2KF3A

Barnase, low pressure reference nmr structure
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Pressure-dependent structure changes in barnase on ligand binding reveal intermediate rate fluctuations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 35
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kf3A00
1BIRA 1DETA 1RGCA 1BU4A 2KF3A 3AGOA 1YVSA 1JBRA 1BNRA 1UCKA 1I3IA 1BRHA 1X1YA 3URPA 2AAEA 3Q3FA 1BSBA 1BSAA 2F4YA 1G02A 1I0VA 1TTOA 1GMRA 1PY3A 1X1WA 1Q9EA 1RMSA 1B2XA 1AQZA 1I70A 1YNVX 2F5WA 1MGRA 4J5KA 1BUJA 4BIRA 1PYLA 1BVIA 1HZ1A 1LRAA 1BANA 1B3SA 8RNTA 1BGSA 1BNFA 1RCKA 1RGEA 3DGYA 2ZA4A 1BRSA 3WHOA 1BNJA 1RCLA 3DH2A 1I8VA 1LOWA 1LOYA 2KF5A 2RBIA 4GHOA 1IYYA 7GSPA 1I3FA 1T2HA 9RNTA 1I0XA 1BAOA 2C4BA 1B2ZA 1GOUA 1B2SA 4HOHA 1LNIA 4GSPA 1BRIA 2RNTA 1YGWA 1BRJA 1RGLA 2GSPA 3RNTA 2KF4A 4HAAA 4BU4A 1HYFA 1FUSA 3AHSA 1GOVA 2F5MA 3SYUA 3A5EA 1T2IA 1BSDA 1GMPA 2BIRA 6RNTA 1BNEA 1R4YA 6GSPA 1ZGXA 2HOHA 3BIRA 2BU4A 1RNBA 1X1XA 1BOXA 3D5GA 1UCJA 1CH0A 1RHLA 1GOYA 1RGKA 3D4AA 1JBSA 1RGGA 1I2EA 1LOVA 1MGWA 1RGAA 2KAAA 5BU4A 1BNGA 1BSCA 1C54A 3AGNA 4RNTA 1I2GA 1B27A 1UCLA 1A2PA 1FW7A 1FYSA 1FZUA 1BNIA 1RNTA 1RGFA 1TRPA 2AADA 3BU4A 1B2UA 1RGHA 1DE3A 1GSPA 5BIRA 3HOHA 1X1UA 1B2MA 3D5IA 1RTUA 3WR2A 2SARA 1RN4A 1BSEA 1RLSA 1I2FA 3GSPA 3KCHA 1FUTA 4J5GA 1B21A 1BNSA 1UCIA 1GMQA 3AHWA 2F56A 5GSPA 1JBTA 1RN1A 1BRGA 7RNTA 1B20A 1SARA 1BRKA 1BRNL 1RDSA 1RSNA 5HOHA 1AY7A 2KF6A 5RNTA 1TRQA
chains in the Genus database with same CATH superfamily
1TIJA 1SJWA 4LYLB 1DETA 1N5PA 2B1XB 5ELUA 2K0MA 3CMA3 2E2UA 2ZL8A 3DUKA 2KF3A 3AGOA 5HGRA 1JBRA 5JPUA 1UCKA 3Q2PA 1IQXA 4HYZA 1LQMB 1BRHA 2STDA 1TTOA 1GMRA 3KN4A 3F9SA 2CG0A 1Q9EA 2CIUA 2L4VA 3T8NA 4Q53A 5AIFA 1ASKA 2R41A 3CCR3 2V1LA 1I70A 1IVUA 4N6NB 2OQEC 1VQ63 5M1AA 4EYCA 4RBNA 3V92A 1PYLA 6STDA 1LRAA 1MWRA 1JN5B 2GU1A 3AMOB 4MMYB 1BGSA 8RNTA 1RCKA 1EKMA 3B8LA 4EC6A 1UI7A 4BTYA 1F8NA 3NV0A 4XDVA 5IERA 1RCLA 4R4KA 3DH2A 1KSIA 2JDIH 1I8VA 4LMIA 1LOWA 3HIIA 1SPUA 2CWVA 4GHOA 1AV4A 5DREA 1IYYA 3BNBA 2MF7A 1T2HA 3MPHA 2B24B 3M8CA 9RNTA 1STDA 2O9UX 3O8YA 1UW1A 5I97A 1A67A 1BAOA 1JZOA 3G4S3 1TFKA 3ZFZA 1BRJA 2GEYA 2BNGA 1OGZA 3NUVA 4IPBA 3H3HA 5LC7A 2KF4A 4HVNA 3IJEB 4N6TA 5AI1A 5JBSA 4MJDA 1IV7A 1JB5A 3BB9A 4IIAA 2QGUA 3X3ZA 1N8R4 3JUOA 4KT3B 3A5EA 1VQ93 3CCU3 4CDLA 2PNCA 1BSDA 2HMOB 3SEDA 1HU9A 1O7GB 3SOAA 1NDOB 1BNEA 1R4YA 6RNTA 1ZGXA 2Z77A 1VQM3 2BO9B 3GZBA 1BOXA 4HBRA 3D79A 1UCJA 3CPOA 4XBXA 5IW9A 5STDA 1JBSA 3V99A 2BMOB 2GXFA 5AYSC 2W04A 1WNHA 3NV0B 3PXMA 3D3LA 1W5ZA 1W00A 4HZ9B 2LQVA 4OVMA 2OTL3 1LOXA 4O02B 3F7XA 1RGAA 3UB1A 3DGLA 1Q864 5BU4A 1BNGA 2KXGA 3HX8A 3N8BA 1W4NA 4RNTA 3EF8A 3PCSA 1FGMA 3DXOA 3CCE3 4JRFA 2FXTA 4I4KA 4HM3B 1IT7A 5ELJA 5CXOA 4BTXA 1RNTA 3OX9A 