2KEJA

Solution structure of a dimer of lac repressor dna-binding domain complexed to its natural operator o2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity and affinity of Lac repressor for the auxiliary operators O2 and O3 are explained by the structures of their protein-DNA complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords Lactose operon repressor
total genus 14
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2kejA00
1X2LA 2IVQA 3RZZA 1PRAA 2MQKA 1NEQA 2KEJA 2L49A 3CLCA 4X4HA 4X4BA 2LYSA 4YBAA 2IU7A 2HSGA 4FBIA 1JWLA 2WUSR 2GRMA 3EUSA 1ZZ6A 3F51A 1HF0A 1RPEL 1RZRA 1ADRA 1RZSA 4MCTA 4MCXA 4X4CA 3IVPA 1JH9A 1PRVA 1QP7A 1B0NA 2B5AA 4I6RA 3PXPA 3S8QA 1VPWA 2D5VA 3B7HA 2ICPA 1R63A 2FJRA 1Y7YA 2EWTA 4YG7B 2PUGA 1ZPQA 3G5GA 2PUEA 3OP9A 2OR1L 2BNMA 4PU8A 1RZRD 3GN5A 1JFTA 4PU3C 4YARA 3SCGA 3TRBA 4X4EA 1CJGA 2LYRA 2LYLA 2JVLA 1UTXA 4Z5DA 3R1FA 3QF3A 3FMYA 4PU4C 4Z59A 4YG1A 3OQMA 1OSLA 2CSFA 2XI8A 4J1XA 3O9XA 2R1JL 3ZKCA 1IC8A 2O4AA 1GT0C 4I6TA 2XSDC 1X57A 1ZS4A 4YG4A 2AUWA 4Z5HA 2WIUB 3LISA 2KEIA 3QWGA 3OQNA 3VK0A 2L8NA 2IV1A 3GBFA 1E3OC 4IVZA 2KEKA 4J1WA 2IUOA 2LYQA 3D1NI 3BD1A 3BDNA 4OB4A 5K98B 1WIZA 4X4GA 3CECA 4GHJA 4JCYA 1ZZBA 3OMTA 3QYXA 1QPZA 2IVGA 2H8RA 2PUAA 2PUDA 4PU7A 5A7LA 1WH6A 2XIUA 2EF8A 3ZHMA 3UFDA 2MEZA 3G7DA 1PNRA 4GQMA 1LLIA 4I8TA 2BNOA 2LCVA 4Z58A 4NDWA 4Z5CA 2XJ3A 1ZZCA 2LYPA 4IA8A 1CQTA 1ZZ7A 3JXDL 2BNNA 3BS3A 4O8BA 1QP0A 1UXCA 2AW6A 1WH8A 1SQ8A 3QQ6A 3SCHA 1L1MA 1EFAA 2XCJA 1JFSA 4X4FA 2KZ8A 1LMB3 1ZZ8A 4Y42A 1WETA 1UXDA 2A6CA 2ICTA 3F52A 2BJCA 1O4XA 1POUA 2LYJA 2AXZA 1ZVVA 2GZUA 2HINA 1BDHA 3U3WA 2AXUA 3LFPA 2PUFA 1S7EA 4FN3A 4JCXA 1QQBA 2AWIA 2PUCA 1LQCA 2AXVA 3L1PA 1LCCA 3JXCL 2KPJA 2JCGA 2IVBA 4X4IA 1AU7A 2LYKA 2PPXA 3FYAA 1OCTC 1LCDA 2R63A 1Y9QA 1PERL 3FYMA 1YSEA 4F8DA 1NERA 3SCFA 1QQAA 3CROL 3KZ3A 2PUBA 4JQDA 1R69A 3JXBC 3ZHIA 2PE5A 4IWRA 2OFYA 3KXAA 3MLFA 1ZUGA 1ZAYA 2GRLA 4X4DA 2CROA 1ZZ9A 1XWRA 2EBYA 1BDIA 3OQOA 1RIOA 2PIJA 3HZIB 3GN5B 4I6UA 3F6WA 2O49A 3H5TA 2O38A 3DNVB 1DWKA 1DW9A 1PRUA 3KJXA 1QP4A
