2KEIA

Refined solution structure of a dimer of lac repressor dna-binding domain complexed to its natural operator o1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
62
structure length
62
Chain Sequence
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity and affinity of Lac repressor for the auxiliary operators O2 and O3 are explained by the structures of their protein-DNA complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords Lactose operon repressor
total genus 17
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2keiA00
3JXDL 3ZHMA 1LCDA 3OQOA 2LYSA 1POUA 3MLFA 3R1FA 4GQMA 1UXCA 4FN3A 3U3WA 2ICTA 1S7EA 4X4HA 2IVQA 3SCGA 1CQTA 1RZRD 4Z5CA 1E3OC 3BD1A 3GN5B 4PU3C 4X4BA 2BJCA 2OR1L 3H5TA 2B5AA 3FYMA 3CECA 1QQAA 1ZVVA 1ZZ7A 1ZUGA 3OQMA 1OCTC 2LYQA 2PUFA 2XI8A 1RZRA 4IA8A 2A6CA 3UFDA 2KZ8A 1DW9A 1DWKA 2KPJA 2MQKA 1ZZBA 4I6UA 4IVZA 3L1PA 2CSFA 4OB4A 3OMTA 3FMYA 2O4AA 4NDWA 2MEZA 1Y9QA 2EWTA 2HINA 4GHJA 4FBIA 3S8QA 2WIUB 1R63A 2GRLA 3PXPA 2LCVA 1JFTA 2FJRA 2PUGA 2EF8A 1XWRA 2AUWA 2BNNA 4Y42A 1RPEL 3ZKCA 1IC8A 2KEKA 1EFAA 1UXDA 4I8TA 1BDIA 1QP0A 1B0NA 2KEIA 1RIOA 2GZUA 4JCYA 2XIUA 4Z58A 1ZAYA 4YG1A 4YBAA 4JCXA 3QF3A 4J1WA 3BDNA 4Z5DA 3ZHIA 3O9XA 2BNMA 2LYLA 3VK0A 1LMB3 4F8DA 1O4XA 3FYAA 3RZZA 3TRBA 2KEJA 1LQCA 1OSLA 2LYKA 2PPXA 3KZ3A 4MCXA 4YG7B 1ZS4A 2O49A 3D1NI 3GBFA 1NEQA 4YARA 4YG4A 2PE5A 1HF0A 2R63A 3G7DA 4IWRA 1ADRA 4MCTA 2HSGA 1UTXA 2AW6A 1RZSA 2IV1A 3B7HA 4I6TA 5K98B 1JFSA 1PRUA 4PU7A 3QQ6A 2BNOA 1QQBA 1QP7A 2WUSR 5A7LA 1CJGA 1LCCA 1PRVA 2JCGA 2IU7A 2L49A 3OQNA 3KJXA 2IVBA 3OP9A 1JH9A 1ZZ6A 2CROA 1X2LA 2IVGA 2LYPA 3F6WA 1Y7YA 4PU8A 1VPWA 3SCHA 2L8NA 1ZPQA 3F51A 1PERL 3QWGA 2XSDC 2EBYA 1ZZCA 3EUSA 4X4GA 1BDHA 2D5VA 2PUCA 1AU7A 2LYJA 2JVLA 4O8BA 3KXAA 1R69A 3LISA 2PUAA 2AXUA 1QP4A 1WIZA 4X4EA 2AXZA 2OFYA 3SCFA 4X4IA 3CLCA 2GRMA 2PIJA 3F52A 1YSEA 4Z59A 1LLIA 3CROL 3IVPA 4JQDA 2ICPA 1NERA 3LFPA 1L1MA 1WH8A 3JXBC 2PUDA 1WETA 4X4DA 1ZZ9A 1GT0C 2XJ3A 1SQ8A 4J1XA 1ZZ8A 1WH6A 2R1JL 3GN5A 3JXCL 4Z5HA 3G5GA 1PRAA 2LYRA 4I6RA 4X4CA 3HZIB 3DNVB 2AWIA 4PU4C 1JWLA 2H8RA 2PUBA 1QPZA 2O38A 3BS3A 3QYXA 2AXVA 2PUEA 2IUOA 1X57A 1PNRA 4X4FA 2XCJA