2RCDA 3BU4A 1MWTA 1B2UA 1RN7A 3FF2A 2IMJA 1DE3A 1IDPA 3B7CA 1Q824 1TP6A 1D6UA 4FMDA 1V57A 3X42A 1RLSA 2CHCA 3DGMA 2K3DA 3V98A 2WGQA 4J5GA 2C11A 1B21A 2W2CA 3N54B 1UCIA 4FR9A 1Q40B 5D82A 3K9MC 1OACA 2QEX3 2J8XB 3EC9A 1MWSA 1US1A 5GSPA 3MG2A 1N8QA 2HMLB 1RN1A 2XGNA 5IF6A 2O3OA 4FCZA 4STDA 1RJOA 1EUIC 5EQLA 3X40A 1RDSA 5HOHA 1R4CA 4L8PA 1ZX2A 5EVHA 3DY5A 2LYXA 1EA2A 2F98A 1K28A 2I9WA 3Q1CA 1BU4A 3NQZA 1YVSA 1GY6A 1Z1SA 4FMBA 4JF8A 3I553 2HMNB 3URPA 1X1YA 1YI23 1BSAA 2F4YA 5AIGA 3X3XA 1NJI4 1I0VA 2WGOA 2CX0A 5DRVA 1K41A 1W2B2 1WMOA 1QAKA 1BUQA 1V74A 3K7CA 1CYVA 1RKYA 3PZWA 1OGXA 3CCV3 1Q42A 4ZM8A 3E99A 3NBJA 4BIRA 3EN8A 1BUJA 1BVIA 1HZ1A 1G0TA 2D1WA 3DGNA 4ILFA 2BMQB 4L8OA 5KP4A 3DGOA 3CC73 2BMRB 1WQLB 3X3YA 1ISKA 3BLZA 1RGEA 1BNFA 1VQO3 1KD14 1QALA 3EJVA 4R9KA 3DGYA 2RFRA 1UUGB 2ZA4A 2CW9A 3OWYA 1GY7A 1W6GA 1BRSA 3UNLA 1M1XB 3HIGA 1WTHA 3EQQB 8CHOA 1LOYA 4FMAA 1KWIA 3DM8A 3NX0A 3JUPA 5G1KA 5AYRB 3T0UA 3I563 4J9AA 2H0IA 1UDII 4GB5A 5IENA 5EEOA 3DZLA 4I5QA 3CCQ3 4KFDA 1T3BA 2CWTA 4WFOA 1GYBA 3LT9A 4OUQA 4MEIA 1B2ZA 1OHPA 5TGNA 4GSPA 4K61A 5CK6A 1BRIA 2RNTA 1NO3A 1YGWA 3CCS3 4ORLA 3U1WA 1HYFA 1FUSA 4K1VA 3AHSA 4L7KA 3KKGA 4FCJA 1OHSA 4TX4A 3SX1A 2YFJB 2F5MA 3SXXA 1LXEA 1IU7A 1OUNA 4HM7B 3FG1A 1T2IA 1O7HB 2BIRA 2ZDJA 3X41A 2HOHA 3FH1A 3K63A 3BIRA 2ML6A 4N6V0 3CD63 1OCVA 1GD4A 1X1XA 3RGRA 1GY5A 2YX9A 1CEWI 3L0RA 4NPBA 4HZBB 4WP5A 3MHEA 1Q7Y4 1CYUA 3PYJA 2CH9A 4HM2B 2QA43 1JRQA 3LT8A 2OTJ3 2CWUA 4O3VA 1VQP3 5G2GA 2KAAA 4N6MA 3LH4A 4O8SA 1C54A 1IVXA 4XBTA 1I2GA 1B27A 1UCLA 2GBWB 2KRTA 1RRLA 2Y74A 1FYSA 1BNIA 1VQ43 2IY2A 3ECFA 4KVHA 4AEQA 1L5GB 4KZ1A 4H61A 1J2BA 4RNYA 4HM4B 5FGOA 2CG1A 3NXJA 1ULIB 2M7OA 3LTBA 1RTUA 5IG5A 2C10A 1RN4A 5G1LA 1VQK3 1K734 1UI8A 1N5HA 3VF1A 1I2FA 1IQ8A 3KCHA 1ZS7A 3UJMA 1Q814 4WWUC 2P0XA 1BNSA 1GMQA 1JV2B 1EG9B 1IV9A 1UGHI 3AHWA 3FF0A 3PS8A 3MYTA 1JBTA 1EQKA 2F99A 3HK4A 2CKFB 4BL3A 4AKYA 1N9EA 1B20A 3MSOA 4KFFA 3G6E3 1LVNA 2XFTA 2SBLA 2OQEA 3JVCA 1AY7A 3CCM3 2D42A 2KF6A 1TRQA 3LOYA 1BIRA 3KSPA 4RZMA 1GS3A 1RGCA 4LZIA 4N3VA 1FGRA 1VQQA 1EEJA 2RGQA 2Y73A 4OK0A 3OWSA 2WO0A 4WHAA 1T5YA 2FNQA 1YJW3 2XSHB 1BNRA 1U5OA 1I3IA 2XGLA 5CLKA 3K5TA 1G02A 3OWUA 1TFOA 2ML5A 3NQYA 1X1WA 4WYKA 4EV2A 3WDGB 1RMSA 2CFGA 1FA3A 4N6LA 1AQZA 3FG4A 2W9QA 1C7HA 1YNVX 2H0GA 2UX0A 2WOHA 2F5WA 2Z6BA 3F40A 3NHXA 1W7CA 1AVKA 1ZO2A 2WOFA 1A2VA 2YFIB 2P05A 3MKIA 4GL6A 4RNZA 1IQYA 1OH0A 1BANA 1M1K4 1G96A 5CF1A 4FCMA 5IG0A 3CNMA 3U97A 5A0OB 3LMLA 2K54A 1D6ZA 1VQ53 3CCJ3 3WHOA 1KC84 1ULJB 3SOYA 1JNQA 2OCTA 2CFLA 3LZAA 3UL5A 3CXC2 7GSPA 1NB3I 3MWZA 2IA7A 1STFI 1I0XA 4K90B 2CFWA 2C4BA 1GOUA 3CNXA 1B2SA 4HOHA 1QAFA 2GSPA 1AVLA 1RGLA 1YIJ3 2E2TA 2P09A 4HAAA 3CU3A 4BU4A 3EBTA 4WYKB 4R80A 2HMMB 1A90A 1DMNA 3LTCA 4U13A 1UUVB 1O7PB 3CCL3 