2KF3A

Barnase, low pressure reference nmr structure
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Pressure-dependent structure changes in barnase on ligand binding reveal intermediate rate fluctuations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 35
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kf3A00
5BU4A 3SYUA 1LNIA 1BSDA 3AGNA 1I2GA 2RBIA 1BNRA 3D4AA 3KCHA 1Q9EA 1I0VA 2KF6A 1JBSA 1BSBA 1I3IA 1RGCA 1RN1A 4GHOA 1B27A 1BGSA 2SARA 1BNJA 1FUSA 1BRHA 1GOVA 1I2EA 1TRPA 4J5GA 1RGGA 1UCJA 2F5WA 1RGLA 1FW7A 3GSPA 2F56A 1BOXA 5HOHA 1B20A 4J5KA 1BRKA 1DE3A 1I2FA 1G02A 1RSNA 1HYFA 3DGYA 3Q3FA 1BU4A 1RGKA 3WR2A 4RNTA 1BRIA 1CH0A 1GMPA 1BRJA 3DH2A 1B2MA 1RGHA 6GSPA 1RLSA 3WHOA 2RNTA 1GMRA 7RNTA 1IYYA 1UCLA 1UCKA 2GSPA 1BRGA 1RCLA 5BIRA 1RNTA 2F4YA 1RNBA 1LOVA 3D5GA 1X1WA 1PY3A 9RNTA 1AY7A 1B2UA 1I8VA 1FUTA 1MGRA 1RGEA 2KF3A 1LRAA 2ZA4A 1ZGXA 1BUJA 4BIRA 3URPA 5RNTA 1RGFA 3BIRA 1GOYA 1BAOA 1RDSA 1T2IA 1R4YA 1BNIA 1RHLA 3D5IA 2AAEA 2KF5A 1BNGA 1AQZA 2F5MA 4HAAA 1RTUA 4HOHA 2BU4A 1BRSA 1BNSA 3A5EA 5GSPA 1RCKA 1B21A 1B2SA 1FYSA 1UCIA 1B3SA 1YVSA 3AHWA 1LOWA 3AGOA 8RNTA 3HOHA 1FZUA 1I70A 3AHSA 1GOUA 1SARA 1BNEA 1TRQA 2KAAA 1HZ1A 1TTOA 1X1UA 1X1YA 1YGWA 2C4BA 1GSPA 6RNTA 1BSAA 1RN4A 1B2XA 1BNFA 1BANA 1RGAA 1X1XA 1T2HA 1YNVX 1MGWA 2HOHA 2BIRA 1JBRA 7GSPA 1JBTA 1DETA 1PYLA 1BIRA 3RNTA 1BSEA 1BRNL 1I0XA 1B2ZA 3BU4A 1GMQA 1BSCA 1I3FA 2KF4A 4BU4A 4GSPA 1C54A 1BVIA 2AADA 1A2PA 1LOYA 1RMSA
chains in the Genus database with same CATH superfamily
2MC8A 4PEJA 1AVLA 1SPUA 3AGNA 1RJOA 3JUMA 3DGNA 3EBYA 4DKIA 4WP5A 2E2UA 4J8TA 1Q9EA 2P09A 2BO9B 1OHSA 1IVXA 1JBSA 1I3IA 5DRVA 3CMA3 1KSIA 1T3BA 3V99A 1MWUA 4MEIA 1BGSA 2R41A 3CNXA 2OTL3 1CYUA 3LTBA 2SARA 4LSOA 4R80A 2IY2A 5AIHA 1BNJA 1OPYA 3GWRA 4HM7B 1I2EA 1IQ8A 4IIAA 4IPBA 4KT3B 1BUQA 4EW5A 4G1MB 1FW7A 1HKXA 4J9AA 1G0TA 2MF7A 3GSPA 1A90A 2WO0A 1BRKA 3PXMA 4J5KA 2Z7AA 1G02A 1DVDA 1KQS2 3Q3FA 1IK3A 3OV4A 4N6LA 2D1WA 1SIIA 4RNTA 3F9SA 3X3ZA 1W2ZA 2CX0A 1B2MA 3MG1A 1QJGA 2WGOA 3U97A 2Q07A 3CXC2 1N8QA 1Q814 1JB4A 1TFOA 1UCKA 3CCM3 3D3LA 1YVBI 4O02B 1OHOA 1M904 3CCR3 1EQKA 1TUHA 3X3XA 4N3VA 2CC3A 1LOVA 2W04A 3HI7A 5ELUA 3UL6A 3I0YA 5AYSC 4EV5A 1E3VA 1AY7A 5AEUB 2M7OA 3FG4A 1I8VA 1FUTA 1LRAA 1PFPA 2HMJB 4N6TA 4R1KA 1JZDA 2A15A 3NHXA 1VZZA 2HMMB 4R9LA 3X41A 3G6E3 2B1XB 4Q53A 5KP4A 1FGOA 3D79A 3DGMA 2LYXA 2HMLB 2QGUA 1GY6A 3LH4A 5CXOA 1Q824 1STDA 4ORLA 3CD63 1BAOA 3FG1A 1FGTA 1GY5A 3UL5A 1PU4A 1R4YA 1CEWI 3SOYA 2CWUA 5IG4A 1YHQ3 1UW1A 2LQVA 2RFRA 5AIIA 5IW9A 1W5ZA 2FXTA 2AAEA 5AIFA 2KRTA 6STDA 4XDWA 1A67A 3JUNA 4X2OA 1BNGA 4H3UA 5D81A 4EYCA 1UI7A 1S5AA 4HOHA 3UB1A 4O2HA 4EBGA 1BRSA 2CWVA 3S5CA 5G1LA 3A5EA 3FGYA 1JN5A 5GSPA 1G96A 1B21A 1YIT3 1A2VA 2CFWA 1N5HA 4RNYA 2YFIB 3KSED 