 1SE4A 3P7JA 1BR9A 1RTOA 1B53A 1FNWA 1S5CD 5C4HA 4KK7A 3MEHA 4FF1A 2FINB 5CR3A 4K8IA 3K5LA 3SR1A 5E3FA 1OXUA 4M1UB 1EFID 2EXZA 3VR4A 1B2TA 3MWYW 3ITPA 3ND9A 1HTPA 4XQJA 2IL8A 4ZKBB 2RQXA 5I9OA 4PV1C 2HCIA 2G9DA 1KLUD 1BNZA 1PZJD 4LJZC 1JB3A 2BOSA 4KKSA 1HHVA 3NPPA 3DMUA 1WCMB 1TY0A 1Z7TA 3FDTA 2HDMA 3S1RB 1G2SA 5C5LA 3FMCA 1S4ZA 2KCCA 1BUVT 1HXYD 1IW7C 1HCZA 3WOFA 1YNJD 4QCLA 1DOLA 1DZ1A 1BBXC 1PTOC 5E4XA 1X3QA 1MGSA 3GQBA 1QCBD 1LTID 3D8GA 4NKLA 4TSSA 1GXDC 1EZ8A 1SEBD 5IOCA 2O2LD 2CHBD 4DFAA 2F0MA 2WP8J 3I72A 1RDPD 4BA1I 5FK9C 4IN3A 2YYZA 5E1FA 2F0GA 5IODA 4OGQC 3NK9A 2K5QA 1TIID 2IX0A 1XXGA 1T5XD 4ZUIA 3NTIA 1FGBD 2BDOA 2WIIB 4C3JB 2QILA 3BVZA 1Q12A 3PUYA 4RA8A 1LV9A 2B8FA 1MSGA 1WTQA 1DOKA 1GUNA 1KDBA 3D6WA 1R9TB 1EWCA 5ELFA 5KYIA 4RWSC 1WTPA 3I73A 3HOYB 1JOOA 2XSCA 2AWNA 4OO1H 4N9TA 1CQFA 4FF2A 2MP1A 2K28A 2A68D 2EYOA 3OWFA 5C0XG 1MBYA 3O13A 4KY5A 2DNCA 3HZXA 1EEID 4KMUC 3GTQB 1U4RA 1Q8IA 4KN4C 1W6KA 1WTVA 2PZTA 2QKIC 4A3BB 1QJOA 1S5DD 1VF7A 2F0EA 4OO1I 4WRDA 1Y8NB 1RTNA 3D4WA 4B9XA 4IFDG 5M5YB 5A2QE 5BN4A 3P20A 4I7ZC 5CV7A 2K33A 2C5CA 1ET9A 2JEBI 3H0GB 1KNAA 1D5ZC 4BY7B 4IURA 4DA2A 4IUVA 1RD9D 3FRPB 2Q8IB 4CKCA 1IYVA 2MUYA 4OHJA 4JBWA 1IYUA 3C46A 4ZUJA 1GUTA 2E2HB 1FR3A 3E5SA 2F4IA 3DXJC 3RZOB 1G8ZD 4JK1C 1EZ6A 3PIP3 4A3KB 1NR2A 3A7AB 2NUCA 2JA8B 2AWOA 2VXWA 1FD7D 2F0FA 1PRTF 1LTAD 3OMGA 2FJ2A 3DWAA 1JE4A 2B2YA 3HRZC 5KGUA 4A3IB 3NWTA 2MPMA 3K57A 3GTLB 3MFGA 3PO2B 3C2PA 3OOCA 4GZYC 2R3ZA 3SDZA 1F2MA 3HOUB 3M7GA 4YIJA 3S1QB 4ME5A 4MN3A 2F0WA 2WAQB 4J6HA 3OIQA 2JA6B 1I4XA 3OIPA 1I4GA 3L3OC 4IUQA 3HKZB 1H9JA 4BY1B 1LTSD 5JVH3 5BN5A 3TDQA 1F77A 3JAME 2B2TA 4K5VA 4RGTA 3EQLC 2X6LA 3H91A 2IJ0A 1SNOA 5IT9E 2EE1A 1X3PA 4A3GB 4RKBA 4V190 4U673 2VUMB 1K8MA 1TKWB 1UEAB 1S5ED 1Q1EA 3NBIA 1EWHA 3BDCA 3MVVA 1I6VC 5IGEA 2Z8LA 4C3IG 1SYBA 3T53B 3VA5A 4FYDA 1STNA 1BCPD 2LKVA 1TU2B 2NWGA 1TS2A 5KEEA 1RCVD 5C0XH 4IUTA 1JCKB 4CBVA 4I65A 1SNCA 3BYTB 4KV6A 5CV8A 3J81E 1XX8A 3KLRA 3VYUA 1KNEA 1ICWA 5C6AA 2NVQB 1SSOA 5CBEE 4XT1B 4PMCA 5C3EB 2KQ3A 2F3WA 2H1EA 5CV9A 3A54A 2N55A 1TS5A 1STYA 2DY7A 2DN8A 2HUGA 2F0SA 1QILA 3D4DA 1SJHD 3GP7A 4R8IA 1C8CA 1QWYA 2L1BA 1WD1A 5C0XI 1DYQA 3IL8A 5FKAC 5EPKA 1CTMA 3DEPA 1PZKD 1LTGD 1HFGA 1KAAA 3Q22A 2IPKD 4RCNA 4C2MB 2A6HC 1DONA 3S1MB 1LT6D 2PO4A 2KUMA 3MXPA 2ICIA 3RD4A 3N52A 4TKOB 2WKDA 1B44D 3MHBA 1Q3LA 2EYLA 4A3EB 3NP8A 1HTLD 4BBRB 3GTJB 3VYRA 1TS3A 2OXPA 5ELCA 1SYFA 1V1PA 4DNRB 4DAVA 5T1GA 2LS01 2A69D 1G2TA 4G7OC 4A3JB 1TWFB 2M2LA 4O1NA 4O42A 1ZYRD 1GHJA 3VR6A 1ILPA 4CKBA 2PCFB 3SEBA 1SDFA 1L0YB 4DNTB 4FXKC 3PUVA 1QB5D 1LLRD 3BYYB 2F0JA 2VB3X 2F0IA 5I4DA 3FPPA 3HG9A 1SXTA 4R9WA 2AQ2B 1ESFA 1I4PA 2BE5D 2AQ3B 3BG3A 4XYOA 2TMPA 1SNQA 3MFYA 1LO5D 4C3HG 5DM73 1WD0A 3MC0B 2ENBA 1GUWA 3SK6A 2Z4HA 2OF1A 1K83B 4OO1G 1JWMD 3P75A 3HOXB 4QF4A 1ZXTA 4L63B 4DXFA 3TMEA 1RF2D 1O7LA 2J4XA 1SE2A 5IGCA 2NVTB 2F0HA 4H44C 1HUNA 2KA7A 4S3SA 2ID0A 4KKUA 2R93B 2WKCA 4ULLA 4XIGS 5JOBA 4MIUA 4EQNA 1G6ZA 3BS1A 3L7ZC 1TT2A 4PMBA 1EEFD 3Q6SA 3CRLC 2QDBA 5M3MB 1HFNA 1OXXK 4ODGA 1II3A 4FP5D 4HEDA 2ZT9C 2KHSA 2JEAI 4FO2A 2RDHA 1TQOA 1I4HA 4F8MA 4CJ2C 4A3MB 3NWSA 2IW3A 1DJRD 1F2ZA 2FHTA 4F87A 3PUZA 1CFMA 3A8JE 1PRTD 3S2HB 3FVQA 3S15B 4HN7A 3EROA 2HQEA 4OL7A 1E0BA 1SYEA 4A93B 4NW2A 1H9MA 3D4RA 2SNSA 1BCPF 1G91A 4RHSA 1CI3M 1CK1A 1AEXA 1EY4A 3Q23A 2ICEC 1CA6A 1HRJA 5F2DA 5JEAJ 2GA4B 1OXSC 5C4XB 1OXVA 3RZDB 1TWHB 2A6ED 3PV0A 2O5IC 5C44B 3DUZA 1D2BA 2KEEA 2NTSA 3D3RA 5M5XB 3J7YW 5G3LF 1AZQA 3DWPA 3AU7A 2BCOA 2JYOA 5DNFA 3F2UA 2EYJA 2ZXRA 1Q1BA 3A55A 5D3DA 3DM1A 3PMFA 3IKJA 4KD3A 1STGA 1E2VA 2PZWA 4H0LC 1UAPA 1Y1VB 1CQVA 1BXTA 1EOTA 3VYTA 2HCCA 2KJXA 4G7ZC 1GUOA 1UNSA 3OHXC 2TSSA 4KD4A 5FOBB 3PUXA 1U4LA 4ZK9B 3J80E 5I2XA 3M3YB 2PYKA 3K5NA 1CM9A 2NN6H 4ZLTF 1B4OA 3G6JB 1EYAA 1EIGA 3NSWA 4PNYA 3SVMA 1I3QB 4ZQ3A 1PZID 4KHZA 1CHQD 1SBBB 3I4MB 3Q0AA 3AMUA 2K03A 4HR7B 4HCEA 1SMYD 5C5MA 3PO3B 1B50A 1SNPA 2XWJB 1XWEA 3FKIB 1YNNC 1PXUA 3L9AX 5KNCA 2NN6I 2A5HA 4X3TA 5D14A 3J7AF 4K2KA 2EPBA 5K36G 3G7LA 1MI2A 3VR5A 1KLGD 3T4AC 3GV6A 5CC4A 1VF5C 2JE6I 3H09A 1BCPB 1ET6A 2CVRA 1IW7D 5ISRA 2K05A 1SAPA 3SXHA 3QB3A 3GTOB 1VMPA 1QNUA 1PTOD 2EDGA 3EFXD 2IX1A 1I4RA 3BDOA 4XTCS 3VA7A 1U9RA 3C1FA 3LWEA 3RUZA 1EY0A 4UDUC 2EJFC 1O80A 3A8IE 2Q8RE 3TP6A 3KBXA 3D31A 1JWUD 1ZKOA 5CBAE 3MA2B 1HQRD 2E76C 2F0NA 3I4NB 3TP7A 3V2TA 3R3OA 2NB0A 1GJXA 1F9RA 1JOKA 1LTRD 3TP8A 4DF7A 1HPCA 4C3IB 3MZ5A 2EYMA 1O7YA 2K1BA 1ONLA 3QO2A 1V43A 4XT3B 3QJYA 4Y7NB 5ELBA 1A6XA 3VR2A 4RH6A 1D6EC 3KF8A 4P2CB 3SE0A 1DCZA 1VCIA 2RDGA 2VB2X 5LL6S 1QNKA 1EY6A 1NCVA 2IWHA 5AFWA 1SNDA 2A69C 1A15A 3QOJA 1CZWA 3KK7A 5C4ZA 2FMMA 1QOHA 2SNMA 2XRQD 5BN3A 5EPJA 1D1IA 1W6JA 3I4LA 4DAPA 4XYQA 4H7BA 4HSPA 4FVMA 4DN4M 4PQXA 2XWBB 2B8GA 2PW7A 2SOBA 4CGYB 4HTHA 4B9WA 4XDXA 1M4VA 3VYSA 4K8JA 5M5WB 3R2IA 5D3IB 2EOTA 2D5DA 4RCOA 2ZXPA 4X3SA 4F7XA 3P1HA 5M9OA 1XYIA 4NP5A 3GO5A 1IKLA 1H9SB 2PPBC 3OWEB 1NUCA 3HGBA 3BVGA 4K5WA 4EQPA 1V1OA 1EU3A 1PTOH 4ID6A 2JA5B 1KTKA 3WOEA 4FF4A 5DEHA 3CRKC 3TP5A 4OIKA 3AB9A 2K04A 4IALA 2CW0D 1EY5A 2K6AA 1TY2A 1ZEQX 5G3LD 2L12A 3GTPB 4DU9A 5K36H 2PZUA 5JEAG 1RHPA 4A3FB 3TZDA 1D1KA 1TS4A 2F0PA 4AYBB 1WTXA 2D62A 1A3VA 3NTKA 3HOZB 2MHVA 1A2UA 3MAQA 2F0UA 4C3HB 5FO8B 3S9WA 4IFDJ 1PRTC 5A2QL 2OEOA 1DM0B 3GTGB 1SJED 2L55A 3KBGA 4TRDA 1V8QA 2EYPA 1SYCA 1I6HB 3LWUA 1JQYD 2G9HD 1ILQA 1SYGA 3FEWX 1PRTB 5KNBA 5JJZA 4DGZA 1FYCA 2XNAC 5EQ0A 1AFPA 3SK4A 4IZ8A 4FXGC 4CKEA 2EYHA 1S5BD 3M4YA 5LL6X 4C1NI 3K58A 1KABA 4KJOA 2O5JC 4ZYSA 2B2VC 4RAUC 4XXEA 1CA5A 3M85A 3RMHA 4QIWB 1YNJC 1PTOF 2LFNA 4B08A 1NR4A 3ONAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXT A;  1F9R A;  1F9S A;  3TN2 A;  1RTN A;  2X6G A;  2B2W C;  1VMC