4LSOA 3KIIA 2JQ5A 2HMJB 3GAXA 3K0ZA 1W2ZA 2Z7AA 3EX9A 3SVAA 3CC23 1O7MB 2OOVC 3QK9A 1JB4A 5BXQA 3WA3A 6GSPA 1MNLA 1RRHA 2FGTA 2BU4A 1NB5I 3G0KA 1RNBA 3D5GA 4BTWA 1CH0A 5IG4A 1OF5A 1E97A 3JUMA 2Z76A 2CC3A 3D4AA 3KE7A 4KFEA 5AEWB 2E2VA 1JKGA 3SLUA 3ALAA 3CPW2 1K9M4 3LYGA 4XBYA 4HM6B 3OXAA 1MGWA 3WODG 4O2HA 3S5CA 3GZXB 1TJDA 1JB2A 3T8UA 5KP1A 3EHCA 3AGNA 3FKAA 1OPYA 2GU3A 1FW7A 4DKIA 1FZUA 3WA2X 3EN1B 2HMKB 1RGFA 5FW5A 3GZRA 3TDGA 1FUWA 2PZVA 2QIYA 1DYUA 2W0QA 3BNDA 2XSOB 3F7SA 1RGHA 1WMNA 1DVCA 3S28A 3MG3A 5BIRA 1FGQA 1X1UA 3N9HA 2Q07A 4IT7A 4R9LA 1N9JA 3S29A 2W6JH 1IK3A 3NM7A 4HM5B 2GBXB 3NBBA 4HM8B 3EB8A 3F8HA 3GSPA 2MC8A 1FUTA 3IMAB 3RDEA 2CK3H 3MG1A 4AKZA 2XFSA 1UGIA 2F56A 4HM1B 3VSYA 1Y4KA 1OF5B 1SQWA 2YFLB 3FGYA 4MMZB 2IUJA 1E3RA 7RNTA 3VGNA 1JKGB 4PEJA 1W02A 1RSNA 2W56A 3JUQA 4N6OB 4XM4A 3UL6A 1BRNL 5RNTA 3WR2A 4FMCA 3STDA 5M19A 1MWUA 1SIHA 3KZTA 1GD3A 2R4IA 4XB5A 3KFQC 1Q7HA 2OOVA 1YJ93 3FG3A 2RSXA 3EBYA 2AAEA 3Q3FA 4NHFA 1BSBA 3WMDA 1PFPA 3FCSB 4X2HA 1DMMA 5KP3A 1QVF2 3F8XA 1PY3A 4H3UA 5IG3A 3PCRA 1HKXA 3S67A 3F14A 1B2XA 3EE1A 1IVVA 1LNHA 1NWWA 3ROBA 1CQSA 1MGRA 4J5KA 3J7Yd 3GWRA 1VZZA 3OW22 1FGTA 1B3SA 1ROAA 5AIIA 3S27A 1UUWB 4EXRA 2W03A 3G8ZA 4X2OA 1VQ83 2IUKA 1YJN3 1SIIA 3LTAA 1DMQA 1JZDA 2XR8B 5LC6A 3HZPA 1Q40A 3LXUX 5CF2A 2W56B 1D6YA 2XF3A 4HM0B 1BNJA 5D83A 1IVWA 3WOEB 3CC43 2UUGC 3BNEA 1O7NB 2CFKA 2KF5A 2RBIA 4CPKA 5M18A 1A2KA 1TUHA 1U8CB 3QRDA 3GZYB 4BL2A 1I3FA 1LQGC 1S723 3FLJA 1IT8A 3HI7A 1S5AA 1QVG2 3WOFB 2XH9A 3B4PA 4XDWA 1LNIA 1VQN3 3RNTA 1M9GA 3D9RA 3IPTA 2GEXA 1NNVA 2P0MA 3RGAA 4QWTA 1GOVA 4R1KA 5JPPA 3G16A 3H51A 4G1MB 3SYUA 3I0YA 1FGOA 4J8TA 4EV5A 4MMXB 3JUNA 4CCVA 1AR0A 1GMPA 5AEUB 3BNCA 1YIT3 3ER7A 1MOLA 4CJNA 1RHLA 1GOYA 1RGKA 3DMCA 4HJLB 3LTDA 1K8A4 1RGGA 1I2EA 1WMPA 2L1SA 1LOVA 2OWPA 3A76A 2H0HA 4HKVB 4NREA 4LGQA 5AIHA 1OHOA 3GRDA 7STDA 3FZWA 1YGEA 1BSCA 1DVDA 2ZHXB 1A2PA 1QMAA 2W9PA 4EBGA 4N6UA 1W01A 1ROVA 3Q90A 2CX1A 3B4OA 4EW5A 3CME3 1O7WB 1TRPA 2AADA 2XRXB 2INXA 1PU4A 3OV4A 1TU5A 1YHQ3 2F86B 2BHMA 1JJ22 1GSPA 2IYJA 1NU3A 2UGIA 3HOHA 3D5IA 5BVBA 1VQL3 2SARA 3ZG5A 3G713 4LEHA 2KCDA 1BSEA 2BT3A 2XEPA 3NM2A 1E3VA 1KQS2 1YVBI 2A15A 4K1UA 1M904 1JN5A 3PGBA 3FSDA 5IEPA 1V58A 3AMOA 3ZG0A 1VQ73 2CFDA 1W6YA 1BRGA 1SARA 1BRKA 2P38A 1W6CA 1QJGA 5D81A 3NBRA 3KSED 1B2MA 5IEOA
chains in the Genus database with same CATH topology