chains in the Genus database with same CATH superfamily
3OKZA 4EK9A 1POUA 3UWPA 2PXQA 1UXCA 4Q2JA 2IVQA 4Z5CA 2V3CC 1E3OC 3BD1A 3GZDA 2B5AA 1ZZ7A 3OQMA 5DRYA 2CSFA 4OB4A 3OMTA 4NDWA 4DE8A 2EF8A 1XWRA 1RPEL 2PXTA 1EFAA 1UXDA 4I8TA 2KEIA 4DE9A 2GZUA 3OWQA 4JCXA 4YG1A 3SR4A 4J1WA 3RZZA 1LQCA 3KZ3A 3GBFA 4YARA 2PE5A 1HF0A 2R63A 3G7DA 2HSGA 1UTXA 2AW6A 2HCSA 3ZPXA 1PRUA 4PU7A 5A7LA 1CJGA 1LCCA 1PRVA 2XXPA 3KJXA 2IVBA 1JH9A 1ZZ6A 2IVGA 1VPWA 5DTQA 1ZPQA 3QWGA 5DTRA 3EUSA 1AU7A 4O8BA 3KXAA 4X4EA 1MFQC 2GRMA 4JQDA 2ICPA 2PXPA 3JXBC 1QB2A 2XJ3A 1ZZ8A 1WH6A 2R1JL 3GN5A 2HFZA 2AWIA 5DSXA 4PU4C 3QFIA 4WVLA 2J7UA 2PUEA 2IUOA 4X4FA 4OBMA 3ZHMA 3QOWA 4FN3A 1S7EA 4X4HA 2MXDA 1RZRD 3GN5B 2LLWA 4ER6A 3H5TA 3FYMA 1QQAA 2LLVA 4IA8A 3GZCA 1DW9A 1DWKA 1ZZBA 4IVZA 3L1PA 3FMYA 1Y9QA 2EWTA 2HINA 4FBIA 3PXPA 3GUUA 2BNNA 4Y42A 3ZKCA 2M4HA 1BDIA 1B0NA 4JCYA 1RIOA 2XIUA 1ZAYA 3BDNA 3O9XA 2BNMA 2LYLA 4F8DA 3TEPA 3FYAA 1ZS4A 4MCXA 3LQXA 2O49A 5DTMA 4YG4A 4ER5A 4MCTA 2IV1A 3B7HA 1U2ZA 3NZLA 3M9LA 3QQ6A 2WUSR 2JCGA 2L49A 1X2LA 3A9XA 1ZZCA 1BDHA 2PUAA 1QP4A 2AXZA 2PXDA 3CLCA 2PIJA 2PXUA 3CROL 3LFPA 3TELA 2PXFA 1WH8A 2PXBA 1ZZ9A 1GT0C 4EKGA 4Z5HA 3JXCL 1PRAA 3HZIB 1JWLA 2O38A 3BS3A 2AXVA 1PNRA 2XCJA 2JQEA 3DM5A 2YBDA 3KL4A 3U3WA 2ICTA 5DT2A 1CQTA 4X4BA 2BJCA 3CECA 1ZVVA 2LNMA 1ZUGA 3PE5A 2XI8A 5DRTA 4I6UA 2PUBA 2O4AA 4GHJA 3MEJA 2GRLA 2PXLA 2LCVA 1JFTA 2FJRA 3TFLA 4Z5DA 1LMB3 3TRBA 1OSLA 2PPXA 4YG7B 3D1NI 1NEQA 4IWRA 1ADRA 5K98B 3ME5A 4HRAA 3A9ZA 2IU7A 3OQNA 3OP9A 3A9YA 2CROA 2LYPA 1Y7YA 5GAGi 2L8NA 3F51A 3NROA 2EBYA 2PUCA 1R69A 3SCFA 4X4IA 3GZDC 3F52A 1YSEA 2HCNA 1HQ1A 2XXAA 3IVPA 1L1MA 2PUDA 1WETA 3G5GA 2LYRA 4I6RA 4X4CA 2VEOA 4ER0A 1NW3A 1QPZA 3QYXA 3JXDL 1LCDA 3OQOA 2LYSA 3MLFA 3R1FA 4GQMA 3SCGA 4EQZA 4PU3C 2OR1L 1DULA 2ODRD 1OCTC 2LYQA 2PUFA 1RZRA 2PXEA 3R09A 2A6CA 3UFDA 2KZ8A 2KPJA 2MQKA 2PXVA 2MEZA 3S8QA 3NXHA 2WIUB 1R63A 2XXQA 2PUGA 2AUWA 4EZIA 1IC8A 2KEKA 5GAHi 