2ZL8A 4R4KA 3SOAA 3AGOA 5IG5A 3FF2A 3HOHA 1LQMB 1YJ93 1I70A 2F98A 5LC7A 1BNEA 2O3OA 1TRQA 3CC43 2XH9A 1ZS7A 4NREA 5FGOA 1JZOA 3S27A 2HMKB 1IT7A 2XSOB 1GSPA 3HK4A 3FF0A 1VQ53 4HM6B 3LYGA 3Q2PA 3CPOA 1OACA 4AKZA 1LOXA 1BANA 3K5TA 1X1XA 1T2HA 1IT8A 3EE1A 3NM7A 2HOHA 1Q40A 4MJDA 4STDA 7GSPA 2K54A 1TFKA 2Y74A 1VQQA 1GS3A 3G8ZA 3EF8A 1BSEA 1KWIA 2E2TA 4LYLB 2F99A 1IVUA 1Y4KA 4RBNA 1JB2A 4BU4A 3F40A 2W6JH 3AMOA 2JDIH 3FSDA 4FMBA 5JPPA 2ZHXB 2RSXA 2SBLA 3MHEA 1HYFA 5D82A 3DGLA 1E3RA 1LNIA 4FCMA 3S28A 3CU3A 3NBJA 5I97A 3FH1A 3WODG 1BNRA 1ZO2A 2P0MA 4LEHA 2XF3A 1Q864 1I0VA 2GU1A 2CFGA 1BSBA 1RGCA 1RN1A 3DXOA 3BNCA 3HZPA 1E97A 1B27A 3CPW2 3GRDA 4XBXA 1W02A 2V1LA 1JRQA 4HM5B 2WGQA 2PZVA 1FUSA 1DMQA 2OOVA 3ZG5A 1UCJA 2F5WA 2L1SA 3CCJ3 3F8HA 1YIJ3 2O9UX 3EBTA 4N6OB 3K63A 2QA43 1YJN3 1RSNA 3B4PA 5IF6A 2W9PA 1AV4A 3FG3A 1Q42A 4FMDA 3KSPA 4HM1B 4OUQA 5STDA 3EJVA 2CIUA 2STDA 3DH2A 1N9EA 4BL2A 3KIIA 1S723 1ISKA 1RLSA 3NUVA 4OVMA 1KC84 7RNTA 3SVAA 1K734 1IYYA 1QAFA 5HGRA 1O7MB 8CHOA 4HYZA 3DUKA 2CWTA 2XGNA 2XRXB 4FCJA 5BIRA 4BL3A 3E99A 1GYBA 4N6MA 1NDOB 3MG3A 2QIYA 3PGBA 3K9MC 1NWWA 4TX4A 3V92A 3X42A 5IERA 1PY3A 3B8LA 2GU3A 4IT7A 2D42A 1RGEA 3NX0A 1ZGXA 3WA3A 3KFQC 4MMXB 4KFDA 1W6GA 4BIRA 3MG2A 5AYRB 1VQL3 1D6ZA 3Q1CA 1SIHA 3IPTA 3SEDA 3BIRA 1IDPA 3VGNA 2Z76A 4O3VA 1CYVA 1IV9A 1T2IA 4H61A 1DMNA 2RCDA 1RHLA 4LZIA 1O7WB 2ZDJA 2P38A 3HIGA 3LT9A 1EA2A 1UDII 1L5GB 1AQZA 2F5MA 1AVKA 5AI1A 1RTUA 3OXAA 2K3DA 2INXA 4CPKA 1GD3A 3LZAA 3G713 1BNSA 1MWTA 3FCSB 4HM2B 1O7NB 4LGQA 1B2SA 4AKYA 1NB5I 4BTYA 3HX8A 1B3SA 3CCL3 1YVSA 3X40A 4HM3B 3AHWA 4N6UA 1M1K4 1LVNA 3KE7A 1OF5A 1OHPA 1V58A 2I9WA 2J8XB 3EB8A 3ECFA 3SX1A 1IQXA 3AHSA 1RKYA 4QWTA 1DMMA 2OQEC 4XBTA 5EQLA 3T0UA 1ULIB 3DM8A 1HZ1A 3GZXB 1TTOA 1WTHA 2XFSA 1X1UA 1YI23 5M19A 2W9QA 3QRDA 1YGWA 3BNEA 1V57A 1ROAA 3PCSA 3KKGA 3NQZA 4K1VA 2CH9A 2XFTA 3H51A 2PNCA 2XGLA 3EX9A 3MPHA 4KFEA 4L8PA 4RNZA 1NJI4 2RGQA 3B4OA 4I4KA 5A0OB 2CG0A 2CFLA 4I5QA 2CK3H 5AEWB 4AEQA 1M9GA 3X3YA 3FLJA 1W6CA 3VSYA 2IUKA 3LXUX 4CCVA 4CJNA 4GL6A 1DETA 2L4VA 2BT3A 3BNDA 3OW22 2BMRB 1M1XB 1MWRA 1I0XA 1Q7HA 1B2ZA 2YX9A 3BU4A 1UGIA 1MOLA 3O8YA 4GSPA 1WMPA 5JPUA 1WMNA 3LTAA 1OUNA 2FGTA 1DVCA 4L7KA 4WYKB 3SYUA 1FGRA 5DREA 1VQ93 3LTDA 2BNGA 3CNMA 3NV0B 4XM4A 1I2GA 1VQ63 4L8OA 2RBIA 2W03A 3D4AA 3PZWA 1JNQA 1ZX2A 3I563 3NXJA 3CME3 3ZG0A 1K8A4 1NB3I 1J2BA 4FCZA 2YFJB 1IVWA 4GHOA 3PCRA 1STFI 3JVCA 3DMCA 1VQP3 5CLKA 4EV2A 5IEOA 1K9M4 5BXQA 1RGGA 1OCVA 1VQ83 1F8NA 2IMJA 2W56B 3F7XA 3LMLA 3F7SA 3S67A 1BOXA 5HOHA 1QVF2 3GZRA 4KFFA 3DGYA 1ASKA 4XBYA 1NU3A 3K0ZA 4FR9A 3TDGA 2Z77A 5M1AA 3WR2A 1AR0A 3DY5A 4MMYB 4LMIA 3JUOA 1CH0A 1GMPA 1BRJA 3OWYA 3PYJA 1WMOA 1UUWB 1RGHA 3BLZA 3N9HA 7STDA 3G0KA 1K28A 1GMRA 2RNTA 3KN4A 4WFOA 1UCLA 4CDLA 5LC6A 1BRGA 