A;  1HFG A;  4ZKC B;  1EIH A;  2K03 A;  3HP3 A;  2B2T A;  3P7J A;  1O7Y A;  2HDL A;  2X6L A;  3UI2 A;  3H91 A;  1IL8 A;  1RTO A;  4IUU A;  4MHE A;  2K1B A;  5CMD A;  4QUC A;  1F9P A;  1HUN A;  3QO2 A;  2J7Z A;  3I3C A;  4XT3 B;  1B53 A;  1J8I A;  1DON A;  1KNA A;  2RA4 A;  4IUR A;  4OIK A;  2EE1 A;  2KUM A;  1B50 A;  1DZ1 A;  1X3P A;  1X32 A;  2B2Y C;  2K04 A;  4IUV A;  3GV3 A;  2KEE A;  1G6Z A;  1HHV A;  2K01 A;  4X3K A;  3N52 A;  4RA8 A;  2B2V A;  2N88 A;  2FIN B;  3DEO A;  1LV9 A;  3I91 A;  3Q6S A;  5EJW A;  2JP1 A;  1AZP A;  2L12 A;  1F2L A;  1Q3L A;  1AZQ A;  5D65 A;  1HUM A;  1MSG A;  2KVM A;  3MTS A;  1PFB A;  1ESR A;  4X3T A;  1QNK A;  2JYO A;  5D14 A;  5DNF A;  4CJ1 B;  1HFN A;  1RHP A;  1MSH A;  1NCV A;  1U4P A;  1PFN A;  3F2U A;  5AFW A;  2L9H A;  3TZD A;  4QUF A;  1WTO A;  1WTQ A;  1A15 A;  1DOK A;  1RJT A;  4HED A;  2NYZ D;  1B2T A;  3MWY W;  1WTX A;  2MGS A;  3D6W A;  4HAE A;  4CJ0 B;  2FMM A;  2EPB A;  1PDQ A;  1HA6 A;  1PLF A;  4CJ2 C;  2B2U C;  2NZ1 D;  2IL8 A;  5EPL A;  5T1G A;  3FPU B;  3G7L A;  4RWS C;  4ZKB B;  1WTP A;  5EPJ A;  1EQT A;  1MI2 A;  2B2W A;  3DM1 A;  3I8Z A;  5EKI A;  1G2T A;  2FFK B;  1BF4 A;  2HCI A;  3GV6 A;  2BDN A;  2M2L A;  4HCS A;  2NWG A;  4O42 A;  1BNZ A;  4HSV A;  2FHT A;  4IUT A;  1NR2 A;  1ILP A;  2X69 A;  4UAI A;  2SDF A;  2CVR A;  2VXW A;  1SDF A;  2XIW A;  2K05 A;  1TVX A;  2L4N A;  2RVL A;  1SAP A;  2D9U A;  2FJ2 A;  2RSN A;  1EOT A;  4DN4 M;  4OIJ A;  2B2T C;  2HCC A;  1VMP A;  2KEC A;  1JE4 A;  1ILQ A;  2B2Y A;  2MP1 A;  1U4M A;  1ML0 D;  1O7Z A;  1XX8 A;  2MPM A;  2K28 A;  4IUP A;  1M8A A;  3FDT A;  5JJZ A;  2HDM A;  1G2S A;  3R93 A;  2KED A;  1KNE A;  1ICW A;  2R3Z A;  2MJ8 A;  4U68 A;  1QE6 A;  5EQ0 A;  1F9Q A;  1S4Z A;  4XDX A;  1E0B A;  3IFD A;  3LWE A;  4NW2 A;  1SSO A;  2EOT A;  4R9W A;  1DOL A;  1ROD A;  5CBE E;  4XT1 B;  1WTR A;  2Q8T A;  1AP0 A;  1G91 A;  4MN3 A;  1U4L A;  1U4R A;  1J9O A;  4ZK9 B;  2DY8 A;  1BO0 A;  2B2V C;  1BBX C;  1O80 A;  4X3S A;  1X3Q A;  2H1E A;  2Q8R E;  5COY A;  5E4X A;  5COR A;  1EL0 A;  1CM9 A;  4ZLT F;  2N55 A;  4RAU C;  1B4O A;  1MGS A;  2KOL A;  1WTW A;  1QG7 A;  1XYI A;  1CA5 A;  4X3U A;  3KBX A;  2DY7 A;  1IKL A;  5CBA E;  2B2U A;  2HUG A;  1EIG A;  3I90 A;  1WTV A;  1WD0 A;  1B3A A;  4IUQ A;  3SVM A;  4ZAI A;  4LMQ D;  2RSO A;  1DOM A;  4R8I A;  5T1I A;  1PFM A;  1CA6 A;  1WVL A;  1JIC A;  1C8C A;  2L1B A;  1GUW A;  1WD1 A;  2L11 A;  1IKM A;  1HRJ A;  1NR4 A;  3IL8 A;  3ONA B;  5E4W C;  5EPK A;  3KUP A;  3DEP A;  1NAP A; 
#chains in the Genus database with same CATH topology
 3S14 B;  2Y0S E;  4HMI A;  2DNE A;  3R2T A;  2B2W C;  4KHV A;  1N8R C;  1E3P A;  1STA A;  3CCR A;  5M5Y H;  4LF8 L;  1NE3 A;  2HDL A;  1LM0 A;  5CMD A;  4HJ5 A;  4O2D A;  4DR3 Q;  3C3L A;  3PF4 A;  2NZH A;  5C3W A;  3H0G H;  5FLM G;  3T1H Q;  5EKL A;  4CDD C;  4BY7 H;  2UXD Q;  4J8Q A;  3CME A;  4JCV E;  5J39 A;  1N9W A;  3K6O A;  2XGT A;  3KLS X;  3SK8 A;  2NN6 G;  3A0J A;  5JJI A;  3BVM A;  4LF9 Q;  4NMZ A;  1HUM A;  1YHB A;  4QQB X;  2F0Q A;  2OTL A;  3AYH B;  2QF7 A;  2PI2 A;  4MTN A;  1MSH A;  1YHA A;  4TVA B;  2ZM6 Q;  4X64 L;  1RJT A;  5FO9 B;  2D2C C;  4RGM A;  1E2Z A;  1IZ6 A;  4OON A;  3VR3 A;  5C3X A;  1PDQ A;  1I50 B;  5J22 A;  2OQ0 A;  2H4O A;  4UHV A;  3FPU B;  3S16 B;  1EQT A;  3JAM L;  3RZO H;  2PMZ E;  1O7I A;  2Z1C A;  1R4Q B;  2BA0 A;  3S24 A;  4A3K H;  2NZO A;  3KOJ A;  5IT9 L;  4JI8 L;  3M4O H;  3CHB D;  3E0J A;  1EQR A;  2I5M X;  2JA8 H;  1EU4 A;  1DGS A;  1N33 Q;  4G4K A;  4P74 A;  4QL5 A;  5I9P A;  1FVI A;  2XIW A;  4K6L A;  2XRS D;  4I7A A;  4FF3 A;  1ENA A;  4A3I H;  3TBI B;  2R92 G;  1AE2 A;  4N8F A;  5EBD A;  4U68 A;  5IY0 A;  2V1C C;  1KDC A;  3ERS X;  4LFA Q;  4NDX A;  5HY6 A;  3STB D;  4NXM Q;  1AP0 A;  3HOW H;  3GTM B;  4OWX B;  1BOS A;  1J9O A;  1YBY A;  2DY8 A;  1S5F D;  5M3F H;  3LX0 A;  3NXW A;  5COR A;  2A68 C;  4UY8 C;  3QWN A;  1LAC A;  1JR0 D;  3I90 A;  4JI3 Q;  4R4T A;  1G51 A;  1X6O A;  4GOP B;  1STE A;  5T1I A;  1QUQ B;  1JIC A;  2V4D A;  4ILW A;  1TWC B;  1JWS D;  1IBK Q;  4B3M Q;  1GHK A;  4QB4 A;  4KKT A;  4RGO S;  2B63 G;  2A6H D;  1HZB A;  1UE1 A;  1BDO A;  1SMY C;  5TSS A;  5FJ8 G;  5IGB A;  2X6G A;  3S17 B;  2WV6 D;  2F4V L;  1VMC A;  3J81 L;  1CHP D;  4YY3 Q;  2CQA A;  5EGT A;  2MNA A;  1H9K A;  4MHE A;  5HGT A;  2DJG C;  2R7D A;  4BBS H;  2R6G A;  1EY8 A;  3EN2 A;  1NJI C;  1E7Z A;  3T13 A;  1B9M A;  2JQO A;  1V1Q A;  5JEA H;  2RA4 A;  4IUN A;  5IP9 H;  4A3G H;  5J1Z A;  1H9R A;  2F52 A;  3NHH A;  2IX3 A;  5DM6 3;  5ELO A;  2RCN A;  3DEO A;  3I91 A;  4DV7 Q;  2VUM H;  2NBF A;  1R4P B;  1SE3 A;  5FLX L;  2I0Q A;  2KVM A;  3IAY A;  4CJ1 B;  1IBM Q;  1BQQ T;  5L37 A;  4DR4 Q;  2R7Z G;  3VDY A;  2JXM B;  5JPM C;  2K7V A;  2MGS A;  2C9O A;  2HT1 A;  2QCP X;  2OCE A;  3X3M A;  5LHY 1;  2UXB L;  3MXN A;  2PNH A;  5LMN L;  4ABN A;  4DXG A;  4HCS A;  4X62 Q;  4HSV A;  2DGY A;  2Z6B A;  3B6Y A;  1A0I A;  2B29 A;  1SYD A;  2X69 A;  1HJP A;  1ICF B;  5KYL A;  1PYW D;  1JC7 A;  2E2D C;  2RSN A;  2M00 A;  2KEC A;  2PW5 A;  4JI5 L;  3CP0 A;  1SN8 A;  2F0O A;  2NVY H;  3H3V C;  1CSP A;  2E74 C;  2GVB A;  4IUP A;  1T9H A;  2E2J H;  1QE6 A;  2E2I H;  3ZYY X;  4KN7 C;  1PTO B;  4DK6 C;  4L6T B;  1FJG Q;  2VL6 A;  1ENC A;  5C3E H;  1I4Q A;  4L8J A;  1VQF A;  1A3T A;  1JJG A;  2WB1 B;  4DAY B;  4A3C G;  1CKN A;  5IP7 G;  4IQZ A;  4X3U A;  1SR3 A;  4G57 A;  3NBH B;  1U0L A;  4HMJ A;  3T56 B;  1V1P B;  4RGN A;  4DR5 Q;  1EY9 A;  4LMQ D;  1EYC A;  4YWK A;  1XTC D;  2L11 A;  4BS9 A;  2FMC A;  4EVO A;  2EY6 A;  2F03 A;  3C1E A;  3KUP A;  5FLM H;  2F0L