1QP0A 4Z58A 4YBAA 1QZXA 3QF3A 3ZHIA 3VK0A 3G0TA 1O4XA 2KEJA 2LYKA 5JUWA 1RZSA 4I6TA 1JFSA 2BNOA 1QQBA 1QP7A 4EKIA 3F6WA 4PU8A 3SX0A 3SCHA 1PERL 2XSDC 4X4GA 2D5VA 2LYJA 2JVLA 3LISA 2AXUA 1WIZA 2OFYA 1LLIA 4Z59A 1NERA 2PXKA 4X4DA 4ER3A 3NDBB 2J7WA 1SQ8A 4J1XA 3DNVB 2H8RA 2L1PA 2FFHA 3VWSA 3QOXA 1X57A 4ER7A
chains in the Genus database with same CATH topology
3JXDL 3ZHMA 1LCDA 3OQOA 2LYSA 1POUA 3MLFA 3R1FA 4GQMA 1UXCA 4FN3A 3U3WA 2ICTA 1S7EA 4X4HA 2IVQA 3SCGA 1CQTA 1RZRD 4Z5CA 1E3OC 3BD1A 3GN5B 4PU3C 4X4BA 2BJCA 2OR1L 3H5TA 2B5AA 3FYMA 3CECA 1QQAA 1ZVVA 1ZZ7A 1ZUGA 3OQMA 1OCTC 2LYQA 2PUFA 2XI8A 1RZRA 4IA8A 2A6CA 3UFDA 2KZ8A 1DW9A 1DWKA 2KPJA 2MQKA 1ZZBA 4I6UA 4IVZA 3L1PA 2CSFA 4OB4A 3OMTA 3FMYA 2O4AA 4NDWA 2MEZA 1Y9QA 2EWTA 2HINA 4GHJA 4FBIA 3S8QA 2WIUB 1R63A 2GRLA 3PXPA 2LCVA 1JFTA 2FJRA 2PUGA 2EF8A 1XWRA 2AUWA 2BNNA 4Y42A 1RPEL 3ZKCA 1IC8A 2KEKA 1EFAA 1UXDA 4I8TA 1BDIA 1QP0A 1B0NA 2KEIA 1RIOA 2GZUA 4JCYA 2XIUA 4Z58A 1ZAYA 4YG1A 4YBAA 4JCXA 3QF3A 4J1WA 3BDNA 4Z5DA 3ZHIA 3O9XA 2BNMA 2LYLA 3VK0A 1LMB3 4F8DA 1O4XA 3FYAA 3RZZA 3TRBA 2KEJA 1LQCA 1OSLA 2LYKA 2PPXA 3KZ3A 4MCXA 4YG7B 1ZS4A 2O49A 3D1NI 3GBFA 1NEQA 4YARA 4YG4A 2PE5A 1HF0A 2R63A 3G7DA 4IWRA 1ADRA 4MCTA 2HSGA 1UTXA 2AW6A 1RZSA 2IV1A 3B7HA 4I6TA 5K98B 1JFSA 1PRUA 4PU7A 3QQ6A 2BNOA 1QQBA 1QP7A 2WUSR 5A7LA 1CJGA 1LCCA 1PRVA 2JCGA 2IU7A 2L49A 3OQNA 3KJXA 2IVBA 3OP9A 1JH9A 1ZZ6A 2CROA 1X2LA 2IVGA 2LYPA 3F6WA 1Y7YA 4PU8A 1VPWA 3SCHA 2L8NA 1ZPQA 3F51A 1PERL 3QWGA 2XSDC 2EBYA 1ZZCA 3EUSA 4X4GA 1BDHA 2D5VA 2PUCA 1AU7A 2LYJA 2JVLA 4O8BA 3KXAA 1R69A 3LISA 2PUAA 2AXUA 1QP4A 1WIZA 4X4EA 2AXZA 2OFYA 3SCFA 4X4IA 3CLCA 2GRMA 2PIJA 3F52A 1YSEA 4Z59A 1LLIA 3CROL 3IVPA 4JQDA 2ICPA 1NERA 3LFPA 1L1MA 1WH8A 3JXBC 2PUDA 1WETA 4X4DA 1ZZ9A 1GT0C 2XJ3A 1SQ8A 4J1XA 1ZZ8A 1WH6A 2R1JL 3GN5A 3JXCL 4Z5HA 3G5GA 1PRAA 2LYRA 4I6RA 4X4CA 3HZIB 3DNVB 2AWIA 4PU4C 1JWLA 2H8RA 2PUBA 1QPZA 2O38A 3BS3A 3QYXA 2AXVA 2PUEA 2IUOA 1X57A 1PNRA 4X4FA 2XCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXD L;  3ZHM A;  1LCD A;  3OQO A;  