1RCLA 3FKAA 3OWSA 3IMAB 4HBRA 1RNBA 2IA7A 1QVG2 5CF1A 3CC73 2XSHB 4U13A 9RNTA 3G4S3 2Z6BA 3OWUA 1UGHI 1MGRA 3I553 3GAXA 3F8XA 2ZA4A 3KZTA 4NPBA 1FA3A 4N6V0 2WOHA 4JF8A 2QEX3 2WOFA 1VQM3 1LQGC 2GBWB 1RDSA 4WHAA 4HKVB 3D5IA 5CK6A 1W2B2 5M18A 5ELJA 1UUGB 5IG3A 1W4NA 3DGOA 2KF5A 3V98A 3CCS3 1VQK3 2UX0A 4HZBB 1W6YA 3CCQ3 3NQYA 1U5OA 2BU4A 4WYKA 3B7CA 1HU9A 3NV0A 3ALAA 2IUJA 1EUIC 3U1WA 4ZM8A 3CCE3 1UCIA 2FNQA 4EXRA 2CKFB 1WQLB 2UUGC 1MNLA 3BNBA 1LOWA 3K7CA 8RNTA 5KP3A 2OTJ3 1FZUA 1GY7A 3ROBA 1SARA 1QAKA 2JQ5A 3WMDA 1JN5B 1ULJB 2KAAA 3HIIA 3J7Yd 2CFKA 1X1YA 4HM0B 1CQSA 2W56A 3NBBA 2GXFA 2ML6A 1UUVB 3EN8A 5G1KA 2K0MA 5CF2A 1BSAA 3N54B 1N5PA 2GEXA 1K41A 1MWSA 4WWUC 1D6YA 2CX1A 4X2HA 4O8SA 3WDGB 3RDEA 1QALA 4MMZB 3GZYB 4BTXA 1V74A 2H0GA 2HMOB 4OK0A 1JBRA 1FGQA 4GB5A 4HJLB 1BRNL 2Y73A 3VF1A 3QK9A 1GMQA 1BSCA 1I3FA 2KF4A 3IJEB 3OX9A 3RGAA 1W7CA 2H0IA 2P0XA 2AADA 2F86B 3BB9A 1RMSA 1OH0A 5BU4A 3WA2X 1BSDA 4FMAA 1OGXA 4HM4B 1Q40B 1TP6A 1NNVA 3KCHA 4XB5A 2KF6A 4K90B 1ROVA 4N6NB 3CCV3 3AMOB 1N9JA 3CCU3 1TU5A 1SJWA 1IVVA 3T8NA 5D83A 2HMNB 2P05A 2C11A 2OQEA 2OCTA 1JB5A 5EVHA 2BMOB 1FUWA 1EG9B 3GZBA 5IENA 1GOVA 1BRHA 1TRPA 4J5GA 1W00A 2W0QA 1TJDA 1RGLA 5IG0A 1O7GB 1T5YA 3M8CA 3T8UA 1JJ22 2F56A 3G16A 1B20A 4K61A 5AIGA 2IYJA 1I2FA 1VQ73 1DE3A 3FZWA 1BU4A 1RGKA 3JUQA 1OGZA 2GEYA 4XDVA 1EEJA 3WOEB 1GD4A 1BRIA 2XR8B 3STDA 2CHCA 1JKGB 2H0HA 4BTWA 4HM8B 6GSPA 1YJW3 2BMQB 2KXGA 3MYTA 1WNHA 4ILFA 2UGIA 3WHOA 2GSPA 3LOYA 5BVBA 1RNTA 2F4YA 3D5GA 3EQQB 1U8CB 4RZMA 1W01A 1YGEA 3JUPA 1X1WA 4HZ9B 1B2UA 2KCDA 1IQYA 2KF3A 3EN1B 3SXXA 1Q7Y4 1D6UA 2XEPA 1BUJA 2ML5A 3URPA 3RGRA 5RNTA 1RGFA 5JBSA 1DYUA 3F14A 3A76A 3S29A 1N8R4 5FW5A 3N8BA 5KP1A 3H3HA 5EEOA 1GOYA 4K1UA 4FMCA 1UI8A 1BNIA 1A2KA 1JV2B 2CFDA 3D9RA 3MSOA 1O7PB 1NO3A 1RN7A 5TGNA 1RRLA 4HAAA 5IEPA 1QMAA 2R4IA 4EC6A 1LXEA 3ER7A 3LT8A 3NM2A 3EC9A 1RCKA 1IV7A 1LNHA 1FYSA 1VQO3 1IU7A 2CW9A 3L0RA 4KZ1A 3Q90A 1US1A 1SQWA 1FGMA 2C10A 2W2CA 3MWZA 1GOUA 1R4CA 4HVNA 4KVHA 2YFLB 2OOVC 3UJMA 3CC23 5G2GA 3DZLA 2C4BA 4NHFA 1O7HB 6RNTA 3SLUA 1OF5B 2BHMA 2E2VA 1RN4A 1B2XA 1BNFA 3MKIA 1RGAA 3UNLA 1RRHA 1YNVX 1MGWA 2B24B 4R9KA 2BIRA 1JKGA 1KD14 4JRFA 1C7HA 2OWPA 1JBTA 1PYLA 1BIRA 3EHCA 3NBRA 1EKMA 3PS8A 3RNTA 1TIJA 3LTCA 1VQN3 1C54A 2GBXB 1Z1SA 1BVIA 1VQ43 2CG1A 3WOFB 1A2PA 1LOYA 3ZFZA
chains in the Genus database with same CATH topology