A;  1T5E A;  4DK0 A;  2EJM A;  1WCM G;  1V9P A;  2DJF C;  3HP3 A;  3S2D B;  2CKZ B;  1MKH A;  3V05 A;  4IUU A;  2EYF A;  1JB7 A;  4QUC A;  2J7Z A;  1A8V A;  1H9S A;  3KLS A;  2EY5 A;  5IGG A;  2NTT A;  5HUR A;  2UUA L;  3K7A B;  1GUS A;  5DLQ E;  1EQV A;  3CKI B;  3TSS A;  2K01 A;  4G7H C;  1E2W A;  3M9B A;  2Z6K C;  1EYG A;  3U9O A;  2HIV A;  2QEJ C;  4DV0 Q;  1F2L A;  4F88 A;  4YHH L;  3RLF A;  4DV1 L;  1G29 1;  2LXK A;  1U4P A;  4KTA A;  2L9H A;  3OSO A;  3S1N H;  3F2B A;  3CQZ B;  1K0R A;  1TWG B;  3U9S A;  2OQK A;  3E6Z X;  1C9O A;  4Q5V A;  4CJ0 B;  1GVP A;  2LXJ A;  3JAM c;  2B2U C;  4LFC L;  3JAM i;  2M9V A;  1X55 A;  1LAB A;  3I8Z A;  5JJL A;  1TWF H;  5IT9 c;  1Y8P B;  2JK8 A;  5JAV A;  1HR0 Q;  4J15 A;  2L0C A;  2WAC A;  4UAI A;  2SDF A;  2B39 A;  1SMX A;  1F2Y A;  3NEL A;  1K9M C;  1IYJ B;  3LNN A;  4C3J G;  1AW7 A;  1MD2 D;  3NQI A;  3HS0 C;  1BCP C;  1O7Z A;  5K5P A;  2A1A A;  3J7A V;  4HID A;  1F9Q A;  5CV5 A;  2IT1 A;  1SFO H;  4IPC A;  4JV5 L;  2PNR C;  1Z6H A;  1RIP A;  1VDZ A;  4MZ9 A;  5KRU A;  1WJJ A;  2H5X A;  1ROD A;  1S72 A;  2KCT A;  2YTV A;  3K59 A;  2EY2 A;  5JVG 3;  1NBW A;  4X6A H;  1EL0 A;  2ZXO A;  2A73 B;  1Q46 A;  4JVZ A;  1J6Q A;  1SNM A;  3K0Y A;  5FJ8 H;  5KIX A;  5KND A;  1OXT A;  1YVC A;  3W2D A;  1HQM C;  3HOY G;  4LF6 L;  3A7L A;  4BWG B;  3NTH A;  3QIA A;  1PFM A;  3T16 A;  4Q0F A;  1IKM A;  1S40 A;  3R8B A;  4A3D B;  3M4Q A;  5E4W C;  4UP8 A;  3HOX H;  1XPO A;  4LAA A;  3CCU A;  3J81 c;  3QG1 A;  1X3F A;  3J81 i;  1ASY A;  2EJG C;  1LT4 D;  4ZKC B;  1GO3 E;  2F1M A;  1EIH A;  2I46 A;  2NVT H;  1VQL A;  2QDL A;  3RNU A;  1FNV A;  2RBM A;  2CW0 C;  1E24 A;  4AQY Q;  1VQ6 A;  1W3S A;  2R93 H;  3ER0 A;  1CKO A;  1X32 A;  1GOZ A;  3GV3 A;  1EYD A;  2B2V A;  2I5H A;  2F0V A;  2UU9 Q;  5D65 A;  3M4O B;  3OMC A;  3MTS A;  2GVA A;  1PFB A;  4OEM B;  1ESR A;  2E75 C;  3WWV A;  1HR0 W;  3CCJ A;  1LTB D;  1WTO A;  4IJH A;  4QUF A;  4A3B G;  3ERQ A;  1K28 A;  5I6W A;  3EA6 A;  4AIM A;  3EJI A;  4HAE A;  4ZRZ A;  3I55 A;  5I6Y A;  4DK1 A;  1D5M C;  2NZ1 D;  4A3M H;  1AH9 A;  3OYY A;  1DD2 A;  2PI2 E;  4WOR A;  1XMQ Q;  2B2W A;  1Y14 B;  2FFK B;  1C48 A;  1JOQ A;  1KRS A;  1A3U A;  2K5D A;  3HOW B;  5M3F B;  3H0G G;  4BY7 G;  4ZCK A;  1KC8 C;  2RF4 A;  1YIT A;  4OIJ A;  2EIF A;  3CCL A;  1U4M A;  1ML0 D;  4FXD A;  1VQ4 A;  3T51 B;  4B3R Q;  4A3C H;  1PYS B;  1ZYR C;  4DR7 L;  1PYB A;  3GTK B;  4E6I A;  1WTR A;  3K5O A;  4YCU A;  3G6E A;  3RLN A;  4GN3 B;  5LMU L;  1TWA B;  4IO9 A;  3K5M A;  4BBS B;  1WCM H;  2F0K A;  1HNW L;  4K6D A;  3T1Y L;  1XMO Q;  3HOV B;  2JA7 B;  2UXC L;  3Q8D A;  2RSO A;  2BE5 C;  4LK1 C;  4A3K G;  3PIO 3;  2JA8 G;  2R61 A;  4KJN A;  3SK5 A;  2RKS A;  5C4X H;  4KY7 A;  4CDC C;  3RZD H;  4A3I G;  1OO9 B;  1YNN D;  1O78 A;  4PMW A;  3G4S A;  1BBU A;  3PO2 G;  3KDF A;  3MXU A;  3PUW A;  5FO7 B;  1WYD A;  5CYU A;  5DAU A;  4CHT B;  3HOU G;  1D5X C;  1J5E L;  1LT5 D;  4UP7 A;  4M8A A;  1LT3 D;  4XQN A;  1JOR A;  4DV2 Q;  1B9N A;  1QUQ A;  2AUJ D;  1FGU A;  3J80 L;  2UUC Q;  2WAQ G;  1ENF A;  2I07 B;  5EJW A;  1K8O A;  2JP1 A;  1K8A C;  5NUC A;  2HHH Q;  3Q24 A;  2JA6 G;  3A56 A;  2K5W A;  3JC6 6;  2BA1 A;  3HKZ G;  3OW7 A;  2XVS A;  2Y0S B;  4L5S A;  1XNR Q;  4RKL A;  4BY1 G;  2F3V A;  2VNU D;  2NVX B;  2NYZ D;  4R8N A;  5C0X J;  2QA4 A;  1PMR A;  1YEZ A;  2NVY B;  3TZU A;  3KF6 A;  1PLF A;  5EPL A;  5EBC A;  4DUZ L;  4KI0 A;  2E2J B;  2E2I B;  4C3J H;  4GNX C;  4ME3 A;  2HIX A;  1NSN S;  1BF4 A;  2LY7 A;  1LTT D;  1Z47 A;  5CV6 A;  2BDN A;  4JI2 L;  3NEM A;  2VQE Q;  1UUP A;  2VS1 A;  2EY1 A;  1Y1W B;  3DWQ A;  5IGD A;  2A74 C;  4FNF A;  4A3G G;  1TVX A;  2L4N A;  5FLX E;  2D9U A;  4IFD H;  5JPN C;  2RDF A;  1PA6 A;  1R9T H;  1RKN A;  2OT2 A;  1M8A A;  3R93 A;  2J0T D;  2VUM G;  1IBL L;  4H02 A;  4DV5 Q;  1HNZ Q;  3HOY H;  3IFD A;  3A8K E;  2PQE A;  5I2Y A;  4EGV A;  4WJW A;  2SEB D;  4JOI C;  5CV4 A;  2D0O A;  5COY A;  2O4X A;  1Q90 A;  3GD7 A;  2PMZ B;  1VQI A;  3WDN A;  2UUB Q;  5C4J B;  1QZG A;  1WTW A;  4RFB A;  5IGF A;  1QG7 A;  4KHP Q;  2K14 A;  4J1M A;  1X54 A;  3N6R A;  1I3Q H;  2AHO B;  1B3A A;  2F0D A;  1B7Y B;  4LUV A;  4K5X A;  4RHR A;  4ZAI A;  2VQF Q;  3U58 A;  1DOM A;  1KDA A;  3OPO A;  2LMC B;  2XN9 C;  4C1N K;  1WVL A;  3AQQ A;  2K32 A;  1TR5 A;  2WIN B;  1UE5 A;  1N36 L;  4WJ3 M;  1IXR A;  4JYA Q;  3TN2 A;  1N34 L;  3GTQ H;  4LF5 L;  2DUD A;  2XTI A;  4IFD I;  4JPB W;  4XQQ A;  5ELE A;  3UI2 A;  4DAY A;  2JSO A;  4LFB Q;  1IL8 A;  3S1N B;  3URY A;  1F9P A;  2L5T A;  3I3C A;  1HZC A;  3NBH A;  2EZV A;  1VQ7 A;  1A2T A;  1PH1 A;  1J8I A;  4Z9C B;  1PH2 A;  1QZH A;  4Y52 H;  1EY7 A;  3CU7 A;  4A3L G;  5IYD H;  2B2Y C;  5C3E G;  2F0T A;  3FKI H;  4BA2 I;  3W3A A;  4X3K A;  1HA5 A;  2N88 A;  2R92 B;  1Y69 U;  5IIF A;  1AZP A;  2A6E C;  1B1Z A;  3M7N A;  3H94 A;  2Z9H A;  3SGI A;  1PFN A;  2AQ1 B;  4P72 A;  5ELD A;  3E0E A;  5H1S E;  1CT1 D;  5CGK A;  2CH4 A;  1CZG A;  3X3N A;  1HA6 A;  1IHZ A;  3NQT A;  2Z4I A;  3SHL A;  3ND8 A;  3QOL A;  4TQU S;  3DHQ A;  3PQI A;  2MFI A;  1SFO B;  3OTO Q;  1GUG A;  5EKI A;  3H6M A;  3V96 A;  1Q81 C;  1VQD A;  4B3S Q;  1X3G A;  4DR3 L;  3IFT A;  2B63 B;  3EVQ A;  4K2L A;  1FNU A;  3T1H L;  1Y8O B;  1GD7 A;  2MO0 A;  2RVL A;  4WFN 3;  2UXD L;  4N9P A;  2B2T C;  3NE5 B;  5GAD C;  4EX5 A;  1FL0 A;  2MO1 A;  4QMG A;  4X64 Q;  1EFW A;  2Z6K A;  2VW9 A;  3KF8 B;  2KED A;  2MJ8 A;  1AN8 A;  2E2H H;  3BZD B;  1EIY B;  4A4I A;  4LF9 L;  4OEL B;  2GN5 A;  4K14 A;  4A3E G;  1VQE A;  4C56 C;  4DV6 Q;  2ZM6 L;  3I70 A;  4BBR G;  3HEJ A;  2Q8T A;  1BO0 A;  1C4Q A;  