2LYS A;  1POU A;  3MLF A;  3R1F A;  4GQM A;  1UXC A;  4FN3 A;  3U3W A;  2ICT A;  1S7E A;  4X4H A;  2IVQ A;  3SCG A;  1CQT A;  1RZR D;  4Z5C A;  1E3O C;  3BD1 A;  3GN5 B;  4PU3 C;  4X4B A;  2BJC A;  2OR1 L;  3H5T A;  2B5A A;  3FYM A;  3CEC A;  1QQA A;  1ZVV A;  1ZZ7 A;  1ZUG A;  3OQM A;  1OCT C;  2LYQ A;  2PUF A;  2XI8 A;  1RZR A;  4IA8 A;  2A6C A;  3UFD A;  2KZ8 A;  1DW9 A;  1DWK A;  2KPJ A;  2MQK A;  1ZZB A;  4I6U A;  4IVZ A;  3L1P A;  2CSF A;  4OB4 A;  3OMT A;  3FMY A;  2O4A A;  4NDW A;  2MEZ A;  1Y9Q A;  2EWT A;  2HIN A;  4GHJ A;  4FBI A;  3S8Q A;  2WIU B;  1R63 A;  2GRL A;  3PXP A;  2LCV A;  1JFT A;  2FJR A;  2PUG A;  2EF8 A;  1XWR A;  2AUW A;  2BNN A;  4Y42 A;  1RPE L;  3ZKC A;  1IC8 A;  2KEK A;  1EFA A;  1UXD A;  4I8T A;  1BDI A;  1QP0 A;  1B0N A;  2KEI A;  1RIO A;  2GZU A;  4JCY A;  2XIU A;  4Z58 A;  1ZAY A;  4YG1 A;  4YBA A;  4JCX A;  3QF3 A;  4J1W A;  3BDN A;  4Z5D A;  3ZHI A;  3O9X A;  2BNM A;  2LYL A;  3VK0 A;  1LMB 3;  4F8D A;  1O4X A;  3FYA A;  3RZZ A;  3TRB A;  2KEJ A;  1LQC A;  1OSL A;  2LYK A;  2PPX A;  3KZ3 A;  4MCX A;  4YG7 B;  1ZS4 A;  2O49 A;  3D1N I;  3GBF A;  1NEQ A;  4YAR A;  4YG4 A;  2PE5 A;  1HF0 A;  2R63 A;  3G7D A;  4IWR A;  1ADR A;  4MCT A;  2HSG A;  1UTX A;  2AW6 A;  1RZS A;  2IV1 A;  3B7H A;  4I6T A;  5K98 B;  1JFS A;  1PRU A;  4PU7 A;  3QQ6 A;  2BNO A;  1QQB A;  1QP7 A;  2WUS R;  5A7L A;  1CJG A;  1LCC A;  1PRV A;  2JCG A;  2IU7 A;  2L49 A;  3OQN A;  3KJX A;  2IVB A;  3OP9 A;  1JH9 A;  1ZZ6 A;  2CRO A;  1X2L A;  2IVG A;  2LYP A;  3F6W A;  1Y7Y A;  4PU8 A;  1VPW A;  3SCH A;  2L8N A;  1ZPQ A;  3F51 A;  1PER L;  3QWG A;  2XSD C;  2EBY A;  1ZZC A;  3EUS A;  4X4G A;  1BDH A;  2D5V A;  2PUC A;  1AU7 A;  2LYJ A;  2JVL A;  4O8B A;  3KXA A;  1R69 A;  3LIS A;  2PUA A;  2AXU A;  1QP4 A;  1WIZ A;  4X4E A;  2AXZ A;  2OFY A;  3SCF A;  4X4I A;  3CLC A;  2GRM A;  2PIJ A;  3F52 A;  1YSE A;  4Z59 A;  1LLI A;  3CRO L;  3IVP A;  4JQD A;  2ICP A;  1NER A;  3LFP A;  1L1M A;  1WH8 A;  3JXB C;  2PUD A;  1WET A;  4X4D A;  1ZZ9 A;  1GT0 C;  2XJ3 A;  1SQ8 A;  4J1X A;  1ZZ8 A;  1WH6 A;  2R1J L;  3GN5 A;  3JXC L;  4Z5H A;  3G5G A;  1PRA A;  2LYR A;  4I6R A;  4X4C A;  3HZI B;  3DNV B;  2AWI A;  4PU4 C;  1JWL A;  2H8R A;  2PUB A;  1QPZ A;  2O38 A;  3BS3 A;  3QYX A;  2AXV A;  2PUE A;  2IUO A;  1X57 A;  1PNR A;  4X4F A;  2XCJ A; 