chains in the Genus database with same CATH superfamily
3RZZA 2MQKA 3ZPXA 2L49A 2HSGA 2WUSR 3EUSA 1QP7A 1Y7YA 2EWTA 4YG7B 3G5GA 1HQ1A 2XXQA 1RZRD 3GN5A 3SCGA 4X4EA 2JVLA 3ME5A 4PU4C 3FMYA 2VEOA 2O4AA 4EK9A 4EZIA 3QWGA 2L8NA 2HCNA 1E3OC 2KEKA 4J1WA 1WIZA 3CECA 4GHJA 1ZZBA 3QYXA 2H8RA 2PUDA 5A7LA 3UFDA 4GQMA 4Z58A 2XJ3A 3OWQA 2LYPA 5DRYA 3NROA 3JXDL 3NDBB 2AW6A 3DM5A 2HFZA 1L1MA 3LQXA 2A6CA 2BJCA 1BDHA 5DTQA 3KL4A 3LFPA 1S7EA 3L1PA 4HRAA 3JXCL 3FYAA 3FYMA 3QFIA 3CROL 4EKIA 2PUBA 3JXBC 2PE5A 1XWRA 5DTRA 3TELA 1U2ZA 4WVLA 5DTMA 3OP9A 1X2LA 2IVQA 1PRAA 1NEQA 4X4HA 2LYSA 4FBIA 2IU7A 4JCXA 3SR4A 1JWLA 2GRMA 1HF0A 1RPEL 1MFQC 4I6RA 3PXPA 2D5VA 3B7HA 1R63A 2PXTA 3A9ZA 2PUEA 4PU8A 3TRBA 4Q2JA 2LYRA 2PXBA 4Z5DA 2O49A 2XI8A 3O9XA 4J1XA 3M9LA 3ZKCA 5DT2A 4YG4A 4Z5HA 2WIUB 3GBFA 4IVZA 3D1NI 3BD1A 4OB4A 5K98B 4X4GA 2MXDA 3OMTA 1QPZA 2PUAA 4ER6A 2LLWA 3ZHMA 4PU7A 2XIUA 2EF8A 4ER3A 1PNRA 4Z5CA 2JQEA 4ER0A 1QP0A 5DRTA 2KZ8A 2PUGA 1WETA 2ICTA 3GZCA 1POUA 2LYJA 2AXUA 4EKGA 3GZDC 2PXDA 2AWIA 2PXLA 2HCSA 2IVBA 4X4IA 2L1PA 1LCDA 2PXFA 1PERL 1YSEA 4F8DA 1NERA 3SCFA 3KZ3A 1ZUGA 2XXPA 2CROA 1BDIA 2PIJA 3HZIB 3F6WA 2PXVA 2O38A 3DNVB 1DWKA 1DW9A 1PRUA 2KEJA 4X4BA 2XXAA 4YBAA 3F51A 1RZRA 1ADRA 1RZSA 4MCTA 3SX0A 4X4CA 3IVPA 1PRVA 2B5AA 3S8QA 2ICPA 1ZPQA 3A9YA 2OR1L 4YARA 3OKZA 1UTXA 4Z59A 3OQMA 2CSFA 2R1JL 1GT0C 4I6TA 1ZS4A 2AUWA 4DE9A 3OQNA 3R09A 2IUOA 2PXQA 4JCYA 2IVGA 1WH6A 4OBMA 2FFHA 3G7DA 1LLIA 2LCVA 4ER5A 4IA8A 2LNMA 4O8BA 3TFLA 3QQ6A 4Y42A 2GZUA 2HINA 2LLVA 4FN3A 1QQBA 2PUCA 1LQCA 1LCCA 2J7WA 2KPJA 3QOWA 1OCTC 2R63A 1QZXA 4JQDA 4IWRA 3KXAA 3VWSA 5JUWA 2GRLA 2EBYA 3OQOA 3QOXA 3H5TA 5GAHi 4EQZA 3A9XA 3CLCA 3NZLA 3NXHA 1ZZ6A 4MCXA 1JH9A 1B0NA 1QB2A 1VPWA 2FJRA 4ER7A 2ODRD 2V3CC 2BNMA 1JFTA 4PU3C 1CJGA 2LYLA 3R1FA 3QF3A 4YG1A 1OSLA 1IC8A 5DSXA 3GZDA 2PXEA 2XSDC 1X57A 2KEIA 3LISA 3VK0A 2IV1A 3G0TA 2YBDA 2LYQA 2M4HA 3BDNA 2PXUA 2PXPA 2MEZA 4I8TA 2BNOA 4NDWA 1NW3A 1ZZCA 2PXKA 1CQTA 1ZZ7A 2BNNA 3BS3A 1UXCA 1WH8A 1SQ8A 2J7UA 3SCHA 3MEJA 3UWPA 1EFAA 2XCJA 1JFSA 4X4FA 1LMB3 1ZZ8A 1UXDA 3F52A 1O4XA 3GUUA 2AXZA 1ZVVA 3U3WA 2PUFA 2AXVA 2JCGA 1AU7A 2LYKA 2PPXA 3PE5A 1Y9QA 4DE8A 1QQAA 1R69A 5GAGi 3ZHIA 2OFYA 3MLFA 1ZAYA 4X4DA 1ZZ9A 3TEPA 1RIOA 3GN5B 4I6UA 1DULA 3KJXA 1QP4A
