2KFDA

Prp40 ff4 domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
b'NERRILEQKKHYFWLLLQRTYTKTGKPKPSTWDLASKELGESLEYKALGDEDNIRRQIFEDFKPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-processing protein PRP40
publication title Solution structure of the fourth FF domain of yeast Prp40 splicing factor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
total genus 20
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2kfdA00
2B7EA 2JUCA 2KISA 2L9VA 2KFDA 4FQGA 2KZGA 2K85A 2DOFA 2KIQA 2LKSA 2CQNA 2DODA 1UZCA 2E71A 2DOEA
chains in the Genus database with same CATH superfamily
1IUFA 3K4LA 1BBYA 3K7AJ 1T56A 1IN6A 2L3DA 3L09A 3WU1B 3RQIA 2WWYA 2JPCA 1MBGA 3K4CA 2ZJPF 4LG0B 3LA3A 1KGSA 4HW0A 4KYWA 3NAUA 4D5CA 2Y9YA 2VKHA 5IY5H 1U0JA 1YX5A 2I5UA 1U5TB 1X1PA 3TP3A 1FLIA 4BNCA 4AUXA 2AQFA 2O6GE 3FF5A 3I53A 1F43A 1GVJA 3F6OA 1D5VA 4I0BA 2XROA 5HLGA 2R5ZA 4P5OA 2VONA 1TBXA 4UVAA 3S15J 4IHSA 5F1JA 2P5VA 5KK1A 2D1HA 2GA1A 2X51A 3NWSA 1GDTA 2EV6A 5BOXA 1OR7C 6PAXA 3HM5A 2ZBKA 2AHQA 2VPLA 2ADUA 2HQ5A 2F4MB 4A3CJ 4A5MA 1M1EB 1I27A 3ZQFA 2I10A 2YX4A 3AG3H 3L9FA 4B47A 2HVRA 3CMMA 1D8JA 4MTDA 1U9NA 1CQTA 3AKZA 2FQ4A 1PUEE 3QOPA 1SEUA 4ZJZA 4XLEA 1T95A 2DJIA 1KU3A 4M3EA 4IRIA 1IN4A 1R9TJ 2E5ZA 2QYOA 2FF4A 2ZC2A 1OFCX 1XCBA 4G94A 5K7HA 3G6EI 4FT8A 2H8RA 3I54A 1IRGA 2PEXA 3SZPA 4A3EJ 1MMDA 2FBKA 1R5ID 2K9SA 4M3GA 1YIJI 5FKKA 3K70C 4IQ4A 4C2UA 5FD6A 1J59A 3BCAA 1OCTC 2GXGA 2K4JA 4I2OA 2GLOA 1R71A 1D3YA 1K6YA 3PNYA 2PQ8A 2GQQA 1R22A 1E3PA 4UVCA 3I4NJ 1K6OA 4XORA 2M4KA 1FBSA 2X48A 3CJTB 3F0CA 5F0CA 5E1ZB 2OZUA 4HAMA 3ELKA 3FDYA 2MFZA 1W5TA 1P4AA 2OZ6A 3PFYA 2Q1ZB 4XKBA 4RLQA 2GAUA 1WRJA 4XN0A 3EUKL 5HVQC 5IPAA 1O3TA 1E2XA 4JYKA 2RV8A 3BR0A 3I58A 3M8JA 2R7SA 2N8GA 3FZVA 3D5SC 4JOMA 3SDBA 4EM1A 3G1LA 4PFOA 4J01A 2IS4A 3FXKA 3IAS2 3ERMA 2MSYA 5HDGA 3VWBA 3M07A 3LSJA 4BXXJ 4XLHA 4BUPA 4BACA 1IG7A 2JT1A 2P5LC 1B6AA 2NAZA 1R58A 2EQRA 1GVDA 1LDJA 3OYFA 3QU3A 2R5YA 