#chains in the Genus database with same CATH topology
 3OKZ A;  4EK9 A;  1POU A;  3UWP A;  2PXQ A;  1UXC A;  4Q2J A;  2IVQ A;  4Z5C A;  2V3C C;  1E3O C;  3BD1 A;  3GZD A;  2B5A A;  1ZZ7 A;  3OQM A;  5DRY A;  2CSF A;  4OB4 A;  3OMT A;  4NDW A;  4DE8 A;  2EF8 A;  1XWR A;  1RPE L;  2PXT A;  1EFA A;  1UXD A;  4I8T A;  2KEI A;  4DE9 A;  2GZU A;  3OWQ A;  4JCX A;  4YG1 A;  3SR4 A;  4J1W A;  3RZZ A;  1LQC A;  3KZ3 A;  3GBF A;  4YAR A;  2PE5 A;  1HF0 A;  2R63 A;  3G7D A;  2HSG A;  1UTX A;  2AW6 A;  2HCS A;  3ZPX A;  1PRU A;  4PU7 A;  5A7L A;  1CJG A;  1LCC A;  1PRV A;  2XXP A;  3KJX A;  2IVB A;  1JH9 A;  1ZZ6 A;  2IVG A;  1VPW A;  5DTQ A;  1ZPQ A;  3QWG A;  5DTR A;  3EUS A;  1AU7 A;  4O8B A;  3KXA A;  4X4E A;  1MFQ C;  2GRM A;  4JQD A;  2ICP A;  2PXP A;  3JXB C;  1QB2 A;  2XJ3 A;  1ZZ8 A;  1WH6 A;  2R1J L;  3GN5 A;  2HFZ A;  2AWI A;  5DSX A;  4PU4 C;  3QFI A;  4WVL A;  2J7U A;  2PUE A;  2IUO A;  4X4F A;  4OBM A;  3ZHM A;  3QOW A;  4FN3 A;  1S7E A;  4X4H A;  2MXD A;  1RZR D;  3GN5 B;  2LLW A;  4ER6 A;  3H5T A;  3FYM A;  1QQA A;  2LLV A;  4IA8 A;  3GZC A;  1DW9 A;  1DWK A;  1ZZB A;  4IVZ A;  3L1P A;  3FMY A;  1Y9Q A;  2EWT A;  2HIN A;  4FBI A;  3PXP A;  3GUU A;  2BNN A;  4Y42 A;  3ZKC A;  2M4H A;  1BDI A;  1B0N A;  4JCY A;  1RIO A;  2XIU A;  1ZAY A;  3BDN A;  3O9X A;  2BNM A;  2LYL A;  4F8D A;  3TEP A;  3FYA A;  1ZS4 A;  4MCX A;  3LQX A;  2O49 A;  5DTM A;  4YG4 A;  4ER5 A;  4MCT A;  2IV1 A;  3B7H A;  1U2Z A;  3NZL A;  3M9L A;  3QQ6 A;  2WUS R;  2JCG A;  2L49 A;  1X2L A;  3A9X A;  1ZZC A;  1BDH A;  2PUA A;  1QP4 A;  2AXZ A;  2PXD A;  3CLC A;  2PIJ A;  2PXU A;  3CRO L;  3LFP A;  3TEL A;  2PXF A;  1WH8 A;  2PXB A;  1ZZ9 A;  1GT0 C;  4EKG A;  4Z5H A;  3JXC L;  1PRA A;  