chains in the Genus database with same CATH topology
1X2LA 2IVQA 3RZZA 1PRAA 2MQKA 1NEQA 2KEJA 2L49A 3CLCA 4X4HA 4X4BA 2LYSA 4YBAA 2IU7A 2HSGA 4FBIA 1JWLA 2WUSR 2GRMA 3EUSA 1ZZ6A 3F51A 1HF0A 1RPEL 1RZRA 1ADRA 1RZSA 4MCTA 4MCXA 4X4CA 3IVPA 1JH9A 1PRVA 1QP7A 1B0NA 2B5AA 4I6RA 3PXPA 3S8QA 1VPWA 2D5VA 3B7HA 2ICPA 1R63A 2FJRA 1Y7YA 2EWTA 4YG7B 2PUGA 1ZPQA 3G5GA 2PUEA 3OP9A 2OR1L 2BNMA 4PU8A 1RZRD 3GN5A 1JFTA 4PU3C 4YARA 3SCGA 3TRBA 4X4EA 1CJGA 2LYRA 2LYLA 2JVLA 1UTXA 4Z5DA 3R1FA 3QF3A 3FMYA 4PU4C 4Z59A 4YG1A 3OQMA 1OSLA 2CSFA 2XI8A 4J1XA 3O9XA 2R1JL 3ZKCA 1IC8A 2O4AA 1GT0C 4I6TA 2XSDC 1X57A 1ZS4A 4YG4A 2AUWA 4Z5HA 2WIUB 3LISA 2KEIA 3QWGA 3OQNA 3VK0A 2L8NA 2IV1A 3GBFA 1E3OC 4IVZA 2KEKA 4J1WA 2IUOA 2LYQA 3D1NI 3BD1A 3BDNA 4OB4A 5K98B 1WIZA 4X4GA 3CECA 4GHJA 4JCYA 1ZZBA 3OMTA 3QYXA 1QPZA 2IVGA 2H8RA 2PUAA 2PUDA 4PU7A 5A7LA 1WH6A 2XIUA 2EF8A 3ZHMA 3UFDA 2MEZA 3G7DA 1PNRA 4GQMA 1LLIA 4I8TA 2BNOA 2LCVA 4Z58A 4NDWA 4Z5CA 2XJ3A 1ZZCA 2LYPA 4IA8A 1CQTA 1ZZ7A 3JXDL 2BNNA 3BS3A 4O8BA 1QP0A 1UXCA 2AW6A 1WH8A 1SQ8A 3QQ6A 3SCHA 1L1MA 1EFAA 2XCJA 1JFSA 4X4FA 2KZ8A 1LMB3 1ZZ8A 4Y42A 1WETA 1UXDA 2A6CA 2ICTA 3F52A 2BJCA 1O4XA 1POUA 2LYJA 2AXZA 1ZVVA 2GZUA 2HINA 1BDHA 3U3WA 2AXUA 3LFPA 2PUFA 1S7EA 4FN3A 4JCXA 1QQBA 2AWIA 2PUCA 1LQCA 2AXVA 3L1PA 1LCCA 3JXCL 2KPJA 2JCGA 2IVBA 4X4IA 1AU7A 2LYKA 2PPXA 3FYAA 1OCTC 1LCDA 2R63A 1Y9QA 1PERL 3FYMA 1YSEA 4F8DA 1NERA 3SCFA 1QQAA 3CROL 3KZ3A 2PUBA 4JQDA 1R69A 3JXBC 3ZHIA 2PE5A 4IWRA 2OFYA 3KXAA 3MLFA 1ZUGA 1ZAYA 2GRLA 4X4DA 2CROA 1ZZ9A 1XWRA 2EBYA 1BDIA 3OQOA 1RIOA 2PIJA 3HZIB 3GN5B 4I6UA 3F6WA 2O49A 3H5TA 2O38A 3DNVB 1DWKA 1DW9A 1PRUA 3KJXA 1QP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2L A;  2IVQ A;  3RZZ A;  1PRA A;  2MQK A;  1NEQ A;  2KEJ A;  2L49 A;  3CLC A;  4X4H A;  