3DU5A 3QYBA 4F92B 3HL2A 4RMNA 3V7SA 3HG9A 3E6DA 3RPUA 3OYLA 4CCNA 5FLXZ 3BR5A 3HHHA 2QVOA 3H1CA 3LFKA 4ZZLA 2V4JC 3K9TA 1ZYRF 2O9LA 1R1VA 4BE1A 4U7BA 1YO5C 2IVMA 4CCLA 2DK8A 4LK0F 2EBIA 4GYGA 2L2OA 2O7OA 3R0JA 4HDUA 3VYTB 5D4RA 3S1NJ 4LOCA 3MWMA 5FKNA 4AVPA 2DFHA 4RAYA 1C0WA 1A35A 2F4IA 2VXDA 3FXMA 3FHZA 3ASNH 2DLLA 1DGRM 3EUAA 3I64A 4CA0A 3GYHX 3F3XA 1WJFA 1X19A 1U9OA 1RI7A 1XSVA 4YIIA 3HEFA 4G7HF 1TNTA 2R7WA 3DTEA 2JA7J 2M1BA 2XGCA 4OWRB 2CQQA 4E7ZA 4E7SA 1RR8C 2HPIA 2DODA 3GFIA 1QZEA 3WTUC 4B48A 4E7IA 3JAMK 1DDNA 1AA7A 5DUKA 4QLCU 3CJNA 1RUOA 1B59A 2FXAA 5E3OA 3ZGKA 5H2FC 1D8KA 1F1ZA 2HGCA 3U9GA 5D5XB 2DMPA 2Y0SN 3MAJA 2DYRH 1TLHB 4MIMA 5L3DA 1D1BA 3WG7H 1BOBA 4LIVA 4BHCA 2X6YA 3H0DA 2ZJRF 4KA4A 5M3MJ 1BM9A 2DI3A 4EV0A 1B4AA 2IBDA 2KRHA 2L7ZA 2KQRA 2JN6A 5DCFA 4BYYA 3SJMA 1XGOA 2CV2A 2IP2A 2XIGA 1R4NB 3TKYA 3OS1A 4L9JA 1A36A 5LHIA 4Y3OA 2R93J 5JVGF 1V5FA 1EH6A 2R7FA 5E8IA 3OYCA 1LEBA 2KIQA 3W6JB 1LVAA 4L9TA 4Y17A 1F5TA 3DV8A 2G0EA 1N78A 2DA4A 1P92A 3LL7A 1P4XA 2CW8A 2M2EA 3E5QA 3VDXA 2STWA 3BTIA 2L9RA 3EETA 2QSGX 4HX4A 1T39A 4D1QA 4XR6A 3OYIA 4M9ZA 1EH8A 5J3LA 5DUIA 4KT6A 1R1UA 2PMZA 4G7OF 2HDCA 2COMA 2KL4A 3D0SA 3NWTA 5E1WA 3OYGA 1D5YA 4NBQA 1YS6A 1AWCA 1IN7A 4B1RA 1QHHD 4V2FA 4F93B 2OCCH 1RESA 4Q5SF 2LR8A 1O3QA 3RSNA 3H0GJ 3WGGA 2KHMA 5H6RA 4KN7X 4IO9F 4EJOA 2MLKA 1IJWC 2VT2A 4ABZA 1DQUA 3BJ6A 4KJZA 4LG0A 1BL0A 2EA4A 5CVIA 2E1MB 3ZQLA 4GYIA 2ZMEC 2X6XA 3V7RA 1W5SA 2DBBA 1IZ1A 1U5TA 1G2HA 3S3OA 4XLCA 1FYKA 4A3GJ 2M0CA 2KIFA 2X0LA 3F22A 2WY7Q 5DTDA 5D5UB 1SFOJ 1K7AA 5FLVA 2E1NA 3DQVC 1BR2A 2UXNA 1Y1VJ 3S32A 4XKCA 3J7ZI 3BR6A 1VF9A 2MYSA 3JW4A 4IL6C 1OQYA 3VSKA 5J1UA 4HSRA 2W25A 4IHWA 1HKSA 5D6EA 2FNPA 2HTJA 3V8JA 2W00A 3LQRA 3ZPLA 3OYNA 1BI2A 2K3PA 3CTAA 4BU2A 3LMMA 4ZYDA 2E7XA 5DM6F 4ESJA 1I3AA 3HOWJ 1IXRC 2I8DA 3PNVA 3VFZA 2KIUA 3GTMJ 4U0WA 4PUSA 1K61A 1O3SA 4LIUA 1A04A 4PJJA 1G3YA 5F0FA 2R92J 1V4RA 2V1NA 3NARA 2RAEA 2QCOA 1T8IA 4LB5A 3ABUA 