1BIRA 1DETA 1RGCA 1BU4A 2KF3A 3AGOA 1YVSA 1JBRA 1BNRA 1UCKA 1I3IA 1BRHA 1X1YA 3URPA 2AAEA 3Q3FA 1BSBA 1BSAA 2F4YA 1G02A 1I0VA 1TTOA 1GMRA 1PY3A 1X1WA 1Q9EA 1RMSA 1B2XA 1AQZA 1I70A 1YNVX 2F5WA 1MGRA 4J5KA 1BUJA 4BIRA 1PYLA 1BVIA 1HZ1A 1LRAA 1BANA 1B3SA 8RNTA 1BGSA 1BNFA 1RCKA 1RGEA 3DGYA 2ZA4A 1BRSA 3WHOA 1BNJA 1RCLA 3DH2A 1I8VA 1LOWA 1LOYA 2KF5A 2RBIA 4GHOA 1IYYA 7GSPA 1I3FA 1T2HA 9RNTA 1I0XA 1BAOA 2C4BA 1B2ZA 1GOUA 1B2SA 4HOHA 1LNIA 4GSPA 1BRIA 2RNTA 1YGWA 1BRJA 1RGLA 2GSPA 3RNTA 2KF4A 4HAAA 4BU4A 1HYFA 1FUSA 3AHSA 1GOVA 2F5MA 3SYUA 3A5EA 1T2IA 1BSDA 1GMPA 2BIRA 6RNTA 1BNEA 1R4YA 6GSPA 1ZGXA 2HOHA 3BIRA 2BU4A 1RNBA 1X1XA 1BOXA 3D5GA 1UCJA 1CH0A 1RHLA 1GOYA 1RGKA 3D4AA 1JBSA 1RGGA 1I2EA 1LOVA 1MGWA 1RGAA 2KAAA 5BU4A 1BNGA 1BSCA 1C54A 3AGNA 4RNTA 1I2GA 1B27A 1UCLA 1A2PA 1FW7A 1FYSA 1FZUA 1BNIA 1RNTA 1RGFA 1TRPA 2AADA 3BU4A 1B2UA 1RGHA 1DE3A 1GSPA 5BIRA 3HOHA 1X1UA 1B2MA 3D5IA 1RTUA 3WR2A 2SARA 1RN4A 1BSEA 1RLSA 1I2FA 3GSPA 3KCHA 1FUTA 4J5GA 1B21A 1BNSA 1UCIA 1GMQA 3AHWA 2F56A 5GSPA 1JBTA 1RN1A 1BRGA 7RNTA 1B20A 1SARA 1BRKA 1BRNL 1RDSA 1RSNA 5HOHA 1AY7A 2KF6A 5RNTA 1TRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIR A;  1DET A;  1RGC A;  1BU4 A;  2KF3 A;  3AGO A;  1YVS A;  1JBR A;  1BNR A;  1UCK A;  1I3I A;  1BRH A;  1X1Y A;  3URP A;  2AAE A;  3Q3F A;  1BSB A;  1BSA A;  2F4Y A;  1G02 A;  1I0V A;  1TTO A;  1GMR A;  1PY3 A;  1X1W A;  1Q9E A;  1RMS A;  1B2X A;  1AQZ A;  1I70 A;  1YNV X;  2F5W A;  1MGR A;  4J5K A;  1BUJ A;  4BIR A;  1PYL A;  1BVI A;  1HZ1 A;  1LRA A;  1BAN A;  1B3S A;  8RNT A;  1BGS A;  1BNF A;  1RCK A;  1RGE A;  3DGY A;  2ZA4 A;  1BRS A;  3WHO A;  1BNJ A;  1RCL A;  3DH2 A;  1I8V A;  1LOW A;  1LOY A;  2KF5 A;  2RBI A;  4GHO A;  1IYY A;  7GSP A;  1I3F A;  1T2H A;  9RNT A;  1I0X A;  1BAO A;  2C4B A;  1B2Z A;  1GOU A;  1B2S A;  4HOH A;  1LNI A;  4GSP A;  1BRI A;  2RNT A;  1YGW A;  1BRJ A;  1RGL A;  2GSP A;  3RNT A;  2KF4 A;  4HAA A;  4BU4 A;  1HYF A;  1FUS A;  3AHS A;  1GOV A;  2F5M A;  3SYU A;  3A5E A;  1T2I A;  1BSD A;  1GMP A;  2BIR A;  6RNT A;  1BNE A;  1R4Y A;  6GSP A;  1ZGX A;  2HOH A;  3BIR A;  2BU4 A;  1RNB A;  1X1X A;  1BOX A;  3D5G A;  1UCJ A;  1CH0 A;  1RHL A;  1GOY A;  1RGK A;  3D4A A;  1JBS A;  1RGG A;  1I2E A;  1LOV A;  1MGW A;  1RGA A;  2KAA A;  5BU4 A;  1BNG A;  1BSC A;  1C54 A;  3AGN A;  4RNT A;  1I2G A;  1B27 A;  1UCL A;  1A2P A;  1FW7 A;  1FYS A;  1FZU A;  1BNI A;  1RNT A;  1RGF A;  1TRP A;  2AAD A;  3BU4 A;  1B2U A;  1RGH A;  1DE3 A;  1GSP A;  5BIR A;  3HOH A;  1X1U A;  1B2M A;  3D5I A;  1RTU A;  3WR2 A;  2SAR A;  1RN4 A;  1BSE A;  1RLS A;  1I2F A;  3GSP A;  3KCH A;  1FUT A;  4J5G A;  1B21 A;  1BNS A;  1UCI A;  1GMQ A;  3AHW A;  2F56 A;  5GSP A;  1JBT A;  1RN1 A;  1BRG A;  7RNT A;  1B20 A;  1SAR A;  1BRK A;  1BRN L;  1RDS A;  1RSN A;  5HOH A;  1AY7 A;  2KF6 A;  5RNT A;  1TRQ A; 
#chains in the Genus database with same CATH topology