4EQO A;  1L0X B;  2EVB A;  2KOL A;  2AUK A;  3BDL A;  4V0B A;  1YHQ A;  2B2U A;  4POG A;  5EKK A;  1VQC A;  5GAE C;  3GTL H;  4A3J G;  3I4N H;  3KFU A;  3PO2 H;  2R7Z B;  3D6C A;  1STH A;  4H13 C;  3HOU H;  1STB A;  3FHW A;  4PZ7 A;  2YU9 B;  2BH8 A;  4KY6 A;  3MXG A;  2KCN A;  1NAP A;  1N33 L;  3S1Q H;  4QJF A;  4GOP C;  1DXM A;  1F9S A;  4C3I H;  5A35 A;  3NUC A;  2CH4 W;  1SE4 A;  3P7J A;  1BR9 A;  4JI7 Q;  4R4C A;  1RTO A;  2JA6 H;  1B53 A;  3CW2 C;  4LFA L;  1FNW A;  1B8A A;  1S5C D;  5C4H A;  3J80 c;  3CC2 A;  4KK7 A;  4BY1 H;  4NXM L;  3MEH A;  2KBN A;  3L2P A;  3ICE A;  4FF1 A;  2FIN B;  2IHE A;  5CR3 A;  4L5Q A;  4K8I A;  3K5L A;  4QIW E;  3SR1 A;  5E3F A;  2A8V A;  1OXU A;  3E9I A;  4YWL A;  4M1U B;  1EFI D;  2WFW A;  2EXZ A;  3VR4 A;  1IBK L;  4B3M L;  1X9N A;  1B2T A;  3MWY W;  3ITP A;  3ND9 A;  1HTP A;  1VQH A;  3HOX G;  4XQJ A;  2IL8 A;  4N8X 1;  4ZKB B;  2RQX A;  5I9O A;  4PV1 C;  4YY3 L;  3KYH C;  2HCI A;  2G9D A;  3TEH B;  1KLU D;  1BNZ A;  1E1O A;  1PZJ D;  4JC0 A;  4LJZ C;  4DV3 Q;  2Q2T A;  3BJU A;  2R93 G;  3J7A 5;  1JB3 A;  2BOS A;  4KKS A;  1HHV A;  3NPP A;  1CUK A;  3DMU A;  3RN2 A;  1WCM B;  1E1T A;  3DM3 A;  2JN4 A;  1Q8K A;  1TY0 A;  1Z7T A;  3FDT A;  2HDM A;  4A75 A;  1G2S A;  4DV7 L;  3S1R B;  4R4Q A;  2ES2 A;  5C5L A;  3FMC A;  1S4Z A;  5M3M G;  5M5W H;  2KCC A;  1BUV T;  1IBM L;  4DR4 L;  1HXY D;  1IW7 C;  1HCZ A;  1YNJ D;  3WOF A;  1PHJ A;  1DOL A;  1SRO A;  4QCL A;  1DZ1 A;  1BBX C;  3K81 C;  1PTO C;  5E4X A;  1X3Q A;  1A62 A;  1M1K C;  1MGS A;  3HKS A;  5IWA Q;  4A3M G;  3GQB A;  1QCB D;  1BVS A;  4X65 Q;  2ZJQ A;  1LTI D;  3D8G A;  4NKL A;  4TSS A;  2ZTD A;  1GXD C;  1EZ8 A;  4X62 L;  1SEB D;  5IOC A;  2O2L D;  2CHB D;  4DFA A;  1EOV A;  1M90 C;  2F0M A;  2WP8 J;  3I72 A;  1XPU A;  1RDP D;  2NVQ H;  4BA1 I;  3BZC A;  5FK9 C;  4A3L H;  4IN3 A;  2ZJP A;  2YYZ A;  5E1F A;  1ASZ A;  2F0G A;  5IOD A;  4OGQ C;  3NK9 A;  2K5Q A;  4DR6 L;  1TII D;  4A93 G;  1MHW C;  2IX0 A;  1I94 Q;  3A5U A;  1XXG A;  4CDF C;  1FJG L;  1T5X D;  4ZUI A;  3NTI A;  4GKJ Q;  1FGB D;  4LF7 Q;  2BDO A;  2WII B;  5GAH C;  4C3J B;  2QIL A;  2RCF A;  3BVZ A;  1Q12 A;  3PUY A;  4RA8 A;  1KIX A;  1LV9 A;  1XJV A;  2B8F A;  4JBJ A;  4IOA A;  1MSG A;  4A3F H;  4OWT B;  4OX9 Q;  4DR5 L;  1K8G A;  1WTQ A;  4C2M H;  1DOK A;  1GUN A;  4JI0 Q;  4LNQ A;  3CXC A;  1KDB A;  3D6W A;  1R9T B;  1EWC A;  3S1M H;  5ELF A;  5KYI A;  4HIM A;  3A5Z B;  2AMC B;  4RWS C;  4DR2 Q;  5AJ3 L;  2KCM A;  3I73 A;  1WTP A;  5C4X G;  3HOY B;  4APV A;  1JOO A;  2L15 A;  1VQN A;  2XSC A;  1VQK A;  2AWN A;  4OO1 H;  5C44 G;  4GLA C;  4DKA C;  1PH6 A;  4A3E H;  2N8N A;  1S3O A;  4N9T A;  1L1O C;  5LMN W;  1CQF A;  4BBR H;  3GTJ H;  3CF5 A;  4FF2 A;  4RG1 A;  3CC7 A;  2MP1 A;  2K28 A;  2A68 D;  2EYO A;  1GKH A;  2Q2I A;  3OWF A;  1MBY A;  4FDB A;  5C0X G;  3E3X A;  4DV0 L;  3O13 A;  4KY5 A;  1UWV A;  2DNC A;  4DUY Q;  3HZX A;  1E22 A;  1EEI D;  4KMU C;  1L1O B;  4A3J H;  3GTQ B;  4HJ9 A;  4PG3 A;  1JJ2 A;  1U4R A;  1HZ9 A;  1Q8I A;  4KN4 C;  2ZTC A;  1W6K A;  2F3I A;  3G48 A;  4WJ4 A;  4GNX A;  1WTV A;  2PZT A;  4BXX H;  1CSQ A;  2QKI C;  1PH7 A;  4A3B B;  1QJO A;  1S5D D;  1VF7 A;  3DLL A;  1HR0 L;  2F0E A;  4OO1 I;  3CPF A;  4WRD A;  3S14 H;  4UPA A;  1Y1V G;  1Y8N B;  2JA9 A;  1RTN A;  3D4W A;  4B9X A;  4IFD G;  2N3S A;  5IYB H;  4B3T Q;  1WI5 A;  5M5Y B;  5A2Q E;  5BN4 A;  3P20 A;  4I7Z C;  2AKW B;  5CV7 A;  2K33 A;  2C5C A;  1ET9 A;  2JEB I;  3H0G B;  1KNA A;  1D5Z C;  4BY7 B;  4IUR A;  4DA2 A;  4AH6 A;  4IUV A;  4OXP A;  1K83 H;  1RD9 D;  3FRP B;  2WB1 E;  4JOI A;  2Q8I B;  3MEF A;  4YCW A;  4CKC A;  3F8T A;  5IYC G;  4GLX A;  2JJQ A;  1IYV A;  3PF5 A;  3ULP A;  2MUY A;  3E9H A;  4OHJ A;  4JBW A;  2ASB A;  1VQP A;  1IYU A;  3I4M G;  1BBW A;  4NXN L;  3C46 A;  2CCZ A;  1I50 H;  4ZUJ A;  2PQA A;  1HNX Q;  1GUT A;  2RHS B;  1YIJ A;  3S16 H;  2E2H B;  1FR3 A;  3E5S A;  1VQO A;  2F4I A;  3DXJ C;  3RZO B;  1MJE A;  1G8Z D;  1WFQ A;  4JK1 C;  1EZ6 A;  3PIP 3;  4A3K B;  3PO3 G;  4AQY L;  5M3M H;  1NR2 A;  3A7A B;  2NUC A;  1XNQ Q;  2JA8 B;  2AWO A;  2VXW A;  3PIO A;  1FD7 D;  2F0F A;  1PRT F;  1LTA D;  3OMG A;  2FJ2 A;  5IYD G;  4X66 Q;  3FKI G;  3DWA A;  1JE4 A;  2B2Y A;  3BZK A;  3HRZ C;  5KGU A;  4A3I B;  3NWT A;  2MPM A;  3K57 A;  4JI4 Q;  1AE3 A;  3GTL B;  3MFG A;  3PO2 B;  1VQJ A;  2CQO A;  3C2P A;  2CWP A;  3OOC A;  4GZY C;  1C0A A;  2R3Z A;  3SDZ A;  1F2M A;  3HOU B;  4LF4 Q;  1X65 A;  3M7G A;  1YNX A;  1L2F A;  1WTH A;  4YIJ A;  2UU9 L;  3S1Q B;  2P5Z X;  4ME5 A;  1K3R A;  4P71 A;  3GTM H;  4MN3 A;  2OWO A;  3PSI A;  2F0W A;  4GKK Q;  2WAQ B;  4KLK A;  4J6H A;  3S2H H;  3F1Z A;  1N32 Q;  3OIQ A;  3S15 H;  2CFM A;  2JA6 B;  1I4X A;  1XMQ L;  1EQQ A;  3OIP A;  1I4G A;  3L3O C;  4IUQ A;  3MXN B;  3HKZ B;  1H9J A;  3CCE A;  4BY1 B;  1LTS D;  2E5L Q;  4A93 H;  4R1J A;  2OTJ A;  5JVH 3;  2K50 A;  5BN5 A;  3TDQ A;  1F77 A;  3JAM E;  2B2T A;  4K5V A;  4RGT A;  3EQL C;  3I4O A;  1VQB A;  3KJP A;  2X6L A;  4B3R L;  3H91 A;  1RL2 A;  2IJ0 A;  1SNO A;  5IT9 E;  1NMG A;  4R4O A;  4JI1 Q;  2EE1 A;  1LYL A;  1X3P A;  4YWM A;  4A3G B;  4MNO A;  4HIK A;  4RKB A;  4A76 A;  4V19 0;  4U67 3;  1A63 A;  2VUM B;  1K8M A;  1TKW B;  1UEA B;  1XMO L;  1CKN B;  1TWH H;  1S5E D;  1Q1E A;  3NBI A;  3I4N G;  1EWH A;  5C44 H;  3BDC A;  3MVV A;  1I6V C;  5IGE A;  2Z8L A;  4GOP A;  1OTC A;  1XTD A;  1SYB A;  4C3I G;  3T53 B;  3VA5 A;  5M5X H;  2YTX A;  4FYD A;  1STN A;  1BCP D;  1PV4 A;  2LKV A;  1TU2 B;  2NWG A;  2Q2U A;  1TS2 A;  5KEE A;  1RCV D;  5C0X H;  4IUT A;  2HQL A;  1JCK B;  4CBV A;  4I65 A;  4RMF