3B73A 5FLMJ 3K4KA 4RB2C 4GXOA 1MBJA 3CO7C 2PLYA 1BI3A 4UXNA 3CUQB 2X1EA 5IT9K 4XKWA 5FGMA 3F72A 2FNAA 5K1YA 4OIQF 5E20A 2L9SA 3S3NA 3T8RA 2VUMJ 3U21A 3HSRA 4C3HJ 1LQ1A 3K4BA 2JRTA 3HXLA 2LKSA 2WBMA 2Y69H 3DXJF 4IF4A 1TNSA 3FKIJ 2MW8A 2VQGA 1IXSB 4OIRF 4YG2F 2IGNA 1FSEA 5KNLA 2FBHA 2IGMA 1XPXA 1S5LC 2PMUA 5E3LA 3CMYA 1ZGJA 3BTCA 5FFZA 3A2KA 2LKPA 3TDZC 2XV4S 2H09A 5JR3A 2ZFUA 1EF4A 4A3KJ 1DU6A 2QBYA 2P5KA 3SHFA 2X6WA 4UUSA 4D7NA 2VASA 1FMWA 3F8MA 5E18F 1J0RA 1LE8B 5GAEJ 1Y8RB 2KDOA 2NOGA 3BG5A 1VQ8I 1S8NA 4PJLA 1UG0A 2BOLA 1QVUA 4RB0A 2E60A 3BTLA 1U8BA 1FPQA 2CUEA 3CCUI 1PUFA 2V6EA 3RKWA 2CYYA 4ESFA 1IRZA 2QQ9A 2LKXA 2ACJA 4UY8I 3CCMI 2BHYA 4XQFA 2FEZA 1YI2I 5DD8A 1KU7A 1DP3A 3G1MA 1UHMA 2K9MA 4P55A 4E7JA 3QOEA 2EIKH 3BQYA 4K2EA 3V42A 4JQFA 2FUG2 4HOBA 4IZZA 1KYWA 1X2NA 5GPAA 1R4MB 2VOPA 1YJNI 5KHDA 2GIVA 2OV7A 1W1WE 4V2GA 5EEGA 1X3WB 4Q48A 1KA8A 1RPWA 4XMYA 4ENMA 2DOFA 2WTEA 1BW5A 1WFXA 1MD0A 3CF2A 3DP7A 3E7LA 2DPDA 4ZYEA 5A2QZ 1YE9A 2VBXA 2XASA 4L5JA 2LBFB 1VQPI 4XLPF 2WV1A 3MEXA 4II2A 2KDZA 4M73A 4ENJA 4P9UA 1QPMA 2AQEA 3V4GA 1JKPC 3GZNB 2RQPA 3ZN1A 4UUTA 4IPAA 4EEFG 4A12A 2QKLB 1G3WA 5B3SH 1FTTA 1QO0D 4XRSA 3HRMA 2WB1A 2K7LA 3KYDB 2VN2A 2XPVA 3I3LA 5D6FA 3AL0C 1MBKA 3JRIA 2NS7A 5E8GA 3IH4A 3WTXC 2E2HJ 1VQLI 2QZ8A 4IXAA 4HBLA 1ETQA 1S29A 1YQAA 3FISA 3PSIA 1FYMA 2KFDA 1UG2A 1IGNA 4BDYA 3RDIA 1U3EM 1YG2A 4N0BA 3ZMSA 3E6MA 4PJMA 2L01A 3V8LA 3KP3A 3CUOA 3GTPJ 3IP4B 4RBOA 3WGIA 4PJ0C 1MMSA 5EJCA 3OIPA 4DYRA 3D5RC 1NG6A 4XLFA 2CH0A 1IF1A 5JHFA 1TC3C 1Q1HA 4RM3A 3I9V2 3C1DA 4UVBA 3PO2J 4AYBA 4KISA 3MKZA 5JLWA 2A3SA 1VQ9I 1T6SA 1O7LA 4I6ZA 3BWGA 3FKJA 3J7AO 2LY1A 3N05A 2VBWA 3Q9VA 2Y31A 3LFUA 4F3QA 2HS5A 1FZPB 4Z2YA 3BDDA 3QU6A 3VOEA 1QGPA 4B4CA 4L0ZB 5F6FA 2RNJA 1ZLKA 2BY2A 1QU3A 3MN2A 1S7EA 2FBIA 3M7GA 2V1DA 4WX9A 4A5NA 4CDGA 2R7XA 4HNUA 3HOUJ 5CKTA 1H8AC 2CG4A 2E19A 2R7DA 1I1GA 1RR7A 2EFOA 5CQEA 4LK1F 4BXUA 1BA5A 2K27A 4AM3A 1RC9A 1ZRCA 2PI0A 1UELB 