5BU4A 3SYUA 1LNIA 1BSDA 3AGNA 1I2GA 2RBIA 1BNRA 3D4AA 3KCHA 1Q9EA 1I0VA 2KF6A 1JBSA 1BSBA 1I3IA 1RGCA 1RN1A 4GHOA 1B27A 1BGSA 2SARA 1BNJA 1FUSA 1BRHA 1GOVA 1I2EA 1TRPA 4J5GA 1RGGA 1UCJA 2F5WA 1RGLA 1FW7A 3GSPA 2F56A 1BOXA 5HOHA 1B20A 4J5KA 1BRKA 1DE3A 1I2FA 1G02A 1RSNA 1HYFA 3DGYA 3Q3FA 1BU4A 1RGKA 3WR2A 4RNTA 1BRIA 1CH0A 1GMPA 1BRJA 3DH2A 1B2MA 1RGHA 6GSPA 1RLSA 3WHOA 2RNTA 1GMRA 7RNTA 1IYYA 1UCLA 1UCKA 2GSPA 1BRGA 1RCLA 5BIRA 1RNTA 2F4YA 1RNBA 1LOVA 3D5GA 1X1WA 1PY3A 9RNTA 1AY7A 1B2UA 1I8VA 1FUTA 1MGRA 1RGEA 2KF3A 1LRAA 2ZA4A 1ZGXA 1BUJA 4BIRA 3URPA 5RNTA 1RGFA 3BIRA 1GOYA 1BAOA 1RDSA 1T2IA 1R4YA 1BNIA 1RHLA 3D5IA 2AAEA 2KF5A 1BNGA 1AQZA 2F5MA 4HAAA 1RTUA 4HOHA 2BU4A 1BRSA 1BNSA 3A5EA 5GSPA 1RCKA 1B21A 1B2SA 1FYSA 1UCIA 1B3SA 1YVSA 3AHWA 1LOWA 3AGOA 8RNTA 3HOHA 1FZUA 1I70A 3AHSA 1GOUA 1SARA 1BNEA 1TRQA 2KAAA 1HZ1A 1TTOA 1X1UA 1X1YA 1YGWA 2C4BA 1GSPA 6RNTA 1BSAA 1RN4A 1B2XA 1BNFA 1BANA 1RGAA 1X1XA 1T2HA 1YNVX 1MGWA 2HOHA 2BIRA 1JBRA 7GSPA 1JBTA 1DETA 1PYLA 1BIRA 3RNTA 1BSEA 1BRNL 1I0XA 1B2ZA 3BU4A 1GMQA 1BSCA 1I3FA 2KF4A 4BU4A 4GSPA 1C54A 1BVIA 2AADA 1A2PA 1LOYA 1RMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BU4 A;  3SYU A;  1LNI A;  1BSD A;  3AGN A;  1I2G A;  2RBI A;  1BNR A;  3D4A A;  3KCH A;  1Q9E A;  1I0V A;  2KF6 A;  1JBS A;  1BSB A;  1I3I A;  1RGC A;  1RN1 A;  4GHO A;  1B27 A;  1BGS A;  2SAR A;  1BNJ A;  1FUS A;  1BRH A;  1GOV A;  1I2E A;  1TRP A;  4J5G A;  1RGG A;  1UCJ A;  2F5W A;  1RGL A;  1FW7 A;  3GSP A;  2F56 A;  1BOX A;  5HOH A;  1B20 A;  4J5K A;  1BRK A;  1DE3 A;  1I2F A;  1G02 A;  1RSN A;  1HYF A;  3DGY A;  3Q3F A;  1BU4 A;  1RGK A;  3WR2 A;  4RNT A;  1BRI A;  1CH0 A;  1GMP A;  1BRJ A;  3DH2 A;  1B2M A;  1RGH A;  6GSP A;  1RLS A;  3WHO A;  2RNT A;  1GMR A;  7RNT A;  1IYY A;  1UCL A;  1UCK A;  2GSP A;  1BRG A;  1RCL A;  5BIR A;  1RNT A;  2F4Y A;  1RNB A;  1LOV A;  3D5G A;  1X1W A;  1PY3 A;  9RNT A;  1AY7 A;  1B2U A;  1I8V A;  1FUT A;  1MGR A;  1RGE A;  2KF3 A;  1LRA A;  2ZA4 A;  1ZGX A;  1BUJ A;  4BIR A;  3URP A;  5RNT A;  1RGF A;  3BIR A;  1GOY A;  1BAO A;  1RDS A;  1T2I A;  1R4Y A;  1BNI A;  1RHL A;  3D5I A;  2AAE A;  2KF5 A;  1BNG A;  1AQZ A;  2F5M A;  4HAA A;  1RTU A;  4HOH A;  2BU4 A;  1BRS A;  1BNS A;  3A5E A;  5GSP A;  1RCK A;  1B21 A;  1B2S A;  1FYS A;  1UCI A;  1B3S A;  1YVS A;  3AHW A;  1LOW A;  3AGO A;  8RNT A;  3HOH A;  1FZU A;  1I70 A;  3AHS A;  1GOU A;  1SAR A;  1BNE A;  1TRQ A;  2KAA A;  1HZ1 A;  1TTO A;  1X1U A;  1X1Y A;  1YGW A;  2C4B A;  1GSP A;  6RNT A;  1BSA A;  1RN4 A;  1B2X A;  1BNF A;  1BAN A;  1RGA A;  1X1X A;  1T2H A;  1YNV X;  1MGW A;  2HOH A;  2BIR A;  1JBR A;  7GSP A;  1JBT A;  1DET A;  1PYL A;  1BIR A;  3RNT A;  1BSE A;  1BRN L;  1I0X A;  1B2Z A;  3BU4 A;  1GMQ A;  1BSC A;  1I3F A;  2KF4 A;  4BU4 A;  4GSP A;  1C54 A;  1BVI A;  2AAD A;  1A2P A;  1LOY A;  1RMS A; 
#chains in the Genus database with same CATH topology