 1TIJ A;  1SJW A;  4LYL B;  1DET A;  1N5P A;  2B1X B;  5ELU A;  2K0M A;  3CMA 3;  2E2U A;  2ZL8 A;  3DUK A;  2KF3 A;  3AGO A;  5HGR A;  1JBR A;  5JPU A;  1UCK A;  3Q2P A;  1IQX A;  4HYZ A;  1LQM B;  1BRH A;  2STD A;  1TTO A;  1GMR A;  3KN4 A;  3F9S A;  2CG0 A;  1Q9E A;  2CIU A;  2L4V A;  3T8N A;  4Q53 A;  5AIF A;  1ASK A;  2R41 A;  3CCR 3;  2V1L A;  1I70 A;  1IVU A;  4N6N B;  2OQE C;  1VQ6 3;  5M1A A;  4EYC A;  4RBN A;  3V92 A;  1PYL A;  6STD A;  1LRA A;  1MWR A;  1JN5 B;  2GU1 A;  3AMO B;  4MMY B;  1BGS A;  8RNT A;  1RCK A;  1EKM A;  3B8L A;  4EC6 A;  1UI7 A;  4BTY A;  1F8N A;  3NV0 A;  4XDV A;  5IER A;  1RCL A;  4R4K A;  3DH2 A;  1KSI A;  2JDI H;  1I8V A;  4LMI A;  1LOW A;  3HII A;  1SPU A;  2CWV A;  4GHO A;  1AV4 A;  5DRE A;  1IYY A;  3BNB A;  2MF7 A;  1T2H A;  3MPH A;  2B24 B;  3M8C A;  9RNT A;  1STD A;  2O9U X;  3O8Y A;  1UW1 A;  5I97 A;  1A67 A;  1BAO A;  1JZO A;  3G4S 3;  1TFK A;  3ZFZ A;  1BRJ A;  2GEY A;  2BNG A;  1OGZ A;  3NUV A;  4IPB A;  3H3H A;  5LC7 A;  2KF4 A;  4HVN A;  3IJE B;  4N6T A;  5AI1 A;  5JBS A;  4MJD A;  1IV7 A;  1JB5 A;  3BB9 A;  4IIA A;  2QGU A;  3X3Z A;  1N8R 4;  3JUO A;  4KT3 B;  3A5E A;  1VQ9 3;  3CCU 3;  4CDL A;  2PNC A;  1BSD A;  2HMO B;  3SED A;  1HU9 A;  1O7G B;  3SOA A;  1NDO B;  1BNE A;  1R4Y A;  6RNT A;  1ZGX A;  2Z77 A;  1VQM 3;  2BO9 B;  3GZB A;  1BOX A;  4HBR A;  3D79 A;  1UCJ A;  3CPO A;  4XBX A;  5IW9 A;  5STD A;  1JBS A;  3V99 A;  2BMO B;  2GXF A;  5AYS C;  2W04 A;  1WNH A;  3NV0 B;  3PXM A;  3D3L A;  1W5Z A;  1W00 A;  4HZ9 B;  2LQV A;  4OVM A;  2OTL 3;  1LOX A;  4O02 B;  3F7X A;  1RGA A;  3UB1 A;  3DGL A;  1Q86 4;  5BU4 A;  1BNG A;  2KXG A;  3HX8 A;  3N8B A;  1W4N A;  4RNT A;  3EF8 A;  3PCS A;  1FGM A;  3DXO A;  3CCE 3;  4JRF A;  2FXT A;  4I4K A;  4HM3 B;  1IT7 A;  5ELJ A;  5CXO A;  4BTX A;  1RNT A;  3OX9 A;  2RCD A;  3BU4 A;  1MWT A;  1B2U A;  1RN7 A;  3FF2 A;  2IMJ A;  1DE3 A;  1IDP A;  3B7C A;  1Q82 4;  1TP6 A;  1D6U A;  4FMD A;  1V57 A;  3X42 A;  1RLS A;  2CHC A;  3DGM A;  2K3D A;  3V98 A;  2WGQ A;  4J5G A;  2C11 A;  1B21 A;  2W2C A;  3N54 B;  1UCI A;  4FR9 A;  1Q40 B;  5D82 A;  3K9M C;  1OAC A;  2QEX 3;  2J8X B;  3EC9 A;  1MWS A;  1US1 A;  5GSP A;  3MG2 A;  1N8Q A;  2HML B;  1RN1 A;  2XGN A;  5IF6 A;  2O3O A;  4FCZ A;  4STD A;  1RJO A;  1EUI C;  5EQL A;  3X40 A;  1RDS A;  5HOH A;  1R4C A;  4L8P A;  1ZX2 A;  5EVH A;  3DY5 A;  2LYX A;  1EA2 A;  2F98 A;  1K28 A;  2I9W A;  3Q1C A;  1BU4 A;  3NQZ A;  1YVS A;  1GY6 A;  1Z1S A;  4FMB A;  4JF8 A;  3I55 3;  2HMN B;  3URP A;  1X1Y A;  1YI2 3;  1BSA A;  2F4Y A;  5AIG A;  3X3X A;  1NJI 4;  1I0V A;  2WGO A;  2CX0 A;  5DRV A;  1K41 A;  1W2B 2;  1WMO A;  1QAK A;  1BUQ A;  1V74 A;  3K7C A;  1CYV A;  1RKY A;  3PZW A;  1OGX A;  3CCV 3;  1Q42 A;  4ZM8 A;  3E99 A;  3NBJ A;  4BIR A;  3EN8 A;  1BUJ A;  1BVI A;  1HZ1 A;  1G0T A;  2D1W A;  3DGN A;  4ILF A;  2BMQ B;  4L8O A;  5KP4 A;  3DGO A;  3CC7 3;  2BMR B;  1WQL B;  3X3Y A;  1ISK A;  3BLZ A;  1RGE