1LJ9A 5L3CA 3S17J 2H6CA 3H5RA 2DN0A 3IWFA 3O6BB 3QRFF 4YIRX 1D0YA 2UXXA 2M8GX 4X6AJ 3R4KA 1Z1DA 4Y7NJ 2K9QA 1W36C 2RREA 2FX0A 5C44J 1E0EA 4AIDA 4BL0B 3Q9SA 2M34A 2P7CB 3UR3C 3HUGA 1B9NA 3F8BA 4BXFA 2VC0A 2ZMEA 2HOEA 3JRBA 5DCMA 1I6XA 1JKQC 3CDLA 3PUBA 3H5AA 4DYCA 4YFNF 5JFRA 3MKWB 1VNDA 1REPC 1YTYA 2HVQA 2IGOA 2NNNA 2CS3A 4PGGA 4BDZA 1ZELA 4QPQA 4A69C 4U7DA 2KLOA 3GBGA 2JA2A 4HYEA 1ZG5A 1BC7C 2Y48A 2Y30A 2RGVA 4P9FA 2OA4A 5CPRB 4EJTA 1XDSA 4R79A 4IVNA 3ECOA 3MCZA 2DJNA 1DP7P 2WA0A 1S6LA 5HLHA 4D9JA 2BEOA 4JP0A 2YU9J 2NYXA 4KNYA 1J75A 1F36A 1LPQA 3R60A 2OQGA 4Y4RA 5BPDA 4PZJA 5KAIC 2E36A 2K9NA 3BTJA 4N9IA 3M3YJ 2ESHA 2HQRA 2A68F 2JRMA 4YELA 1ZRDA 2BV6A 2KJBA 1YLFA 1FWZA 4BE2A 5ED4A 3A4CA 4HNVA 1R7JA 4DQ2A 5TISC 4HX8A 2CU7A 3K1PA 3O8GA 4O3MA 2OAZA 2FJ1A 4NQWB 4M9XA 4B43A 4XK4A 2BHZA 2LG4A 1TWGJ 3M8FA 3QP6A 2ISZA 4C9YA 2VB6A 1VQMI 1X58A 3A03A 3F8NA 4KT5C 1VTNC 1S3JA 3OIQA 2DDAA 1DUXC 4FETA 3I59A 1I39A 5ICGA 2BVMA 2CUJA 2FD5A 3OYMA 3GZ6A 1AHDP 3OYDA 3LSHA 1PJRA 2MC4A 4FISA 1XDUA 1JUSA 1U5TC 2JUGA 1HLVA 1OYIA 1V3FA 4S05A 3HOSA 1UCRA 4C3JJ 1U6GA 4PK4A 3H3UA 4XL9A 1T33A 2M30A 5EEHA 1Y39A 2V9PA 3ECHA 4KIBA 1X1AA 2ZO4A 1SANA 4HSTA 4RAFA 1CF7B 2Q2EA 3ROUA 1T0FA 4H0EA 1IO2A 4AD9A 4LMYA 1B72B 1XX5A 1BJAA 2LNBA 3BLYA 1WJDA 3DEEA 3HOTA 3N4MA 1ZG1A 1K83J 2EZIA 5J8FA 4LITA 5ICCA 3OYAA 1MSFC 1K78B 4I7HA 1PDNC 3CDHA 3MQ0A 2ZKZA 3OL3A 2W1OA 3GUDA 3VYSB 3CC2I 3LOCA 4UV9A 4TV7A 1R1TA 2WAEA 2V79A 3P9KA 4MLOA 1VZ0A 3RKQA 3WGHA 1VQ4I 3DPTA 1XGSA 2JTVA 4NNJA 4RAZA 2JA8J 3OR1C 2FSWA 1G8XA 3HKZA 3Q0VA 2ZFWA 1QA6A 1SMYF 2EZLA 5DS9A 5L3FA 2L7MP 5CVJA 2XF7A 1ONVA 1R5HA 1QQIA 4A3FJ 2CQXA 2MG4A 3J7YJ 1TW3A 2DAOA 2PJRB 5B1BH 2LTPA 3HIFA 3WODF 4BQOA 4RM2A 3M1CA 2CQKA 2Z5UA 1GXQA 5F1RA 1JGGA 1HXDA 5EGOB 3D5LA 1AKHB 1HW1A 4YIFA 1HDDC 4KIFA 2KMUA 3ZMDA 2IW5A 2M8EA 2R7RA 3TDUC 5F08A 3WTVC 4A93J 2DT7B 2A61A 2F48A 2L0KA 1LDDA 3KZIC 2DMQA 2EILH 3REOA 2DQLA 4XSZF 2Y0SA 1QZZA 2JZYA 2UZKA 