 2MC8 A;  4PEJ A;  1AVL A;  1SPU A;  3AGN A;  1RJO A;  3JUM A;  3DGN A;  3EBY A;  4DKI A;  4WP5 A;  2E2U A;  4J8T A;  1Q9E A;  2P09 A;  2BO9 B;  1OHS A;  1IVX A;  1JBS A;  1I3I A;  5DRV A;  3CMA 3;  1KSI A;  1T3B A;  3V99 A;  1MWU A;  4MEI A;  1BGS A;  2R41 A;  3CNX A;  2OTL 3;  1CYU A;  3LTB A;  2SAR A;  4LSO A;  4R80 A;  2IY2 A;  5AIH A;  1BNJ A;  1OPY A;  3GWR A;  4HM7 B;  1I2E A;  1IQ8 A;  4IIA A;  4IPB A;  4KT3 B;  1BUQ A;  4EW5 A;  4G1M B;  1FW7 A;  1HKX A;  4J9A A;  1G0T A;  2MF7 A;  3GSP A;  1A90 A;  2WO0 A;  1BRK A;  3PXM A;  4J5K A;  2Z7A A;  1G02 A;  1DVD A;  1KQS 2;  3Q3F A;  1IK3 A;  3OV4 A;  4N6L A;  2D1W A;  1SII A;  4RNT A;  3F9S A;  3X3Z A;  1W2Z A;  2CX0 A;  1B2M A;  3MG1 A;  1QJG A;  2WGO A;  3U97 A;  2Q07 A;  3CXC 2;  1N8Q A;  1Q81 4;  1JB4 A;  1TFO A;  1UCK A;  3CCM 3;  3D3L A;  1YVB I;  4O02 B;  1OHO A;  1M90 4;  3CCR 3;  1EQK A;  1TUH A;  3X3X A;  4N3V A;  2CC3 A;  1LOV A;  2W04 A;  3HI7 A;  5ELU A;  3UL6 A;  3I0Y A;  5AYS C;  4EV5 A;  1E3V A;  1AY7 A;  5AEU B;  2M7O A;  3FG4 A;  1I8V A;  1FUT A;  1LRA A;  1PFP A;  2HMJ B;  4N6T A;  4R1K A;  1JZD A;  2A15 A;  3NHX A;  1VZZ A;  2HMM B;  4R9L A;  3X41 A;  3G6E 3;  2B1X B;  4Q53 A;  5KP4 A;  1FGO A;  3D79 A;  3DGM A;  2LYX A;  2HML B;  2QGU A;  1GY6 A;  3LH4 A;  5CXO A;  1Q82 4;  1STD A;  4ORL A;  3CD6 3;  1BAO A;  3FG1 A;  1FGT A;  1GY5 A;  3UL5 A;  1PU4 A;  1R4Y A;  1CEW I;  3SOY A;  2CWU A;  5IG4 A;  1YHQ 3;  1UW1 A;  2LQV A;  2RFR A;  5AII A;  5IW9 A;  1W5Z A;  2FXT A;  2AAE A;  5AIF A;  2KRT A;  6STD A;  4XDW A;  1A67 A;  3JUN A;  4X2O A;  1BNG A;  4H3U A;  5D81 A;  4EYC A;  1UI7 A;  1S5A A;  4HOH A;  3UB1 A;  4O2H A;  4EBG A;  1BRS A;  2CWV A;  3S5C A;  5G1L A;  3A5E A;  3FGY A;  1JN5 A;  5GSP A;  1G96 A;  1B21 A;  1YIT 3;  1A2V A;  2CFW A;  1N5H A;  4RNY A;  2YFI B;  3KSE D;  2ZL8 A;  4R4K A;  3SOA A;  3AGO A;  5IG5 A;  3FF2 A;  3HOH A;  1LQM B;  1YJ9 3;  1I70 A;  2F98 A;  5LC7 A;  1BNE A;  2O3O A;  1TRQ A;  3CC4 3;  2XH9 A;  1ZS7 A;  4NRE A;  5FGO A;  1JZO A;  3S27 A;  2HMK B;  1IT7 A;  2XSO B;  1GSP A;  3HK4 A;  3FF0 A;  1VQ5 3;  4HM6 B;  3LYG A;  3Q2P A;  3CPO A;  1OAC A;  4AKZ A;  1LOX A;  1BAN A;  3K5T A;  1X1X A;  1T2H A;  1IT8 A;  3EE1 A;  3NM7 A;  2HOH A;  1Q40 A;  4MJD A;  4STD A;  7GSP A;  2K54 A;  1TFK A;  2Y74 A;  1VQQ A;  1GS3 A;  3G8Z A;  3EF8 A;  1BSE A;  1KWI A;  2E2T A;  4LYL B;  2F99 A;  1IVU A;  1Y4K A;  4RBN A;  1JB2 A;  4BU4 A;  3F40 A;  2W6J H;  3AMO A;  2JDI H;  3FSD A;  4FMB A;  5JPP A;  2ZHX B;  2RSX A;  2SBL A;  3MHE A;  1HYF A;  5D82 A;  3DGL A;  1E3R A;  1LNI A;  4FCM A;  3S28 A;  3CU3 A;  3NBJ A;  5I97 A;  3FH1 A;  3WOD G;  1BNR A;  1ZO2 A;  2P0M A;  4LEH A;  2XF3 A;  1Q86 4;  1I0V A;  2GU1 A;  2CFG A;  1BSB A;  1RGC A;  1RN1 A;  3DXO A;  3BNC A;  3HZP A;  1E97 A;  1B27 A;  3CPW 2;  3GRD A;  4XBX A;  1W02 A;  2V1L A;  1JRQ A;  4HM5 B;  2WGQ A;  2PZV A;  1FUS A;  1DMQ A;  2OOV A;  3ZG5 A;  1UCJ A;  2F5W A;  2L1S A;  3CCJ 