4X4B A;  2LYS A;  4YBA A;  2IU7 A;  2HSG A;  4FBI A;  1JWL A;  2WUS R;  2GRM A;  3EUS A;  1ZZ6 A;  3F51 A;  1HF0 A;  1RPE L;  1RZR A;  1ADR A;  1RZS A;  4MCT A;  4MCX A;  4X4C A;  3IVP A;  1JH9 A;  1PRV A;  1QP7 A;  1B0N A;  2B5A A;  4I6R A;  3PXP A;  3S8Q A;  1VPW A;  2D5V A;  3B7H A;  2ICP A;  1R63 A;  2FJR A;  1Y7Y A;  2EWT A;  4YG7 B;  2PUG A;  1ZPQ A;  3G5G A;  2PUE A;  3OP9 A;  2OR1 L;  2BNM A;  4PU8 A;  1RZR D;  3GN5 A;  1JFT A;  4PU3 C;  4YAR A;  3SCG A;  3TRB A;  4X4E A;  1CJG A;  2LYR A;  2LYL A;  2JVL A;  1UTX A;  4Z5D A;  3R1F A;  3QF3 A;  3FMY A;  4PU4 C;  4Z59 A;  4YG1 A;  3OQM A;  1OSL A;  2CSF A;  2XI8 A;  4J1X A;  3O9X A;  2R1J L;  3ZKC A;  1IC8 A;  2O4A A;  1GT0 C;  4I6T A;  2XSD C;  1X57 A;  1ZS4 A;  4YG4 A;  2AUW A;  4Z5H A;  2WIU B;  3LIS A;  2KEI A;  3QWG A;  3OQN A;  3VK0 A;  2L8N A;  2IV1 A;  3GBF A;  1E3O C;  4IVZ A;  2KEK A;  4J1W A;  2IUO A;  2LYQ A;  3D1N I;  3BD1 A;  3BDN A;  4OB4 A;  5K98 B;  1WIZ A;  4X4G A;  3CEC A;  4GHJ A;  4JCY A;  1ZZB A;  3OMT A;  3QYX A;  1QPZ A;  2IVG A;  2H8R A;  2PUA A;  2PUD A;  4PU7 A;  5A7L A;  1WH6 A;  2XIU A;  2EF8 A;  3ZHM A;  3UFD A;  2MEZ A;  3G7D A;  1PNR A;  4GQM A;  1LLI A;  4I8T A;  2BNO A;  2LCV A;  4Z58 A;  4NDW A;  4Z5C A;  2XJ3 A;  1ZZC A;  2LYP A;  4IA8 A;  1CQT A;  1ZZ7 A;  3JXD L;  2BNN A;  3BS3 A;  4O8B A;  1QP0 A;  1UXC A;  2AW6 A;  1WH8 A;  1SQ8 A;  3QQ6 A;  3SCH A;  1L1M A;  1EFA A;  2XCJ A;  1JFS A;  4X4F A;  2KZ8 A;  1LMB 3;  1ZZ8 A;  4Y42 A;  1WET A;  1UXD A;  2A6C A;  2ICT A;  3F52 A;  2BJC A;  1O4X A;  1POU A;  2LYJ A;  2AXZ A;  1ZVV A;  2GZU A;  2HIN A;  1BDH A;  3U3W A;  2AXU A;  3LFP A;  2PUF A;  1S7E A;  4FN3 A;  4JCX A;  1QQB A;  2AWI A;  2PUC A;  1LQC A;  2AXV A;  3L1P A;  1LCC A;  3JXC L;  2KPJ A;  2JCG A;  2IVB A;  4X4I A;  1AU7 A;  2LYK A;  2PPX A;  3FYA A;  1OCT C;  1LCD A;  2R63 A;  1Y9Q A;  1PER L;  3FYM A;  1YSE A;  4F8D A;  1NER A;  3SCF A;  1QQA A;  3CRO L;  3KZ3 A;  2PUB A;  4JQD A;  1R69 A;  3JXB C;  3ZHI A;  2PE5 A;  4IWR A;  2OFY A;  3KXA A;  3MLF A;  1ZUG A;  1ZAY A;  2GRL A;  4X4D A;  2CRO A;  1ZZ9 A;  1XWR A;  2EBY A;  1BDI A;  3OQO A;  1RIO A;  2PIJ A;  3HZI B;  3GN5 B;  4I6U A;  3F6W A;  2O49 A;  3H5T A;  2O38 A;  3DNV B;  1DWK A;  1DW9 A;  1PRU A;  3KJX A;  1QP4 A; 