3HZI B;  1JWL A;  2O38 A;  3BS3 A;  2AXV A;  1PNR A;  2XCJ A;  2JQE A;  3DM5 A;  2YBD A;  3KL4 A;  3U3W A;  2ICT A;  5DT2 A;  1CQT A;  4X4B A;  2BJC A;  3CEC A;  1ZVV A;  2LNM A;  1ZUG A;  3PE5 A;  2XI8 A;  5DRT A;  4I6U A;  2PUB A;  2O4A A;  4GHJ A;  3MEJ A;  2GRL A;  2PXL A;  2LCV A;  1JFT A;  2FJR A;  3TFL A;  4Z5D A;  1LMB 3;  3TRB A;  1OSL A;  2PPX A;  4YG7 B;  3D1N I;  1NEQ A;  4IWR A;  1ADR A;  5K98 B;  3ME5 A;  4HRA A;  3A9Z A;  2IU7 A;  3OQN A;  3OP9 A;  3A9Y A;  2CRO A;  2LYP A;  1Y7Y A;  5GAG i;  2L8N A;  3F51 A;  3NRO A;  2EBY A;  2PUC A;  1R69 A;  3SCF A;  4X4I A;  3GZD C;  3F52 A;  1YSE A;  2HCN A;  1HQ1 A;  2XXA A;  3IVP A;  1L1M A;  2PUD A;  1WET A;  3G5G A;  2LYR A;  4I6R A;  4X4C A;  2VEO A;  4ER0 A;  1NW3 A;  1QPZ A;  3QYX A;  3JXD L;  1LCD A;  3OQO A;  2LYS A;  3MLF A;  3R1F A;  4GQM A;  3SCG A;  4EQZ A;  4PU3 C;  2OR1 L;  1DUL A;  2ODR D;  1OCT C;  2LYQ A;  2PUF A;  1RZR A;  2PXE A;  3R09 A;  2A6C A;  3UFD A;  2KZ8 A;  2KPJ A;  2MQK A;  2PXV A;  2MEZ A;  3S8Q A;  3NXH A;  2WIU B;  1R63 A;  2XXQ A;  2PUG A;  2AUW A;  4EZI A;  1IC8 A;  2KEK A;  5GAH i;  1QP0 A;  4Z58 A;  4YBA A;  1QZX A;  3QF3 A;  3ZHI A;  3VK0 A;  3G0T A;  1O4X A;  2KEJ A;  2LYK A;  5JUW A;  1RZS A;  4I6T A;  1JFS A;  2BNO A;  1QQB A;  1QP7 A;  4EKI A;  3F6W A;  4PU8 A;  3SX0 A;  3SCH A;  1PER L;  2XSD C;  4X4G A;  2D5V A;  2LYJ A;  2JVL A;  3LIS A;  2AXU A;  1WIZ A;  2OFY A;  1LLI A;  4Z59 A;  1NER A;  2PXK A;  4X4D A;  4ER3 A;  3NDB B;  2J7W A;  1SQ8 A;  4J1X A;  3DNV B;  2H8R A;  2L1P A;  2FFH A;  3VWS A;  3QOX A;  1X57 A;  4ER7 A; 
#chains in the Genus database with same CATH homology
 3JXD L;  3ZHM A;  1LCD A;  3OQO A;  2LYS A;  1POU A;  3MLF A;  3R1F A;  4GQM A;  1UXC A;  4FN3 A;  3U3W A;  2ICT A;  1S7E A;  4X4H A;  2IVQ A;  3SCG A;  1CQT A;  1RZR D;  4Z5C A;  1E3O C;  3BD1 A;  3GN5 B;  4PU3 C;  4X4B A;  2BJC A;  2OR1 L;  3H5T A;  2B5A A;  3FYM A;  3CEC A;  1QQA A;  1ZVV A;  1ZZ7 A;  1ZUG A;  3OQM A;  1OCT C;  2LYQ A;  2PUF A;  2XI8 A;  1RZR A;  4IA8 A;  