3;  3F8H A;  1YIJ 3;  2O9U X;  3EBT A;  4N6O B;  3K63 A;  2QA4 3;  1YJN 3;  1RSN A;  3B4P A;  5IF6 A;  2W9P A;  1AV4 A;  3FG3 A;  1Q42 A;  4FMD A;  3KSP A;  4HM1 B;  4OUQ A;  5STD A;  3EJV A;  2CIU A;  2STD A;  3DH2 A;  1N9E A;  4BL2 A;  3KII A;  1S72 3;  1ISK A;  1RLS A;  3NUV A;  4OVM A;  1KC8 4;  7RNT A;  3SVA A;  1K73 4;  1IYY A;  1QAF A;  5HGR A;  1O7M B;  8CHO A;  4HYZ A;  3DUK A;  2CWT A;  2XGN A;  2XRX B;  4FCJ A;  5BIR A;  4BL3 A;  3E99 A;  1GYB A;  4N6M A;  1NDO B;  3MG3 A;  2QIY A;  3PGB A;  3K9M C;  1NWW A;  4TX4 A;  3V92 A;  3X42 A;  5IER A;  1PY3 A;  3B8L A;  2GU3 A;  4IT7 A;  2D42 A;  1RGE A;  3NX0 A;  1ZGX A;  3WA3 A;  3KFQ C;  4MMX B;  4KFD A;  1W6G A;  4BIR A;  3MG2 A;  5AYR B;  1VQL 3;  1D6Z A;  3Q1C A;  1SIH A;  3IPT A;  3SED A;  3BIR A;  1IDP A;  3VGN A;  2Z76 A;  4O3V A;  1CYV A;  1IV9 A;  1T2I A;  4H61 A;  1DMN A;  2RCD A;  1RHL A;  4LZI A;  1O7W B;  2ZDJ A;  2P38 A;  3HIG A;  3LT9 A;  1EA2 A;  1UDI I;  1L5G B;  1AQZ A;  2F5M A;  1AVK A;  5AI1 A;  1RTU A;  3OXA A;  2K3D A;  2INX A;  4CPK A;  1GD3 A;  3LZA A;  3G71 3;  1BNS A;  1MWT A;  3FCS B;  4HM2 B;  1O7N B;  4LGQ A;  1B2S A;  4AKY A;  1NB5 I;  4BTY A;  3HX8 A;  1B3S A;  3CCL 3;  1YVS A;  3X40 A;  4HM3 B;  3AHW A;  4N6U A;  1M1K 4;  1LVN A;  3KE7 A;  1OF5 A;  1OHP A;  1V58 A;  2I9W A;  2J8X B;  3EB8 A;  3ECF A;  3SX1 A;  1IQX A;  3AHS A;  1RKY A;  4QWT A;  1DMM A;  2OQE C;  4XBT A;  5EQL A;  3T0U A;  1ULI B;  3DM8 A;  1HZ1 A;  3GZX B;  1TTO A;  1WTH A;  2XFS A;  1X1U A;  1YI2 3;  5M19 A;  2W9Q A;  3QRD A;  1YGW A;  3BNE A;  1V57 A;  1ROA A;  3PCS A;  3KKG A;  3NQZ A;  4K1V A;  2CH9 A;  2XFT A;  3H51 A;  2PNC A;  2XGL A;  3EX9 A;  3MPH A;  4KFE A;  4L8P A;  4RNZ A;  1NJI 4;  2RGQ A;  3B4O A;  4I4K A;  5A0O B;  2CG0 A;  2CFL A;  4I5Q A;  2CK3 H;  5AEW B;  4AEQ A;  1M9G A;  3X3Y A;  3FLJ A;  1W6C A;  3VSY A;  2IUK A;  3LXU X;  4CCV A;  4CJN A;  4GL6 A;  1DET A;  2L4V A;  2BT3 A;  3BND A;  3OW2 2;  2BMR B;  1M1X B;  1MWR A;  1I0X A;  1Q7H A;  1B2Z A;  2YX9 A;  3BU4 A;  1UGI A;  1MOL A;  3O8Y A;  4GSP A;  1WMP A;  5JPU A;  1WMN A;  3LTA A;  1OUN A;  2FGT A;  1DVC A;  4L7K A;  4WYK B;  3SYU A;  1FGR A;  5DRE A;  1VQ9 3;  3LTD A;  2BNG A;  3CNM A;  3NV0 B;  4XM4 A;  1I2G A;  1VQ6 3;  4L8O A;  2RBI A;  2W03 A;  3D4A A;  3PZW A;  1JNQ A;  1ZX2 A;  3I56 3;  3NXJ A;  3CME 3;  3ZG0 A;  1K8A 4;  1NB3 I;  1J2B A;  4FCZ A;  2YFJ B;  1IVW A;  4GHO A;  3PCR A;  1STF I;  3JVC A;  3DMC A;  1VQP 3;  5CLK A;  4EV2 A;  5IEO A;  1K9M 4;  5BXQ A;  1RGG A;  1OCV A;  1VQ8 3;  1F8N A;  2IMJ A;  2W56 B;  3F7X A;  3LML A;  3F7S A;  3S67 A;  1BOX A;  5HOH A;  1QVF 2;  3GZR A;  4KFF A;  3DGY A;  1ASK A;  4XBY A;  1NU3 A;  3K0Z A;  4FR9 A;  3TDG A;  2Z77 A;  5M1A A;  