#chains in the Genus database with same CATH topology
 3RZZ A;  2MQK A;  3ZPX A;  2L49 A;  2HSG A;  2WUS R;  3EUS A;  1QP7 A;  1Y7Y A;  2EWT A;  4YG7 B;  3G5G A;  1HQ1 A;  2XXQ A;  1RZR D;  3GN5 A;  3SCG A;  4X4E A;  2JVL A;  3ME5 A;  4PU4 C;  3FMY A;  2VEO A;  2O4A A;  4EK9 A;  4EZI A;  3QWG A;  2L8N A;  2HCN A;  1E3O C;  2KEK A;  4J1W A;  1WIZ A;  3CEC A;  4GHJ A;  1ZZB A;  3QYX A;  2H8R A;  2PUD A;  5A7L A;  3UFD A;  4GQM A;  4Z58 A;  2XJ3 A;  3OWQ A;  2LYP A;  5DRY A;  3NRO A;  3JXD L;  3NDB B;  2AW6 A;  3DM5 A;  2HFZ A;  1L1M A;  3LQX A;  2A6C A;  2BJC A;  1BDH A;  5DTQ A;  3KL4 A;  3LFP A;  1S7E A;  3L1P A;  4HRA A;  3JXC L;  3FYA A;  3FYM A;  3QFI A;  3CRO L;  4EKI A;  2PUB A;  3JXB C;  2PE5 A;  1XWR A;  5DTR A;  3TEL A;  1U2Z A;  4WVL A;  5DTM A;  3OP9 A;  1X2L A;  2IVQ A;  1PRA A;  1NEQ A;  4X4H A;  2LYS A;  4FBI A;  2IU7 A;  4JCX A;  3SR4 A;  1JWL A;  2GRM A;  1HF0 A;  1RPE L;  1MFQ C;  4I6R A;  3PXP A;  2D5V A;  3B7H A;  1R63 A;  2PXT A;  3A9Z A;  2PUE A;  4PU8 A;  3TRB A;  4Q2J A;  2LYR A;  2PXB A;  4Z5D A;  2O49 A;  2XI8 A;  3O9X A;  4J1X A;  3M9L A;  3ZKC A;  5DT2 A;  4YG4 A;  4Z5H A;  2WIU B;  3GBF A;  4IVZ A;  3D1N I;  3BD1 A;  4OB4 A;  5K98 B;  4X4G A;  2MXD A;  3OMT A;  1QPZ A;  2PUA A;  4ER6 A;  2LLW A;  3ZHM A;  4PU7 A;  2XIU A;  2EF8 A;  4ER3 A;  1PNR A;  4Z5C A;  2JQE A;  4ER0 A;  1QP0 A;  5DRT A;  2KZ8 A;  2PUG A;  1WET A;  2ICT A;  3GZC A;  1POU A;  2LYJ A;  2AXU A;  4EKG A;  3GZD C;  2PXD A;  2AWI A;  2PXL A;  2HCS A;  2IVB A;  4X4I A;  2L1P A;  1LCD A;  2PXF A;  1PER L;  1YSE A;  4F8D A;  1NER A;  3SCF A;  3KZ3 A;  1ZUG A;  2XXP A;  2CRO A;  1BDI A;  2PIJ A;  3HZI B;  3F6W A;  2PXV A;  2O38 A;  3DNV B;  1DWK A;  1DW9 A;  1PRU A;  2KEJ A;  4X4B A;  2XXA A;  4YBA