A;  1SNC A;  3BYT B;  3A74 A;  4KV6 A;  4DV2 L;  5CV8 A;  3J81 E;  1PFS A;  3UDG A;  4GLV B;  2UUC L;  1XX8 A;  3J7Z C;  4O0A A;  1PH5 A;  3KLR A;  3VYU A;  1KNE A;  1ICW A;  2HHH L;  1P16 A;  5C6A A;  2NVQ B;  1SSO A;  1NNX A;  5CBE E;  4XT1 B;  1P8L A;  4PMC A;  1XNR L;  4P75 A;  5C3E B;  2KQ3 A;  1D8L A;  2F3W A;  2H1E A;  2IY5 B;  3H3V H;  5CV9 A;  3A54 A;  1Y1V H;  2N55 A;  1TS5 A;  1STY A;  2DY7 A;  2DN8 A;  2HUG A;  2F0S A;  1QIL A;  3D4D A;  1QVC A;  1SJH D;  3STB C;  3GP7 A;  3ULL A;  4R8I A;  1C8C A;  1QWY A;  2A19 A;  2L1B A;  2VQE L;  1WD1 A;  5C0X I;  1DYQ A;  3IL8 A;  5FKA C;  5EPK A;  1CTM A;  3CAM A;  3DEP A;  3K0X A;  1PZK D;  1LTG D;  3UE0 A;  1HFG A;  3W1G A;  4K0K Q;  1Q82 C;  3M3Y H;  2FXQ A;  3S2D H;  1KAA A;  3Q22 A;  4DV4 Q;  2IPK D;  4RCN A;  5IYC H;  4C2M B;  4DV5 L;  1HNZ L;  2A6H C;  4LUO A;  1KAW A;  1DON A;  3S1M B;  2I5L X;  1LT6 D;  2PO4 A;  2KUM A;  3K7A H;  2N78 A;  3MXP A;  2ICI A;  3I7F A;  3RD4 A;  2D0P A;  3N52 A;  4TKO B;  5BR8 Q;  1VQG A;  3I4M H;  3H3V I;  2WKD A;  3PGZ A;  2UUB L;  1B44 D;  3MHB A;  3U50 C;  1PVO A;  3M4P A;  1Q3L A;  2E8G A;  2EYL A;  4A3E B;  3NP8 A;  3FP9 A;  2VQF L;  1HTL D;  4BBR B;  3GTJ B;  3VYR A;  1TS3 A;  3PO3 H;  2OXP A;  2JA5 G;  5ELC A;  4JG2 A;  1SYF A;  1V1P A;  4DNR B;  4DAV A;  4JYA L;  2K75 A;  4QY7 A;  5T1G A;  4DR1 Q;  2LS0 1;  2BH2 A;  2A69 D;  1G2T A;  4G7O C;  4A3J B;  1TWF B;  2M2L A;  4LFB L;  4O1N A;  4O42 A;  4JI6 Q;  3KJO A;  4HJA A;  1ZYR D;  1GHJ A;  3VR6 A;  1ILP A;  1SE8 A;  4CKB A;  2PCF B;  4L5T A;  3SEB A;  4ALP A;  1SDF A;  1L0Y B;  4DNT B;  4FXK C;  3PUV A;  1QB5 D;  1LLR D;  4LF8 Q;  1QVF A;  1K0S A;  1MIU A;  3CCM A;  1KD1 C;  3BYY B;  3L0O A;  2F0J A;  2VB3 X;  2F0I A;  4A3F G;  5I4D A;  3CCQ A;  3GDE A;  3HG9 A;  1SXT A;  3FPP A;  2AQ2 B;  4R9W A;  1UE7 A;  4AYB G;  1ESF A;  1I4P A;  1NTG A;  2BE5 D;  2AQ3 B;  3BG3 A;  4XYO A;  2TMP A;  3HOZ G;  1SNQ A;  3MFY A;  3GTO H;  1LO5 D;  3UDX A;  4C3H G;  5DM7 3;  1WD0 A;  3OTO L;  3MC0 B;  1B70 B;  2ENB A;  1GUW A;  4B3S L;  3SK6 A;  2Z4H A;  2OF1 A;  4A3D H;  1K83 B;  4OO1 G;  1JWM D;  1NY4 A;  3P75 A;  3HOX B;  4QF4 A;  1I5F A;  1ZXT A;  1L1O A;  4L63 B;  4DXF A;  3TME A;  4JBK A;  1RF2 D;  4AYB E;  1O7L A;  2J4X A;  3K80 C;  1SE2 A;  2LSS A;  5IGC A;  4NPS A;  2NVT B;  2F0H A;  4H44 C;  4JI8 Q;  2KA7 A;  4S3S A;  1HUN A;  2ID0 A;  4LUZ A;  3AEV A;  4KKU A;  3EBE A;  4DNI A;  2R93 B;  2WKC A;  4ULL A;  1VQA A;  3ULJ A;  4DV6 L;  4XIG S;  5JOB A;  2K5H A;  4MIU A;  4EQN A;  1G6Z A;  3BS1 A;  3L7Z C;  1TT2 A;  4PMB A;  1EEF D;  3F2D A;  3Q6S A;  3CRL C;  2QDB A;  5M3M B;  5EAY A;  2K4K A;  1HFN A;  1OXX K;  4ODG A;  4BXX G;  1II3 A;  3F2C A;  4FP5 D;  4HED A;  2ZT9 C;  2KHS A;  2JEA I;  4FO2 A;  1YI2 A;  2CWA A;  2RDH A;  1TQO A;  4Y7N H;  1I4H A;  1G6P A;  4F8M A;  4CJ2 C;  4A3M B;  3J80 i;  2K5N A;  3NWS A;  2IW3 A;  5IYB G;  1DJR D;  1F2Z A;  4JI7 L;  2FHT A;  3NEN A;  4F87 A;  3PUZ A;  1CFM A;  1KHI A;  3A8J E;  3KDF B;  4IPH A;  1PRT D;  3S2H B;  4JI3 L;  1PH3 A;  4QGU A;  3FVQ A;  2F4V Q;  3S15 B;  2N49 A;  4HN7 A;  1MJC A;  3ERO A;  2HQE A;  4OL7 A;  3GTK H;  2VY3 A;  1E0B A;  1SYE A;  4A93 B;  3TRZ A;  1K73 C;  4NW2 A;  2RHQ B;  1H9M A;  3D4R A;  2SNS A;  1BCP F;  1Q86 C;  1G91 A;  4RHS A;  1CI3 M;  1CK1 A;  1AEX A;  1EY4 A;  1TWA H;  1LTL A;  3Q23 A;  2JA7 H;  3HOV H;  3KF6 B;  2ICE C;  4UP9 A;  1CA6 A;  1HRJ A;  4DV3 L;  4L5R C;  1X3E A;  5F2D A;  4P73 A;  2UXB Q;  5JEA J;  2GA4 B;  1OXS C;  5C4X B;  1OXV A;  5LMN Q;  3RZD B;  1TWH B;  1UEB A;  2A6E D;  3PV0 A;  2O5I C;  5GAG C;  5C44 B;  1BKB A;  3DUZ A;  1D2B A;  2KEE A;  2NTS A;  4JI5 Q;  3D3R A;  5M5X B;  2JA5 H;  3J7Y W;  1VQ9 A;  5G3L F;  1D7Q A;  4HIO A;  5IWA L;  1AZQ A;  3DWP A;  3AU7 A;  5E7N A;  4X65 L;  2BCO A;  2JYO A;  5DNF A;  1YJW A;  3F2U A;  2NVX H;  2EYJ A;  3AFQ A;  2ZXR A;  1Q1B A;  4DR6 Q;  3A55 A;  5D3D A;  3DM1 A;  3PMF A;  3IKJ A;  4KD3 A;  4JBM A;  1Y1W H;  1STG A;  3GTP H;  3EIV A;  1E2V A;  2PZW A;  4H0L C;  4GN5 A;  1I94 L;  1UAP A;  4LWC A;  1Y1V B;  1CQV A;  4GKJ L;  1BXT A;  1EOT A;  1KRT A;  3VYT A;  4LF7 L;  2HCC A;  2KJX A;  4G7Z C;  1GUO A;  1UNS A;  2G5D A;  1VQ8 A;  3OHX C;  3HOZ H;  2TSS A;  4KD4 A;  4C3H H;  5FOB B;  3PUX A;  2QW7 A;  1PH4 A;  3UDI A;  4IPG A;  2UUA Q;  4OX9 L;  5AJ3 Q;  3GTG H;  1U4L A;  4ZK9 B;  2KHJ A;  5IE8 A;  4JI0 L;  3J80 E;  5I2X A;  3M3Y B;  2PYK A;  3K5N A;  5C4J H;  1Q7Y C;  1CM9 A;  2NN6 H;  4ZLT F;  1B4O A;  3G6J B;  3K8A A;  1I6H H;  4MTK A;  2Z0S A;  4YHH Q;  4DV1 Q;  1EYA A;  4DR2 L;  1EIG A;  2QEX A;  1XPR A;  3NSW A;  4PNY A;  4DK3 C;  4POF A;  3SVM A;  1I3Q B;  4ZQ3 A;  1PZI D;  4KHZ A;  1KL9 A;  1VQ5 A;  1CHQ D;  1SBB B;  3I4M B;  3U4Z A;  3Q0A A;  3AMU A;  4LFC Q;  2R7F A;  4CDE C;  1LUZ A;  2K03 A;  4HR7 B;  4HCE A;  4GN4 B;  1SMY D;  2KEN A;  5C5M A;  3PO3 B;  3PIP A;  1YJ9 A;  4DUY L;  1B50 A;  1SNP A;  2XWJ B;  1XWE A;  4HJ8 A;  3FKI B;  1YNN C;  1PXU A;  3L9A X;  2WB1 G;  2R92 H;  1WOC A;  5KNC A;  2NN6 I;  2A5H A;  3IRB A;  1JMC A;  1U5K A;  3HFZ B;  3W1B A;  4JV5 Q;  4X3T A;  5D14 A;  1C7Y A;  3J7A F;  1CKM A;  4K2K A;  2EPB A;  1EWI A;  3TS2 A;  3UDF A;  5K36 G;  3G7L A;  4LF6 Q;  1MI2 A;  3VR5 A;  1YJN A;  2ATW A;  1KLG D;  4B3T L;  3T4A C;  3GV6 A;  5CC4 A;  1VF5 C;  2JE6 I;  3H09 A;  2B63 H;  1BCP B;  3CCS A;  1JE5 A;  1ET6 A;  2CVR A;  1IW7 D;  5ISR A;  2K05 A;  1SAP A;  3SXH A;  3QB3 A;  3GTO B;  1VMP A;  2QGQ A;  1JJC B;  1QNU A;  1PTO D;  3CC4 A;  2EDG A;  3EFX D;  2IX1 A;  1I4R A;  3BU2 A;  3BDO A;  3CPW A;  4NXN Q;  4XTC S;  3VA7 A;  1U9R A;  3C1F A;  