3WR2 A;  1AR0 A;  3DY5 A;  4MMY B;  4LMI A;  3JUO A;  1CH0 A;  1GMP A;  1BRJ A;  3OWY A;  3PYJ A;  1WMO A;  1UUW B;  1RGH A;  3BLZ A;  3N9H A;  7STD A;  3G0K A;  1K28 A;  1GMR A;  2RNT A;  3KN4 A;  4WFO A;  1UCL A;  4CDL A;  5LC6 A;  1BRG A;  1RCL A;  3FKA A;  3OWS A;  3IMA B;  4HBR A;  1RNB A;  2IA7 A;  1QVG 2;  5CF1 A;  3CC7 3;  2XSH B;  4U13 A;  9RNT A;  3G4S 3;  2Z6B A;  3OWU A;  1UGH I;  1MGR A;  3I55 3;  3GAX A;  3F8X A;  2ZA4 A;  3KZT A;  4NPB A;  1FA3 A;  4N6V 0;  2WOH A;  4JF8 A;  2QEX 3;  2WOF A;  1VQM 3;  1LQG C;  2GBW B;  1RDS A;  4WHA A;  4HKV B;  3D5I A;  5CK6 A;  1W2B 2;  5M18 A;  5ELJ A;  1UUG B;  5IG3 A;  1W4N A;  3DGO A;  2KF5 A;  3V98 A;  3CCS 3;  1VQK 3;  2UX0 A;  4HZB B;  1W6Y A;  3CCQ 3;  3NQY A;  1U5O A;  2BU4 A;  4WYK A;  3B7C A;  1HU9 A;  3NV0 A;  3ALA A;  2IUJ A;  1EUI C;  3U1W A;  4ZM8 A;  3CCE 3;  1UCI A;  2FNQ A;  4EXR A;  2CKF B;  1WQL B;  2UUG C;  1MNL A;  3BNB A;  1LOW A;  3K7C A;  8RNT A;  5KP3 A;  2OTJ 3;  1FZU A;  1GY7 A;  3ROB A;  1SAR A;  1QAK A;  2JQ5 A;  3WMD A;  1JN5 B;  1ULJ B;  2KAA A;  3HII A;  3J7Y d;  2CFK A;  1X1Y A;  4HM0 B;  1CQS A;  2W56 A;  3NBB A;  2GXF A;  2ML6 A;  1UUV B;  3EN8 A;  5G1K A;  2K0M A;  5CF2 A;  1BSA A;  3N54 B;  1N5P A;  2GEX A;  1K41 A;  1MWS A;  4WWU C;  1D6Y A;  2CX1 A;  4X2H A;  4O8S A;  3WDG B;  3RDE A;  1QAL A;  4MMZ B;  3GZY B;  4BTX A;  1V74 A;  2H0G A;  2HMO B;  4OK0 A;  1JBR A;  1FGQ A;  4GB5 A;  4HJL B;  1BRN L;  2Y73 A;  3VF1 A;  3QK9 A;  1GMQ A;  1BSC A;  1I3F A;  2KF4 A;  3IJE B;  3OX9 A;  3RGA A;  1W7C A;  2H0I A;  2P0X A;  2AAD A;  2F86 B;  3BB9 A;  1RMS A;  1OH0 A;  5BU4 A;  3WA2 X;  1BSD A;  4FMA A;  1OGX A;  4HM4 B;  1Q40 B;  1TP6 A;  1NNV A;  3KCH A;  4XB5 A;  2KF6 A;  4K90 B;  1ROV A;  4N6N B;  3CCV 3;  3AMO B;  1N9J A;  3CCU 3;  1TU5 A;  1SJW A;  1IVV A;  3T8N A;  5D83 A;  2HMN B;  2P05 A;  2C11 A;  2OQE A;  2OCT A;  1JB5 A;  5EVH A;  2BMO B;  1FUW A;  1EG9 B;  3GZB A;  5IEN A;  1GOV A;  1BRH A;  1TRP A;  4J5G A;  1W00 A;  2W0Q A;  1TJD A;  1RGL A;  5IG0 A;  1O7G B;  1T5Y A;  3M8C A;  3T8U A;  1JJ2 2;  2F56 A;  3G16 A;  1B20 A;  4K61 A;  5AIG A;  2IYJ A;  1I2F A;  1VQ7 3;  1DE3 A;  3FZW A;  1BU4 A;  1RGK A;  3JUQ A;  1OGZ A;  2GEY A;  4XDV A;  1EEJ A;  3WOE B;  1GD4 A;  1BRI A;  2XR8 B;  3STD A;  2CHC A;  1JKG B;  2H0H A;  4BTW A;  4HM8 B;  6GSP A;  1YJW 3;  2BMQ B;  2KXG A;  3MYT A;  1WNH A;  4ILF A;  2UGI A;  3WHO A;  2GSP A;  3LOY A;  5BVB A;  1RNT A;  2F4Y A;  3D5G A;  3EQQ B;  1U8C B;  4RZM A;  1W01 A;  1YGE A;  3JUP A;  1X1W A;  4HZ9 B;  1B2U A;  2KCD A;  1IQY A;  2KF3 A;  3EN1 B;  3SXX A;  1Q7Y 4;  1D6U A;  2XEP A;  1BUJ A;  2ML5 A;  3URP A;  3RGR A;  5RNT A;  1RGF A;  5JBS A;  1DYU A;  3F14 A;  3A76 A;  3S29 A;  