2A6C A;  3UFD A;  2KZ8 A;  1DW9 A;  1DWK A;  2KPJ A;  2MQK A;  1ZZB A;  4I6U A;  4IVZ A;  3L1P A;  2CSF A;  4OB4 A;  3OMT A;  3FMY A;  2O4A A;  4NDW A;  2MEZ A;  1Y9Q A;  2EWT A;  2HIN A;  4GHJ A;  4FBI A;  3S8Q A;  2WIU B;  1R63 A;  2GRL A;  3PXP A;  2LCV A;  1JFT A;  2FJR A;  2PUG A;  2EF8 A;  1XWR A;  2AUW A;  2BNN A;  4Y42 A;  1RPE L;  3ZKC A;  1IC8 A;  2KEK A;  1EFA A;  1UXD A;  4I8T A;  1BDI A;  1QP0 A;  1B0N A;  2KEI A;  1RIO A;  2GZU A;  4JCY A;  2XIU A;  4Z58 A;  1ZAY A;  4YG1 A;  4YBA A;  4JCX A;  3QF3 A;  4J1W A;  3BDN A;  4Z5D A;  3ZHI A;  3O9X A;  2BNM A;  2LYL A;  3VK0 A;  1LMB 3;  4F8D A;  1O4X A;  3FYA A;  3RZZ A;  3TRB A;  2KEJ A;  1LQC A;  1OSL A;  2LYK A;  2PPX A;  3KZ3 A;  4MCX A;  4YG7 B;  1ZS4 A;  2O49 A;  3D1N I;  3GBF A;  1NEQ A;  4YAR A;  4YG4 A;  2PE5 A;  1HF0 A;  2R63 A;  3G7D A;  4IWR A;  1ADR A;  4MCT A;  2HSG A;  1UTX A;  2AW6 A;  1RZS A;  2IV1 A;  3B7H A;  4I6T A;  5K98 B;  1JFS A;  1PRU A;  4PU7 A;  3QQ6 A;  2BNO A;  1QQB A;  1QP7 A;  2WUS R;  5A7L A;  1CJG A;  1LCC A;  1PRV A;  2JCG A;  2IU7 A;  2L49 A;  3OQN A;  3KJX A;  2IVB A;  3OP9 A;  1JH9 A;  1ZZ6 A;  2CRO A;  1X2L A;  2IVG A;  2LYP A;  3F6W A;  1Y7Y A;  4PU8 A;  1VPW A;  3SCH A;  2L8N A;  1ZPQ A;  3F51 A;  1PER L;  3QWG A;  2XSD C;  2EBY A;  1ZZC A;  3EUS A;  4X4G A;  1BDH A;  2D5V A;  2PUC A;  1AU7 A;  2LYJ A;  2JVL A;  4O8B A;  3KXA A;  1R69 A;  3LIS A;  2PUA A;  2AXU A;  1QP4 A;  1WIZ A;  4X4E A;  2AXZ A;  2OFY A;  3SCF A;  4X4I A;  3CLC A;  2GRM A;  2PIJ A;  3F52 A;  1YSE A;  4Z59 A;  1LLI A;  3CRO L;  3IVP A;  4JQD A;  2ICP A;  1NER A;  3LFP A;  1L1M A;  1WH8 A;  3JXB C;  2PUD A;  1WET A;  4X4D A;  1ZZ9 A;  1GT0 C;  2XJ3 A;  1SQ8 A;  4J1X A;  1ZZ8 A;  1WH6 A;  2R1J L;  3GN5 A;  3JXC L;  4Z5H A;  3G5G A;  1PRA A;  2LYR A;  4I6R A;  4X4C A;  3HZI B;  3DNV B;  2AWI A;  4PU4 C;  1JWL A;  2H8R A;  2PUB A;  1QPZ A;  2O38 A;  3BS3 A;  3QYX A;  2AXV A;  2PUE A;  2IUO A;  1X57 A;  1PNR A;  4X4F A;  2XCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...