A;  1BNF A;  1VQO 3;  1KD1 4;  1QAL A;  3EJV A;  4R9K A;  3DGY A;  2RFR A;  1UUG B;  2ZA4 A;  2CW9 A;  3OWY A;  1GY7 A;  1W6G A;  1BRS A;  3UNL A;  1M1X B;  3HIG A;  1WTH A;  3EQQ B;  8CHO A;  1LOY A;  4FMA A;  1KWI A;  3DM8 A;  3NX0 A;  3JUP A;  5G1K A;  5AYR B;  3T0U A;  3I56 3;  4J9A A;  2H0I A;  1UDI I;  4GB5 A;  5IEN A;  5EEO A;  3DZL A;  4I5Q A;  3CCQ 3;  4KFD A;  1T3B A;  2CWT A;  4WFO A;  1GYB A;  3LT9 A;  4OUQ A;  4MEI A;  1B2Z A;  1OHP A;  5TGN A;  4GSP A;  4K61 A;  5CK6 A;  1BRI A;  2RNT A;  1NO3 A;  1YGW A;  3CCS 3;  4ORL A;  3U1W A;  1HYF A;  1FUS A;  4K1V A;  3AHS A;  4L7K A;  3KKG A;  4FCJ A;  1OHS A;  4TX4 A;  3SX1 A;  2YFJ B;  2F5M A;  3SXX A;  1LXE A;  1IU7 A;  1OUN A;  4HM7 B;  3FG1 A;  1T2I A;  1O7H B;  2BIR A;  2ZDJ A;  3X41 A;  2HOH A;  3FH1 A;  3K63 A;  3BIR A;  2ML6 A;  4N6V 0;  3CD6 3;  1OCV A;  1GD4 A;  1X1X A;  3RGR A;  1GY5 A;  2YX9 A;  1CEW I;  3L0R A;  4NPB A;  4HZB B;  4WP5 A;  3MHE A;  1Q7Y 4;  1CYU A;  3PYJ A;  2CH9 A;  4HM2 B;  2QA4 3;  1JRQ A;  3LT8 A;  2OTJ 3;  2CWU A;  4O3V A;  1VQP 3;  5G2G A;  2KAA A;  4N6M A;  3LH4 A;  4O8S A;  1C54 A;  1IVX A;  4XBT A;  1I2G A;  1B27 A;  1UCL A;  2GBW B;  2KRT A;  1RRL A;  2Y74 A;  1FYS A;  1BNI A;  1VQ4 3;  2IY2 A;  3ECF A;  4KVH A;  4AEQ A;  1L5G B;  4KZ1 A;  4H61 A;  1J2B A;  4RNY A;  4HM4 B;  5FGO A;  2CG1 A;  3NXJ A;  1ULI B;  2M7O A;  3LTB A;  1RTU A;  5IG5 A;  2C10 A;  1RN4 A;  5G1L A;  1VQK 3;  1K73 4;  1UI8 A;  1N5H A;  3VF1 A;  1I2F A;  1IQ8 A;  3KCH A;  1ZS7 A;  3UJM A;  1Q81 4;  4WWU C;  2P0X A;  1BNS A;  1GMQ A;  1JV2 B;  1EG9 B;  1IV9 A;  1UGH I;  3AHW A;  3FF0 A;  3PS8 A;  3MYT A;  1JBT A;  1EQK A;  2F99 A;  3HK4 A;  2CKF B;  4BL3 A;  4AKY A;  1N9E A;  1B20 A;  3MSO A;  4KFF A;  3G6E 3;  1LVN A;  2XFT A;  2SBL A;  2OQE A;  3JVC A;  1AY7 A;  3CCM 3;  2D42 A;  2KF6 A;  1TRQ A;  3LOY A;  1BIR A;  3KSP A;  4RZM A;  1GS3 A;  1RGC A;  4LZI A;  4N3V A;  1FGR A;  1VQQ A;  1EEJ A;  2RGQ A;  2Y73 A;  4OK0 A;  3OWS A;  2WO0 A;  4WHA A;  1T5Y A;  2FNQ A;  1YJW 3;  2XSH B;  1BNR A;  1U5O A;  1I3I A;  2XGL A;  5CLK A;  3K5T A;  1G02 A;  3OWU A;  1TFO A;  2ML5 A;  3NQY A;  1X1W A;  4WYK A;  4EV2 A;  3WDG B;  1RMS A;  2CFG A;  1FA3 A;  4N6L A;  1AQZ A;  3FG4 A;  2W9Q A;  1C7H A;  1YNV X;  2H0G A;  2UX0 A;  2WOH A;  2F5W A;  2Z6B A;  3F40 A;  3NHX A;  1W7C A;  1AVK A;  1ZO2 A;  2WOF A;  1A2V A;  2YFI B;  2P05 A;  3MKI A;  4GL6 A;  4RNZ A;  1IQY A;  1OH0 A;  1BAN A;  1M1K 4;  1G96 A;  5CF1 A;  4FCM A;  5IG0 A;  3CNM A;  3U97 A;  5A0O B;  3LML A;  2K54 A;  1D6Z A;  1VQ5 3;  3CCJ 3;  3WHO A;  1KC8 4;  1ULJ B;  3SOY A;  1JNQ A;  2OCT A;  2CFL A;  3LZA A;  3UL5 A;  3CXC 2;  7GSP A;  1NB3 I;  3MWZ A;  2IA7 A;  1STF I;  1I0X A;  4K90 B;  2CFW A;  