3LWE A;  3RUZ A;  1EY0 A;  4UDU C;  2EJF C;  1O80 A;  3A8I E;  2Q8R E;  3TP6 A;  3TRE A;  3OW2 A;  2Q2H A;  1HNX L;  3KBX A;  3D31 A;  1JWU D;  1ZKO A;  5CBA E;  3MA2 B;  3AFP A;  1HQR D;  2E76 C;  2F0N A;  2R7Z H;  1W2B A;  3I4N B;  5GQO A;  3TP7 A;  3V2T A;  3R3O A;  2YU9 H;  2NB0 A;  5FLX c;  5ELN A;  1GJX A;  1XNQ L;  1F9R A;  1GM5 A;  1JOK A;  1LTR D;  3TP8 A;  1KQS A;  4DF7 A;  4X66 L;  1HPC A;  4C3I B;  3CCV A;  3MZ5 A;  2EYM A;  1O7Y A;  2ALY B;  4JI4 L;  2K1B A;  1ONL A;  3QO2 A;  1V43 A;  2K52 A;  4XT3 B;  4LW1 A;  4PZ8 A;  4LF4 L;  2EXD A;  3QJY A;  4DAM A;  3LGJ A;  4Y7N B;  5ELB A;  1A6X A;  3VR2 A;  3RLO A;  3RN5 A;  4RH6 A;  1D6E C;  1TWC H;  3KF8 A;  4P2C B;  3W5O A;  3SE0 A;  4GKK L;  1DCZ A;  2ZJR A;  1VCI A;  1HZA A;  4DR7 Q;  3S17 H;  4NB3 A;  1Z9F A;  1UE6 A;  1N32 L;  2RDG A;  2VB2 X;  4IJL A;  5LL6 S;  1JT8 A;  3RR5 A;  1QNK A;  1EY6 A;  1NCV A;  2IWH A;  5AFW A;  2KHI A;  1SND A;  2A69 C;  1A15 A;  3QOJ A;  4A3D G;  4R4I A;  1CZW A;  2E5L L;  3KK7 A;  5C4Z A;  5J3B A;  5LMU Q;  2FMM A;  4IOC A;  5IP7 H;  1QOH A;  2SNM A;  1HNW Q;  2XRQ D;  3T1Y Q;  5BN3 A;  5EPJ A;  1D1I A;  2UXC Q;  1W6J A;  3I4L A;  4DAP A;  1L0W A;  4XYQ A;  3J81 j;  1VS0 A;  4H7B A;  1X56 A;  4HSP A;  4FVM A;  4JI1 L;  4DN4 M;  3UE1 A;  4PQX A;  2XWB B;  2B8G A;  3S1R H;  2PW7 A;  2SOB A;  3PCO B;  4CGY B;  4GS3 A;  4HTH A;  4B9W A;  4XDX A;  1M4V A;  3VYS A;  4EQ5 A;  2MQH A;  4K8J A;  1J5E Q;  5M5W B;  3D0F A;  3R2I A;  5D3I B;  5GRO A;  2EOT A;  2D5D A;  4RCO A;  2ZXP A;  1TXY A;  4X3S A;  4F7X A;  3P1H A;  5M9O A;  1PH8 A;  1XYI A;  4NP5 A;  2EQS A;  3GO5 A;  1IKL A;  1H9S B;  2C35 B;  2PPB C;  2VZA A;  3OWE B;  1NUC A;  3HGB A;  3BVG A;  5HGQ A;  4K5W A;  4EQP A;  1V1O A;  4PZ6 A;  5M3F G;  3HOW G;  1EU3 A;  1PTO H;  4ID6 A;  2JA5 B;  1SLJ A;  1K3B C;  4DUZ Q;  4DPG A;  1KTK A;  3I2Z A;  1QVG A;  4YCV A;  4JI2 Q;  4OWW B;  1SRU A;  1EUJ A;  3WOE A;  3U4V A;  4FF4 A;  5DEH A;  3CRK C;  3TP5 A;  2B3G A;  4OIK A;  1YZ6 A;  3AB9 A;  2K04 A;  2WAQ E;  4IAL A;  2CW0 D;  1PH9 A;  1EY5 A;  2K6A A;  1TY2 A;  1ZEQ X;  5G3L D;  3K7U C;  1IBL Q;  2L12 A;  4BBS G;  3TS0 A;  4DU9 A;  3GTP B;  5K36 H;  1EIF A;  2JA7 G;  3HOV G;  2PZU A;  5JEA G;  3HKZ E;  3I56 A;  1RHP A;  5IP9 G;  4A3F B;  1HH2 P;  3TZD A;  1D1K A;  1TS4 A;  1H95 A;  2F0P A;  4AYB B;  4GNX B;  3G71 A;  5JJK A;  1WTX A;  1B3Q A;  2YTY A;  2D62 A;  1A3V A;  3NTK A;  3HOZ B;  2MHV A;  2K5V A;  3H15 A;  1A2U A;  3MAQ A;  2F0U A;  4C3H B;  5FO8 B;  3S9W A;  4K0K L;  1PRT C;  4IFD J;  4DV4 L;  5A2Q L;  4IPD A;  2OEO A;  1DM0 B;  3GTG B;  1IL2 A;  1SJE D;  2L55 A;  4KHP L;  3KBG A;  1N36 Q;  3CD6 A;  3KLW A;  4TRD A;  3TQY A;  1VQM A;  1N34 Q;  1V8Q A;  4LF5 Q;  2EYP A;  1SYC A;  1I6H B;  3LWU A;  1JQY D;  3CQZ H;  2G9H D;  3CMA A;  1TWG H;  1ILQ A;  1SYG A;  3FEW X;  5BR8 L;  1PRT B;  5KNB A;  5JJZ A;  4DGZ A;  1FYC A;  2XNA C;  5EQ0 A;  1AFP A;  3SK4 A;  4IZ8 A;  2YV5 A;  4FXG C;  4CKE A;  2EYH A;  4HJ7 A;  2Y0S G;  1S5B D;  3M4Y A;  5LL6 X;  2IHF A;  4C1N I;  3K58 A;  1KAB A;  4KJO A;  2O5J C;  4ZYS A;  2B2V C;  4RAU C;  4XXE A;  1CA5 A;  3M85 A;  3ZJY C;  3RMH A;  4DR1 L;  3QR8 A;  4QIW B;  2PQA B;  1YNJ C;  1PTO F;  2ZTE A;  4A3B H;  2LFN A;  4JW0 A;  1Y1W G;  4JI6 L;  1KXL A;  4B08 A;  1NR4 A;  2HD3 A;  1NMF A;  3ONA B; 
#chains in the Genus database with same CATH homology
 3S14 B;  4HMI A;  2DNE A;  3R2T A;  2B2W C;  4KHV A;  1STA A;  2HDL A;  5CMD A;  3C3L A;  5C3W A;  5EKL A;  4J8Q A;  5J39 A;  3K6O A;  3KLS X;  3SK8 A;  2NN6 G;  3BVM A;  4NMZ A;  1HUM A;  2F0Q A;  2QF7 A;  1MSH A;  1RJT A;  5FO9 B;  2D2C C;  4RGM A;  1E2Z A;  3VR3 A;  5C3X A;  1PDQ A;  1I50 B;  5J22 A;  2H4O A;  3FPU B;  3S16 B;  1EQT A;  3JAM L;  2Z1C A;  1R4Q B;  2BA0 A;  5IT9 L;  3CHB D;  3E0J A;  1EU4 A;  4G4K A;  5I9P A;  2XIW A;  4K6L A;  2XRS D;  4FF3 A;  1ENA A;  3TBI B;  5EBD A;  4U68 A;  1KDC A;  4NDX A;  1AP0 A;  3GTM B;  1BOS A;  1J9O A;  2DY8 A;  1S5F D;  3LX0 A;  3NXW A;  5COR A;  2A68 C;  3QWN A;  1LAC A;  1JR0 D;  3I90 A;  1STE A;  5T1I A;  1JIC A;  2V4D A;  4ILW A;  1TWC B;  1JWS D;  1GHK A;  4QB4 A;  4KKT A;  4RGO S;  2A6H D;  1BDO A;  1SMY C;  5TSS A;  5IGB A;  2X6G A;  3S17 B;  2WV6 D;  1VMC A;  3J81 L;  1CHP D;  2CQA A;  5EGT A;  1H9K A;  4MHE A;  5HGT A;  2R6G A;  1EY8 A;  3T13 A;  1B9M A;  5JEA H;  2RA4 A;  4IUN A;  5J1Z A;  1H9R A;  3NHH A;  2IX3 A;  5DM6 3;  3DEO A;  3I91 A;  2NBF A;  1R4P B;  1SE3 A;  5FLX L;  2KVM A;  3IAY A;  4CJ1 B;  1BQQ T;  2JXM B;  5JPM C;  2K7V A;  2MGS A;  2C9O A;  2QCP X;  3X3M A;  5LHY 1;  3MXN A;  4ABN A;  4DXG A;  4HCS A;  4HSV A;  1SYD A;  2X69 A;  5KYL A;  1PYW D;  1JC7 A;  2E2D C;  2RSN A;  2M00 A;  2KEC A;  2PW5 A;  2F0O A;  3H3V C;  2E74 C;  4IUP A;  1QE6 A;  3ZYY X;  4KN7 C;  1PTO B;  4L6T B;  1ENC A;  1I4Q A;  4L8J A;  1A3T A;  2WB1 B;  4IQZ A;  4X3U A;  4G57 A;  4HMJ A;  3T56 B;  1V1P B;  4RGN A;  1EY9 A;  4LMQ D;  1EYC A;  1XTC D;  2L11 A;  4BS9 A;  2FMC A;  4EVO A;  2EY6 A;  2F03 A;  3C1E A;  3KUP A;  2F0L A;  1T5E A;  4DK0 A;  2EJM A;  3HP3 A;  3S2D B;  3V05 A;  4IUU A;  2EYF A;  4QUC A;  2J7Z A;  1H9S A;  3KLS A;  2EY5 A;  5IGG A;  2NTT A;  5HUR A;  3K7A B;  1GUS A;  1EQV A;  3CKI B;  3TSS A;  2K01 A;  4G7H C;  1E2W A;  3U9O A;  2QEJ C;  1F2L A;  4F88 A;  3RLF A;  1G29 1;  1U4P A;  4KTA A;  2L9H A;  3OSO A;  3CQZ B;  1TWG B;  3U9S A;  3E6Z X;  4Q5V A;  4CJ0 B;  2B2U C;  2M9V A;  1LAB A;  3I8Z A;  1Y8P B;  5JAV A;  2L0C A;  2WAC A;  4UAI A;  2SDF A;  2B39 A;  1F2Y A;  3LNN A;  4C3J G;  1AW7 A;  1MD2 D;  3NQI A;  3HS0 C;  1BCP C;  1O7Z A;  5K5P A;  3J7A V;  1F9Q