1N8R 4;  5FW5 A;  3N8B A;  5KP1 A;  3H3H A;  5EEO A;  1GOY A;  4K1U A;  4FMC A;  1UI8 A;  1BNI A;  1A2K A;  1JV2 B;  2CFD A;  3D9R A;  3MSO A;  1O7P B;  1NO3 A;  1RN7 A;  5TGN A;  1RRL A;  4HAA A;  5IEP A;  1QMA A;  2R4I A;  4EC6 A;  1LXE A;  3ER7 A;  3LT8 A;  3NM2 A;  3EC9 A;  1RCK A;  1IV7 A;  1LNH A;  1FYS A;  1VQO 3;  1IU7 A;  2CW9 A;  3L0R A;  4KZ1 A;  3Q90 A;  1US1 A;  1SQW A;  1FGM A;  2C10 A;  2W2C A;  3MWZ A;  1GOU A;  1R4C A;  4HVN A;  4KVH A;  2YFL B;  2OOV C;  3UJM A;  3CC2 3;  5G2G A;  3DZL A;  2C4B A;  4NHF A;  1O7H B;  6RNT A;  3SLU A;  1OF5 B;  2BHM A;  2E2V A;  1RN4 A;  1B2X A;  1BNF A;  3MKI A;  1RGA A;  3UNL A;  1RRH A;  1YNV X;  1MGW A;  2B24 B;  4R9K A;  2BIR A;  1JKG A;  1KD1 4;  4JRF A;  1C7H A;  2OWP A;  1JBT A;  1PYL A;  1BIR A;  3EHC A;  3NBR A;  1EKM A;  3PS8 A;  3RNT A;  1TIJ A;  3LTC A;  1VQN 3;  1C54 A;  2GBX B;  1Z1S A;  1BVI A;  1VQ4 3;  2CG1 A;  3WOF B;  1A2P A;  1LOY A;  3ZFZ A; 
#chains in the Genus database with same CATH homology
 5BU4 A;  3SYU A;  1LNI A;  1BSD A;  3AGN A;  1I2G A;  2RBI A;  1BNR A;  3D4A A;  3KCH A;  1Q9E A;  1I0V A;  2KF6 A;  1JBS A;  1BSB A;  1I3I A;  1RGC A;  1RN1 A;  4GHO A;  1B27 A;  1BGS A;  2SAR A;  1BNJ A;  1FUS A;  1BRH A;  1GOV A;  1I2E A;  1TRP A;  4J5G A;  1RGG A;  1UCJ A;  2F5W A;  1RGL A;  1FW7 A;  3GSP A;  2F56 A;  1BOX A;  5HOH A;  1B20 A;  4J5K A;  1BRK A;  1DE3 A;  1I2F A;  1G02 A;  1RSN A;  1HYF A;  3DGY A;  3Q3F A;  1BU4 A;  1RGK A;  3WR2 A;  4RNT A;  1BRI A;  1CH0 A;  1GMP A;  1BRJ A;  3DH2 A;  1B2M A;  1RGH A;  6GSP A;  1RLS A;  3WHO A;  2RNT A;  1GMR A;  7RNT A;  1IYY A;  1UCL A;  1UCK A;  2GSP A;  1BRG A;  1RCL A;  5BIR A;  1RNT A;  2F4Y A;  1RNB A;  1LOV A;  3D5G A;  1X1W A;  1PY3 A;  9RNT A;  1AY7 A;  1B2U A;  1I8V A;  1FUT A;  1MGR A;  1RGE A;  2KF3 A;  1LRA A;  2ZA4 A;  1ZGX A;  1BUJ A;  4BIR A;  3URP A;  5RNT A;  1RGF A;  3BIR A;  1GOY A;  1BAO A;  1RDS A;  1T2I A;  1R4Y A;  1BNI A;  1RHL A;  3D5I A;  2AAE A;  2KF5 A;  1BNG A;  1AQZ A;  2F5M A;  4HAA A;  1RTU A;  4HOH A;  2BU4 A;  1BRS A;  1BNS A;  3A5E A;  5GSP A;  1RCK A;  1B21 A;  1B2S A;  1FYS A;  1UCI A;  1B3S A;  1YVS A;  3AHW A;  1LOW A;  3AGO A;  8RNT A;  3HOH A;  1FZU A;  1I70 A;  3AHS A;  1GOU A;  1SAR A;  1BNE A;  1TRQ A;  2KAA A;  1HZ1 A;  1TTO A;  1X1U A;  1X1Y A;  1YGW A;  2C4B A;  1GSP A;  6RNT A;  1BSA A;  1RN4 A;  1B2X A;  1BNF A;  1BAN A;  1RGA A;  1X1X A;  1T2H A;  1YNV X;  1MGW A;  2HOH A;  2BIR A;  1JBR A;  7GSP A;  1JBT A;  1DET A;  1PYL A;  1BIR A;  3RNT A;  1BSE A;  1BRN L;  1I0X A;  1B2Z A;  3BU4 A;  1GMQ A;  1BSC A;  1I3F A;  2KF4 A;  4BU4 A;  4GSP A;  1C54 A;  1BVI A;  2AAD A;  1A2P A;  1LOY A;  1RMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...