2C4B A;  1GOU A;  3CNX A;  1B2S A;  4HOH A;  1QAF A;  2GSP A;  1AVL A;  1RGL A;  1YIJ 3;  2E2T A;  2P09 A;  4HAA A;  3CU3 A;  4BU4 A;  3EBT A;  4WYK B;  4R80 A;  2HMM B;  1A90 A;  1DMN A;  3LTC A;  4U13 A;  1UUV B;  1O7P B;  3CCL 3;  4LSO A;  3KII A;  2JQ5 A;  2HMJ B;  3GAX A;  3K0Z A;  1W2Z A;  2Z7A A;  3EX9 A;  3SVA A;  3CC2 3;  1O7M B;  2OOV C;  3QK9 A;  1JB4 A;  5BXQ A;  3WA3 A;  6GSP A;  1MNL A;  1RRH A;  2FGT A;  2BU4 A;  1NB5 I;  3G0K A;  1RNB A;  3D5G A;  4BTW A;  1CH0 A;  5IG4 A;  1OF5 A;  1E97 A;  3JUM A;  2Z76 A;  2CC3 A;  3D4A A;  3KE7 A;  4KFE A;  5AEW B;  2E2V A;  1JKG A;  3SLU A;  3ALA A;  3CPW 2;  1K9M 4;  3LYG A;  4XBY A;  4HM6 B;  3OXA A;  1MGW A;  3WOD G;  4O2H A;  3S5C A;  3GZX B;  1TJD A;  1JB2 A;  3T8U A;  5KP1 A;  3EHC A;  3AGN A;  3FKA A;  1OPY A;  2GU3 A;  1FW7 A;  4DKI A;  1FZU A;  3WA2 X;  3EN1 B;  2HMK B;  1RGF A;  5FW5 A;  3GZR A;  3TDG A;  1FUW A;  2PZV A;  2QIY A;  1DYU A;  2W0Q A;  3BND A;  2XSO B;  3F7S A;  1RGH A;  1WMN A;  1DVC A;  3S28 A;  3MG3 A;  5BIR A;  1FGQ A;  1X1U A;  3N9H A;  2Q07 A;  4IT7 A;  4R9L A;  1N9J A;  3S29 A;  2W6J H;  1IK3 A;  3NM7 A;  4HM5 B;  2GBX B;  3NBB A;  4HM8 B;  3EB8 A;  3F8H A;  3GSP A;  2MC8 A;  1FUT A;  3IMA B;  3RDE A;  2CK3 H;  3MG1 A;  4AKZ A;  2XFS A;  1UGI A;  2F56 A;  4HM1 B;  3VSY A;  1Y4K A;  1OF5 B;  1SQW A;  2YFL B;  3FGY A;  4MMZ B;  2IUJ A;  1E3R A;  7RNT A;  3VGN A;  1JKG B;  4PEJ A;  1W02 A;  1RSN A;  2W56 A;  3JUQ A;  4N6O B;  4XM4 A;  3UL6 A;  1BRN L;  5RNT A;  3WR2 A;  4FMC A;  3STD A;  5M19 A;  1MWU A;  1SIH A;  3KZT A;  1GD3 A;  2R4I A;  4XB5 A;  3KFQ C;  1Q7H A;  2OOV A;  1YJ9 3;  3FG3 A;  2RSX A;  3EBY A;  2AAE A;  3Q3F A;  4NHF A;  1BSB A;  3WMD A;  1PFP A;  3FCS B;  4X2H A;  1DMM A;  5KP3 A;  1QVF 2;  3F8X A;  1PY3 A;  4H3U A;  5IG3 A;  3PCR A;  1HKX A;  3S67 A;  3F14 A;  1B2X A;  3EE1 A;  1IVV A;  1LNH A;  1NWW A;  3ROB A;  1CQS A;  1MGR A;  4J5K A;  3J7Y d;  3GWR A;  1VZZ A;  3OW2 2;  1FGT A;  1B3S A;  1ROA A;  5AII A;  3S27 A;  1UUW B;  4EXR A;  2W03 A;  3G8Z A;  4X2O A;  1VQ8 3;  2IUK A;  1YJN 3;  1SII A;  3LTA A;  1DMQ A;  1JZD A;  2XR8 B;  5LC6 A;  3HZP A;  1Q40 A;  3LXU X;  5CF2 A;  2W56 B;  1D6Y A;  2XF3 A;  4HM0 B;  1BNJ A;  5D83 A;  1IVW A;  3WOE B;  3CC4 3;  2UUG C;  3BNE A;  1O7N B;  2CFK A;  2KF5 A;  2RBI A;  4CPK A;  5M18 A;  1A2K A;  1TUH A;  1U8C B;  3QRD A;  3GZY B;  4BL2 A;  1I3F A;  1LQG C;  1S72 3;  3FLJ A;  1IT8 A;  3HI7 A;  1S5A A;  1QVG 2;  3WOF B;  2XH9 A;  3B4P A;  4XDW A;  1LNI A;  1VQN 3;  3RNT A;  1M9G A;  3D9R A;  3IPT A;  2GEX A;  1NNV A;  2P0M A;  3RGA A;  4QWT A;  1GOV A;  4R1K A;  5JPP A;  3G16 A;  3H51 A;  4G1M B;  3SYU A;  3I0Y A;  1FGO A;  4J8T A;  4EV5 A;  4MMX B;  3JUN A;  4CCV A;  