A;  5CV5 A;  2IT1 A;  2PNR C;  1Z6H A;  5KRU A;  1VDZ A;  1ROD A;  3K59 A;  2EY2 A;  5JVG 3;  1EL0 A;  2ZXO A;  2A73 B;  3K0Y A;  1SNM A;  5KIX A;  5KND A;  1OXT A;  3W2D A;  1HQM C;  3A7L A;  4BWG B;  3NTH A;  3QIA A;  1PFM A;  3T16 A;  4Q0F A;  1IKM A;  3R8B A;  4A3D B;  5E4W C;  4LAA A;  3QG1 A;  2EJG C;  1LT4 D;  4ZKC B;  2F1M A;  1EIH A;  2I46 A;  1FNV A;  2RBM A;  2CW0 C;  1X32 A;  1GOZ A;  3GV3 A;  1EYD A;  2B2V A;  2F0V A;  5D65 A;  3M4O B;  3OMC A;  3MTS A;  1PFB A;  1ESR A;  2E75 C;  1LTB D;  1WTO A;  4QUF A;  3ERQ A;  5I6W A;  3EA6 A;  3EJI A;  4HAE A;  4ZRZ A;  5I6Y A;  4DK1 A;  1D5M C;  2NZ1 D;  1DD2 A;  4WOR A;  2B2W A;  2FFK B;  1C48 A;  1JOQ A;  1A3U A;  2K5D A;  3HOW B;  5M3F B;  4OIJ A;  1U4M A;  1ML0 D;  4FXD A;  3T51 B;  1ZYR C;  3GTK B;  4E6I A;  1WTR A;  3K5O A;  1TWA B;  3K5M A;  4BBS B;  2F0K A;  4K6D A;  3HOV B;  2JA7 B;  2RSO A;  2BE5 C;  4LK1 C;  3PIO 3;  2R61 A;  4KJN A;  3SK5 A;  2RKS A;  4KY7 A;  1OO9 B;  1YNN D;  1O78 A;  4PMW A;  3MXU A;  5FO7 B;  3PUW A;  5CYU A;  5DAU A;  4CHT B;  1D5X C;  1LT5 D;  4M8A A;  1LT3 D;  4XQN A;  1JOR A;  1B9N A;  2AUJ D;  3J80 L;  1ENF A;  2I07 B;  5EJW A;  1K8O A;  2JP1 A;  5NUC A;  3Q24 A;  3A56 A;  2K5W A;  2BA1 A;  3OW7 A;  2XVS A;  2Y0S B;  4RKL A;  2F3V A;  2VNU D;  2NVX B;  2NYZ D;  4R8N A;  5C0X J;  1PMR A;  2NVY B;  3TZU A;  1PLF A;  5EPL A;  5EBC A;  4KI0 A;  2E2J B;  2E2I B;  1NSN S;  1BF4 A;  2LY7 A;  1LTT D;  1Z47 A;  5CV6 A;  2BDN A;  1UUP A;  1Y1W B;  2EY1 A;  3DWQ A;  5IGD A;  2A74 C;  4FNF A;  1TVX A;  2L4N A;  5FLX E;  2D9U A;  4IFD H;  5JPN C;  2RDF A;  1RKN A;  2OT2 A;  1M8A A;  3R93 A;  2J0T D;  3IFD A;  3A8K E;  2PQE A;  5I2Y A;  4EGV A;  4WJW A;  2SEB D;  5CV4 A;  5COY A;  2O4X A;  1Q90 A;  3GD7 A;  2PMZ B;  3WDN A;  5C4J B;  1WTW A;  4RFB A;  5IGF A;  1QG7 A;  4J1M A;  3N6R A;  2F0D A;  1B3A A;  4RHR A;  4K5X A;  4ZAI A;  1DOM A;  1KDA A;  3OPO A;  2LMC B;  2XN9 C;  4C1N K;  1WVL A;  2K32 A;  1TR5 A;  2WIN B;  3TN2 A;  4IFD I;  4XQQ A;  5ELE A;  3UI2 A;  4DAY A;  2JSO A;  1IL8 A;  3S1N B;  3URY A;  1F9P A;  2L5T A;  3I3C A;  3NBH A;  2EZV A;  1A2T A;  1J8I A;  4Z9C B;  1EY7 A;  3CU7 A;  2B2Y C;  2F0T A;  4BA2 I;  3W3A A;  4X3K A;  1HA5 A;  2N88 A;  2R92 B;  1Y69 U;  5IIF A;  1AZP A;  2A6E C;  1B1Z A;  3M7N A;  3H94 A;  1PFN A;  2AQ1 B;  5ELD A;  1CT1 D;  5CGK A;  1CZG A;  3X3N A;  1HA6 A;  1IHZ A;  3NQT A;  2Z4I A;  3SHL A;  3ND8 A;  3QOL A;  4TQU S;  3DHQ A;  1SFO B;  1GUG A;  5EKI A;  3H6M A;  3V96 A;  3IFT A;  2B63 B;  3EVQ A;  4K2L A;  1FNU A;  1Y8O B;  4WFN 3;  2RVL A;  4N9P A;  2B2T C;  3NE5 B;  4QMG A;  2KED A;  2MJ8 A;  1AN8 A;  3BZD B;  4K14 A;  4C56 C;  3I70 A;  3HEJ A;  2Q8T A;  1BO0 A;  1C4Q A;  4EQO A;  1L0X B;  2EVB A;  2KOL A;  2AUK A;  3BDL A;  4V0B A;  2B2U A;  5EKK A;  2R7Z B;  3D6C A;  1STH A;  4H13 C;  1STB A;  2YU9 B;  4KY6 A;  3MXG A;  2KCN A;  1NAP A;  1DXM A;  1F9S A;  5A35 A;  3NUC A;  1SE4 A;  3P7J A;  1BR9 A;  1RTO A;  1B53 A;  1FNW A;  1S5C D;  5C4H A;  4KK7 A;  3MEH A;  4FF1 A;  2FIN B;  5CR3 A;  4K8I A;  3K5L A;  3SR1 A;  5E3F A;  1OXU A;  4M1U B;  1EFI D;  2EXZ A;  3VR4 A;  1B2T A;  3MWY W;  3ITP A;  3ND9 A;  1HTP A;  4XQJ A;  2IL8 A;  4ZKB B;  2RQX A;  5I9O A;  4PV1 C;  2HCI A;  2G9D A;  1KLU D;  1BNZ A;  1PZJ D;  4LJZ C;  1JB3 A;  2BOS A;  4KKS A;  1HHV A;  3NPP A;  3DMU A;  1WCM B;  1TY0 A;  1Z7T A;  3FDT A;  2HDM A;  3S1R B;  1G2S A;  5C5L A;  3FMC A;  1S4Z A;  2KCC A;  1BUV T;  1HXY D;  1IW7 C;  1HCZ A;  3WOF A;  1YNJ D;  4QCL A;  1DOL A;  1DZ1 A;  1BBX C;  1PTO C;  5E4X A;  1X3Q A;  1MGS A;  3GQB A;  1QCB D;  1LTI D;  3D8G A;  4NKL A;  4TSS A;  1GXD C;  1EZ8 A;  1SEB D;  5IOC A;  2O2L D;  2CHB D;  4DFA A;  2F0M A;  2WP8 J;  3I72 A;  1RDP D;  4BA1 I;  5FK9 C;  4IN3 A;  2YYZ A;  5E1F A;  2F0G A;  5IOD A;  4OGQ C;  3NK9 A;  2K5Q A;  1TII D;  2IX0 A;  1XXG A;  1T5X D;  4ZUI A;  3NTI A;  1FGB D;  2BDO A;  2WII B;  4C3J B;  2QIL A;  3BVZ A;  1Q12 A;  3PUY A;  4RA8 A;  1LV9 A;  2B8F A;  1MSG A;  1WTQ A;  1DOK A;  1GUN A;  1KDB A;  3D6W A;  1R9T B;  1EWC A;  5ELF A;  5KYI A;  4RWS C;  1WTP A;  3I73 A;  3HOY B;  1JOO A;  2XSC A;  2AWN A;  4OO1 H;  4N9T A;  1CQF A;  4FF2 A;  2MP1 A;  2K28 A;  2A68 D;  2EYO A;  3OWF A;  5C0X G;  1MBY A;  3O13 A;  4KY5 A;  2DNC A;  3HZX A;  1EEI D;  4KMU C;  3GTQ B;  1U4R A;  1Q8I A;  4KN4 C;  1W6K A;  1WTV A;  2PZT A;  2QKI C;  4A3B B;  1QJO A;  1S5D D;  1VF7 A;  2F0E A;  4OO1 I;  4WRD A;  1Y8N B;  1RTN A;  3D4W A;  4B9X A;  4IFD G;  5M5Y B;  5A2Q E;  5BN4 A;  3P20 A;  4I7Z C;  5CV7 A;  2K33 A;  2C5C A;  1ET9 A;  2JEB I;  3H0G B;  1KNA A;  1D5Z C;  4BY7 B;  4IUR A;  4DA2 A;  4IUV A;  1RD9 D;  3FRP B;  2Q8I B;  4CKC A;  1IYV A;  2MUY A;  4OHJ A;  4JBW A;  1IYU A;  3C46 A;  4ZUJ A;  1GUT A;  2E2H B;  1FR3 A;  3E5S A;  2F4I A;  3DXJ C;  3RZO B;  1G8Z D;  4JK1 C;  1EZ6 A;  3PIP 3;  4A3K B;  1NR2 A;  3A7A B;  2NUC A;  2JA8 B;  2AWO A;  2VXW A;  1FD7 D;  2F0F A;  1PRT F;  1LTA D;  3OMG A;  2FJ2 A;  3DWA A;  1JE4 A;  2B2Y A;  3HRZ C;  5KGU A;  4A3I B;  3NWT A;  2MPM A;  3K57 A;  3GTL B;  3MFG A;  3PO2 B;  3C2P A;  3OOC A;  4GZY C;  2R3Z A;  3SDZ A;  1F2M A;  3HOU B;  3M7G A;  4YIJ A;  3S1Q B;  4ME5 A;  4MN3 A;  2F0W A;  2WAQ B;  4J6H A;  3OIQ A;  2JA6 B;  1I4X A;  3OIP A;  1I4G A;  3L3O C;  4IUQ A;  3HKZ B;  1H9J A;  4BY1 B;  1LTS D;  5JVH 3;  5BN5 A;  3TDQ A;  1F77 A;  3JAM E;  2B2T A;  4K5V A;  4RGT A;  3EQL C;  2X6L A;  3H91 A;  2IJ0 A;  1SNO A;  5IT9 E;  2EE1 A;  1X3P A;  4A3G B;  4RKB A;  4V19 0;  4U67 3;  2VUM B;  1K8M A;  1TKW B;  1UEA B;  1S5E D;  1Q1E A;  3NBI A;  1EWH A;  3BDC A;  3MVV A;  1I6V C;  