A;  3F51 A;  1RZR A;  1ADR A;  1RZS A;  4MCT A;  3SX0 A;  4X4C A;  3IVP A;  1PRV A;  2B5A A;  3S8Q A;  2ICP A;  1ZPQ A;  3A9Y A;  2OR1 L;  4YAR A;  3OKZ A;  1UTX A;  4Z59 A;  3OQM A;  2CSF A;  2R1J L;  1GT0 C;  4I6T A;  1ZS4 A;  2AUW A;  4DE9 A;  3OQN A;  3R09 A;  2IUO A;  2PXQ A;  4JCY A;  2IVG A;  1WH6 A;  4OBM A;  2FFH A;  3G7D A;  1LLI A;  2LCV A;  4ER5 A;  4IA8 A;  2LNM A;  4O8B A;  3TFL A;  3QQ6 A;  4Y42 A;  2GZU A;  2HIN A;  2LLV A;  4FN3 A;  1QQB A;  2PUC A;  1LQC A;  1LCC A;  2J7W A;  2KPJ A;  3QOW A;  1OCT C;  2R63 A;  1QZX A;  4JQD A;  4IWR A;  3KXA A;  3VWS A;  5JUW A;  2GRL A;  2EBY A;  3OQO A;  3QOX A;  3H5T A;  5GAH i;  4EQZ A;  3A9X A;  3CLC A;  3NZL A;  3NXH A;  1ZZ6 A;  4MCX A;  1JH9 A;  1B0N A;  1QB2 A;  1VPW A;  2FJR A;  4ER7 A;  2ODR D;  2V3C C;  2BNM A;  1JFT A;  4PU3 C;  1CJG A;  2LYL A;  3R1F A;  3QF3 A;  4YG1 A;  1OSL A;  1IC8 A;  5DSX A;  3GZD A;  2PXE A;  2XSD C;  1X57 A;  2KEI A;  3LIS A;  3VK0 A;  2IV1 A;  3G0T A;  2YBD A;  2LYQ A;  2M4H A;  3BDN A;  2PXU A;  2PXP A;  2MEZ A;  4I8T A;  2BNO A;  4NDW A;  1NW3 A;  1ZZC A;  2PXK A;  1CQT A;  1ZZ7 A;  2BNN A;  3BS3 A;  1UXC A;  1WH8 A;  1SQ8 A;  2J7U A;  3SCH A;  3MEJ A;  3UWP A;  1EFA A;  2XCJ A;  1JFS A;  4X4F A;  1LMB 3;  1ZZ8 A;  1UXD A;  3F52 A;  1O4X A;  3GUU A;  2AXZ A;  1ZVV A;  3U3W A;  2PUF A;  2AXV A;  2JCG A;  1AU7 A;  2LYK A;  2PPX A;  3PE5 A;  1Y9Q A;  4DE8 A;  1QQA A;  1R69 A;  5GAG i;  3ZHI A;  2OFY A;  3MLF A;  1ZAY A;  4X4D A;  1ZZ9 A;  3TEP A;  1RIO A;  3GN5 B;  4I6U A;  1DUL A;  3KJX A;  1QP4 A; 
#chains in the Genus database with same CATH homology
 1X2L A;  2IVQ A;  3RZZ A;  1PRA A;  2MQK A;  1NEQ A;  2KEJ A;  2L49 A;  3CLC A;  4X4H A;  4X4B A;  2LYS A;  4YBA A;  2IU7 A;  2HSG A;  4FBI A;  1JWL A;  2WUS R;  2GRM A;  3EUS A;  1ZZ6 A;  3F51 A;  1HF0 A;  1RPE L;  1RZR A;  1ADR A;  1RZS A;  4MCT A;  4MCX A;  4X4C A;  3IVP A;  1JH9 A;  1PRV A;  1QP7 A;  1B0N A;  2B5A A;  4I6R A;  3PXP A;  3S8Q A;  1VPW A;  2D5V A;  3B7H A;  2ICP A;  1R63 