1AR0 A;  1GMP A;  5AEU B;  3BNC A;  1YIT 3;  3ER7 A;  1MOL A;  4CJN A;  1RHL A;  1GOY A;  1RGK A;  3DMC A;  4HJL B;  3LTD A;  1K8A 4;  1RGG A;  1I2E A;  1WMP A;  2L1S A;  1LOV A;  2OWP A;  3A76 A;  2H0H A;  4HKV B;  4NRE A;  4LGQ A;  5AIH A;  1OHO A;  3GRD A;  7STD A;  3FZW A;  1YGE A;  1BSC A;  1DVD A;  2ZHX B;  1A2P A;  1QMA A;  2W9P A;  4EBG A;  4N6U A;  1W01 A;  1ROV A;  3Q90 A;  2CX1 A;  3B4O A;  4EW5 A;  3CME 3;  1O7W B;  1TRP A;  2AAD A;  2XRX B;  2INX A;  1PU4 A;  3OV4 A;  1TU5 A;  1YHQ 3;  2F86 B;  2BHM A;  1JJ2 2;  1GSP A;  2IYJ A;  1NU3 A;  2UGI A;  3HOH A;  3D5I A;  5BVB A;  1VQL 3;  2SAR A;  3ZG5 A;  3G71 3;  4LEH A;  2KCD A;  1BSE A;  2BT3 A;  2XEP A;  3NM2 A;  1E3V A;  1KQS 2;  1YVB I;  2A15 A;  4K1U A;  1M90 4;  1JN5 A;  3PGB A;  3FSD A;  5IEP A;  1V58 A;  3AMO A;  3ZG0 A;  1VQ7 3;  2CFD A;  1W6Y A;  1BRG A;  1SAR A;  1BRK A;  2P38 A;  1W6C A;  1QJG A;  5D81 A;  3NBR A;  3KSE D;  1B2M A;  5IEO A; 
#chains in the Genus database with same CATH homology
 1BIR A;  1DET A;  1RGC A;  1BU4 A;  2KF3 A;  3AGO A;  1YVS A;  1JBR A;  1BNR A;  1UCK A;  1I3I A;  1BRH A;  1X1Y A;  3URP A;  2AAE A;  3Q3F A;  1BSB A;  1BSA A;  2F4Y A;  1G02 A;  1I0V A;  1TTO A;  1GMR A;  1PY3 A;  1X1W A;  1Q9E A;  1RMS A;  1B2X A;  1AQZ A;  1I70 A;  1YNV X;  2F5W A;  1MGR A;  4J5K A;  1BUJ A;  4BIR A;  1PYL A;  1BVI A;  1HZ1 A;  1LRA A;  1BAN A;  1B3S A;  8RNT A;  1BGS A;  1BNF A;  1RCK A;  1RGE A;  3DGY A;  2ZA4 A;  1BRS A;  3WHO A;  1BNJ A;  1RCL A;  3DH2 A;  1I8V A;  1LOW A;  1LOY A;  2KF5 A;  2RBI A;  4GHO A;  1IYY A;  7GSP A;  1I3F A;  1T2H A;  9RNT A;  1I0X A;  1BAO A;  2C4B A;  1B2Z A;  1GOU A;  1B2S A;  4HOH A;  1LNI A;  4GSP A;  1BRI A;  2RNT A;  1YGW A;  1BRJ A;  1RGL A;  2GSP A;  3RNT A;  2KF4 A;  4HAA A;  4BU4 A;  1HYF A;  1FUS A;  3AHS A;  1GOV A;  2F5M A;  3SYU A;  3A5E A;  1T2I A;  1BSD A;  1GMP A;  2BIR A;  6RNT A;  1BNE A;  1R4Y A;  6GSP A;  1ZGX A;  2HOH A;  3BIR A;  2BU4 A;  1RNB A;  1X1X A;  1BOX A;  3D5G A;  1UCJ A;  1CH0 A;  1RHL A;  1GOY A;  1RGK A;  3D4A A;  1JBS A;  1RGG A;  1I2E A;  1LOV A;  1MGW A;  1RGA A;  2KAA A;  5BU4 A;  1BNG A;  1BSC A;  1C54 A;  3AGN A;  4RNT A;  1I2G A;  1B27 A;  1UCL A;  1A2P A;  1FW7 A;  1FYS A;  1FZU A;  1BNI A;  1RNT A;  1RGF A;  1TRP A;  2AAD A;  3BU4 A;  1B2U A;  1RGH A;  1DE3 A;  1GSP A;  5BIR A;  3HOH A;  1X1U A;  1B2M A;  3D5I A;  1RTU A;  3WR2 A;  2SAR A;  1RN4 A;  1BSE A;  1RLS A;  1I2F A;  3GSP A;  3KCH A;  1FUT A;  4J5G A;  1B21 A;  1BNS A;  1UCI A;  1GMQ A;  3AHW A;  2F56 A;  5GSP A;  1JBT A;  1RN1 A;  1BRG A;  7RNT A;  1B20 A;  1SAR A;  1BRK A;  1BRN L;  1RDS A;  1RSN A;  5HOH A;  1AY7 A;  2KF6 A;  5RNT A;  1TRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...