5IGE A;  2Z8L A;  4C3I G;  1SYB A;  3T53 B;  3VA5 A;  4FYD A;  1STN A;  1BCP D;  2LKV A;  1TU2 B;  2NWG A;  1TS2 A;  5KEE A;  1RCV D;  5C0X H;  4IUT A;  1JCK B;  4CBV A;  4I65 A;  1SNC A;  3BYT B;  4KV6 A;  5CV8 A;  3J81 E;  1XX8 A;  3KLR A;  3VYU A;  1KNE A;  1ICW A;  5C6A A;  2NVQ B;  1SSO A;  5CBE E;  4XT1 B;  4PMC A;  5C3E B;  2KQ3 A;  2F3W A;  2H1E A;  5CV9 A;  3A54 A;  2N55 A;  1TS5 A;  1STY A;  2DY7 A;  2DN8 A;  2HUG A;  2F0S A;  1QIL A;  3D4D A;  1SJH D;  3GP7 A;  4R8I A;  1C8C A;  1QWY A;  2L1B A;  1WD1 A;  5C0X I;  1DYQ A;  3IL8 A;  5FKA C;  5EPK A;  1CTM A;  3DEP A;  1PZK D;  1LTG D;  1HFG A;  1KAA A;  3Q22 A;  2IPK D;  4RCN A;  4C2M B;  2A6H C;  1DON A;  3S1M B;  1LT6 D;  2PO4 A;  2KUM A;  3MXP A;  2ICI A;  3RD4 A;  3N52 A;  4TKO B;  2WKD A;  1B44 D;  3MHB A;  1Q3L A;  2EYL A;  4A3E B;  3NP8 A;  1HTL D;  4BBR B;  3GTJ B;  3VYR A;  1TS3 A;  2OXP A;  5ELC A;  1SYF A;  1V1P A;  4DNR B;  4DAV A;  5T1G A;  2LS0 1;  2A69 D;  1G2T A;  4G7O C;  4A3J B;  1TWF B;  2M2L A;  4O1N A;  4O42 A;  1ZYR D;  1GHJ A;  3VR6 A;  1ILP A;  4CKB A;  2PCF B;  3SEB A;  1SDF A;  1L0Y B;  4DNT B;  4FXK C;  3PUV A;  1QB5 D;  1LLR D;  3BYY B;  2F0J A;  2VB3 X;  2F0I A;  5I4D A;  3FPP A;  3HG9 A;  1SXT A;  4R9W A;  2AQ2 B;  1ESF A;  1I4P A;  2BE5 D;  2AQ3 B;  3BG3 A;  4XYO A;  2TMP A;  1SNQ A;  3MFY A;  1LO5 D;  4C3H G;  5DM7 3;  1WD0 A;  3MC0 B;  2ENB A;  1GUW A;  3SK6 A;  2Z4H A;  2OF1 A;  1K83 B;  4OO1 G;  1JWM D;  3P75 A;  3HOX B;  4QF4 A;  1ZXT A;  4L63 B;  4DXF A;  3TME A;  1RF2 D;  1O7L A;  2J4X A;  1SE2 A;  5IGC A;  2NVT B;  2F0H A;  4H44 C;  1HUN A;  2KA7 A;  4S3S A;  2ID0 A;  4KKU A;  2R93 B;  2WKC A;  4ULL A;  4XIG S;  5JOB A;  4MIU A;  4EQN A;  1G6Z A;  3BS1 A;  3L7Z C;  1TT2 A;  4PMB A;  1EEF D;  3Q6S A;  3CRL C;  2QDB A;  5M3M B;  1HFN A;  1OXX K;  4ODG A;  1II3 A;  4FP5 D;  4HED A;  2ZT9 C;  2KHS A;  2JEA I;  4FO2 A;  2RDH A;  1TQO A;  1I4H A;  4F8M A;  4CJ2 C;  4A3M B;  3NWS A;  2IW3 A;  1DJR D;  1F2Z A;  2FHT A;  4F87 A;  3PUZ A;  1CFM A;  3A8J E;  1PRT D;  3S2H B;  3FVQ A;  3S15 B;  4HN7 A;  3ERO A;  2HQE A;  4OL7 A;  1E0B A;  1SYE A;  4A93 B;  4NW2 A;  1H9M A;  3D4R A;  2SNS A;  1BCP F;  1G91 A;  4RHS A;  1CI3 M;  1CK1 A;  1AEX A;  1EY4 A;  3Q23 A;  2ICE C;  1CA6 A;  1HRJ A;  5F2D A;  5JEA J;  2GA4 B;  1OXS C;  5C4X B;  1OXV A;  3RZD B;  1TWH B;  2A6E D;  3PV0 A;  2O5I C;  5C44 B;  3DUZ A;  1D2B A;  2KEE A;  2NTS A;  3D3R A;  5M5X B;  3J7Y W;  5G3L F;  1AZQ A;  3DWP A;  3AU7 A;  2BCO A;  2JYO A;  5DNF A;  3F2U A;  2EYJ A;  2ZXR A;  1Q1B A;  3A55 A;  5D3D A;  3DM1 A;  3PMF A;  3IKJ A;  4KD3 A;  1STG A;  1E2V A;  2PZW A;  4H0L C;  1UAP A;  1Y1V B;  1CQV A;  1BXT A;  1EOT A;  3VYT A;  2HCC A;  2KJX A;  4G7Z C;  1GUO A;  1UNS A;  3OHX C;  2TSS A;  4KD4 A;  5FOB B;  3PUX A;  1U4L A;  4ZK9 B;  3J80 E;  5I2X A;  3M3Y B;  2PYK A;  3K5N A;  1CM9 A;  2NN6 H;  4ZLT F;  1B4O A;  3G6J B;  1EYA A;  1EIG A;  3NSW A;  4PNY A;  3SVM A;  1I3Q B;  4ZQ3 A;  1PZI D;  4KHZ A;  1CHQ D;  1SBB B;  3I4M B;  3Q0A A;  3AMU A;  2K03 A;  4HR7 B;  4HCE A;  1SMY D;  5C5M A;  3PO3 B;  1B50 A;  1SNP A;  2XWJ B;  1XWE A;  3FKI B;  1YNN C;  1PXU A;  3L9A X;  5KNC A;  2NN6 I;  2A5H A;  4X3T A;  5D14 A;  3J7A F;  4K2K A;  2EPB A;  5K36 G;  3G7L A;  1MI2 A;  3VR5 A;  1KLG D;  3T4A C;  3GV6 A;  5CC4 A;  1VF5 C;  2JE6 I;  3H09 A;  1BCP B;  1ET6 A;  2CVR A;  1IW7 D;  5ISR A;  2K05 A;  1SAP A;  3SXH A;  3QB3 A;  3GTO B;  1VMP A;  1QNU A;  1PTO D;  2EDG A;  3EFX D;  2IX1 A;  1I4R A;  3BDO A;  4XTC S;  3VA7 A;  1U9R A;  3C1F A;  3LWE A;  3RUZ A;  1EY0 A;  4UDU C;  2EJF C;  1O80 A;  3A8I E;  2Q8R E;  3TP6 A;  3KBX A;  3D31 A;  1JWU D;  1ZKO A;  5CBA E;  3MA2 B;  1HQR D;  2E76 C;  2F0N A;  3I4N B;  3TP7 A;  3V2T A;  3R3O A;  2NB0 A;  1GJX A;  1F9R A;  1JOK A;  1LTR D;  3TP8 A;  4DF7 A;  1HPC A;  4C3I B;  3MZ5 A;  2EYM A;  1O7Y A;  2K1B A;  1ONL A;  3QO2 A;  1V43 A;  4XT3 B;  3QJY A;  4Y7N B;  5ELB A;  1A6X A;  3VR2 A;  4RH6 A;  1D6E C;  3KF8 A;  4P2C B;  3SE0 A;  1DCZ A;  1VCI A;  2RDG A;  2VB2 X;  5LL6 S;  1QNK A;  1EY6 A;  1NCV A;  2IWH A;  5AFW A;  1SND A;  2A69 C;  1A15 A;  3QOJ A;  1CZW A;  3KK7 A;  5C4Z A;  2FMM A;  1QOH A;  2SNM A;  2XRQ D;  5BN3 A;  5EPJ A;  1D1I A;  1W6J A;  3I4L A;  4DAP A;  4XYQ A;  4H7B A;  4HSP A;  4FVM A;  4DN4 M;  4PQX A;  2XWB B;  2B8G A;  2PW7 A;  2SOB A;  4CGY B;  4HTH A;  4B9W A;  4XDX A;  1M4V A;  3VYS A;  4K8J A;  5M5W B;  3R2I A;  5D3I B;  2EOT A;  2D5D A;  4RCO A;  2ZXP A;  4X3S A;  4F7X A;  3P1H A;  5M9O A;  1XYI A;  4NP5 A;  3GO5 A;  1IKL A;  1H9S B;  2PPB C;  3OWE B;  1NUC A;  3HGB A;  3BVG A;  4K5W A;  4EQP A;  1V1O A;  1EU3 A;  1PTO H;  4ID6 A;  2JA5 B;  1KTK A;  3WOE A;  4FF4 A;  5DEH A;  3CRK C;  3TP5 A;  4OIK A;  3AB9 A;  2K04 A;  4IAL A;  2CW0 D;  1EY5 A;  2K6A A;  1TY2 A;  1ZEQ X;  5G3L D;  2L12 A;  3GTP B;  4DU9 A;  5K36 H;  2PZU A;  5JEA G;  1RHP A;  4A3F B;  3TZD A;  1D1K A;  1TS4 A;  2F0P A;  4AYB B;  1WTX A;  2D62 A;  1A3V A;  3NTK A;  3HOZ B;  2MHV A;  1A2U A;  3MAQ A;  2F0U A;  4C3H B;  5FO8 B;  3S9W A;  4IFD J;  1PRT C;  5A2Q L;  2OEO A;  1DM0 B;  3GTG B;  1SJE D;  2L55 A;  3KBG A;  4TRD A;  1V8Q A;  2EYP A;  1SYC A;  1I6H B;  3LWU A;  1JQY D;  2G9H D;  1ILQ A;  1SYG A;  3FEW X;  1PRT B;  5KNB A;  5JJZ A;  4DGZ A;  1FYC A;  2XNA C;  5EQ0 A;  1AFP A;  3SK4 A;  4IZ8 A;  4FXG C;  4CKE A;  2EYH A;  1S5B D;  3M4Y A;  5LL6 X;  4C1N I;  3K58 A;  1KAB A;  4KJO A;  2O5J C;  4ZYS A;  2B2V C;  4RAU C;  4XXE A;  1CA5 A;  3M85 A;  3RMH A;  4QIW B;  1YNJ C;  1PTO F;  2LFN A;  4B08 A;  1NR4 A;  3ONA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...