A;  2FJR A;  1Y7Y A;  2EWT A;  4YG7 B;  2PUG A;  1ZPQ A;  3G5G A;  2PUE A;  3OP9 A;  2OR1 L;  2BNM A;  4PU8 A;  1RZR D;  3GN5 A;  1JFT A;  4PU3 C;  4YAR A;  3SCG A;  3TRB A;  4X4E A;  1CJG A;  2LYR A;  2LYL A;  2JVL A;  1UTX A;  4Z5D A;  3R1F A;  3QF3 A;  3FMY A;  4PU4 C;  4Z59 A;  4YG1 A;  3OQM A;  1OSL A;  2CSF A;  2XI8 A;  4J1X A;  3O9X A;  2R1J L;  3ZKC A;  1IC8 A;  2O4A A;  1GT0 C;  4I6T A;  2XSD C;  1X57 A;  1ZS4 A;  4YG4 A;  2AUW A;  4Z5H A;  2WIU B;  3LIS A;  2KEI A;  3QWG A;  3OQN A;  3VK0 A;  2L8N A;  2IV1 A;  3GBF A;  1E3O C;  4IVZ A;  2KEK A;  4J1W A;  2IUO A;  2LYQ A;  3D1N I;  3BD1 A;  3BDN A;  4OB4 A;  5K98 B;  1WIZ A;  4X4G A;  3CEC A;  4GHJ A;  4JCY A;  1ZZB A;  3OMT A;  3QYX A;  1QPZ A;  2IVG A;  2H8R A;  2PUA A;  2PUD A;  4PU7 A;  5A7L A;  1WH6 A;  2XIU A;  2EF8 A;  3ZHM A;  3UFD A;  2MEZ A;  3G7D A;  1PNR A;  4GQM A;  1LLI A;  4I8T A;  2BNO A;  2LCV A;  4Z58 A;  4NDW A;  4Z5C A;  2XJ3 A;  1ZZC A;  2LYP A;  4IA8 A;  1CQT A;  1ZZ7 A;  3JXD L;  2BNN A;  3BS3 A;  4O8B A;  1QP0 A;  1UXC A;  2AW6 A;  1WH8 A;  1SQ8 A;  3QQ6 A;  3SCH A;  1L1M A;  1EFA A;  2XCJ A;  1JFS A;  4X4F A;  2KZ8 A;  1LMB 3;  1ZZ8 A;  4Y42 A;  1WET A;  1UXD A;  2A6C A;  2ICT A;  3F52 A;  2BJC A;  1O4X A;  1POU A;  2LYJ A;  2AXZ A;  1ZVV A;  2GZU A;  2HIN A;  1BDH A;  3U3W A;  2AXU A;  3LFP A;  2PUF A;  1S7E A;  4FN3 A;  4JCX A;  1QQB A;  2AWI A;  2PUC A;  1LQC A;  2AXV A;  3L1P A;  1LCC A;  3JXC L;  2KPJ A;  2JCG A;  2IVB A;  4X4I A;  1AU7 A;  2LYK A;  2PPX A;  3FYA A;  1OCT C;  1LCD A;  2R63 A;  1Y9Q A;  1PER L;  3FYM A;  1YSE A;  4F8D A;  1NER A;  3SCF A;  1QQA A;  3CRO L;  3KZ3 A;  2PUB A;  4JQD A;  1R69 A;  3JXB C;  3ZHI A;  2PE5 A;  4IWR A;  2OFY A;  3KXA A;  3MLF A;  1ZUG A;  1ZAY A;  2GRL A;  4X4D A;  2CRO A;  1ZZ9 A;  1XWR A;  2EBY A;  1BDI A;  3OQO A;  1RIO A;  2PIJ A;  3HZI B;  3GN5 B;  4I6U A;  3F6W A;  2O49 A;  3H5T A;  2O38 A;  3DNV B;  1DWK A;  1DW9 A;  1PRU A;  3KJX A;  1QP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...