3EQLF 1WPKA 4XIDA 1E3HA 5BMZA 2YS9A 1RRJA 2EZKA 2ZSHB 3L00A 4XLNF 3TO7A 3ZQGA 3JAMZ 1Z9CA 2KP6A 2IGKA 2F5VA 4XSXF 4AU7A 1JGSA 2F5FA 1YJWI 1B8IB 2IEKA 4CYDA 1BI0A 3DLLF 1P4WA 2DOEA 4RGUA 3RTRA 4AVZA 2TDXA 2MH2A 3TBIA 3LSPA 5IYBJ 1QPIA 3S8PA 3OV8A 1JTXA 4AC0A 1ZTRA 4GO1A 1NHAA 1ZKGA 5FJ8J 1RNLA 2FMYA 1Z3XA 3FXQA 1SD4A 1U78A 2G9WA 3PQKA 1ETKA 4FQGA 4RGXA 4MNUA 1VFCA 2L4MA 3O2PE 1W7PB 5K5OA 2VIXA 1TL8A 3ESWB 2OPTA 3I4PA 1J09A 5TGTA 5L3BA 1WJCA 1XMKA 3LAPA 2CWEA 3BR2A 2ESNA 3MVPA 4OMZA 2DW4A 3KYLA 4PSWA 3M4OJ 5EG0A 3GTLJ 2J5OA 2H8WA 3G4SI 1YRNB 3H3ZA 2A6HF 2YR2A 2A69F 2VC1A 2R4GA 2NVUB 2R7TA 2OTLI 1N77A 3FK6A 2GA2A 4U0YA 3HTSB 2CMPA 1TP4A 1E17A 1LUJB 2O3FA 4NC8A 3EYYA 2LMDA 2P6SA 3ABTA 4KIGA 4QWQA 3ABLH 3QPLA 3Q3SA 5H20A 5C4JJ 1BIAA 4PGHA 5IP9J 1NK3P 4DBQA 2UWMA 4EJVA 1FMVA 1X3UA 3C2GA 1HDPA 3BR1A 3FHNA 1XB4A 2LOOA 3LAJA 4BEHA 4BBRJ 1ON1A 2NS0A 4FCYA 1KQ0A 4NC6A 2FE3A 3FXJA 1JKOC 2CQNA 1PVEA 4LJZF 2CJJA 4XBFA 4G6DA 3ZQCA 2A5YB 1I3QJ 4BKXA 4B44A 2D5VA 2JUCA 3A02A 3JREA 3E5XA 4IOAF 3DKYA 3JRHA 2V1UA 2CFOA 4DZPA 4M9SA 4G6TB 3DBHB 1KQ9A 3ASOH 1WQ2A 3NQOA 3DLAA 2Z2SB 3GLXA 2DCEA 5FKMA 1O7FA 1JHFA 5L3GA 3CD6I 3A0HC 3HBLA 4OOIA 4UB8C 2OJED 1H89C 1HCRA 1YW9A 3FXUA 5EYRA 1JHHA 2KKOA 3PIOF 2QSFX 3DCFA 1MH3A 3JCUC 4BHBA 2O8XA 2IS1A 4RGSA 5J4VA 2W24A 3CP2A 5LGTA 1USTA 4NQWA 3RKYA 4DYQA 2ZNZA 3IRRA 1KONA 3QQAA 4KN4X 4ESBA 2M87A 2XRNA 4QPOA 1XD7A 1RUNA 2BW3A 4CCOA 1QBJA 2W84A 3BY6A 1PYVA 3KYCB 2DFEA 3WHBA 2XSDC 3F8FA 5D4SA 2R7VA 1TQIA 3FM3A 3AAFA 2VQLA 2E1MC 3ML6A 3K69A 1TWCJ 1WJBA 2HYFA 3A1YA 2HQAA 3HRTA 2DT6A 1JE8A 1HSTA 4EVIA 2ZXJA 1N25A 3A01B 2CRGA 2K86A 3CC7I 5LGNA 5IT3A 1MBFA 3HGYA 4BJ6C 3GLLA 1J7KA 5LEJA 4ZDLA 1XSXA 5GTIC 2E2IJ 3S93A 1GT0C 4IHYA 3LSMA 5IYDJ 1ZAOA 2DA5A 1XGMA 2VBZA 1O4XA 3K1NA 2HZDA 3J80Z 3SFIA 1Z91A 1X2MA 1FTZA 2MH9A 3EPZA 1SFUA 5KAFC 3CCEI 3HB9A 5FKLA 3KETA 3E0JB 3CJRB 4XN3A 3S1QJ 4W97A 4NDLA 1WSUA 1BIBA 1XS9A 1XC5A 3S1RJ 3H36A 3DF8A 3WTWC 4LLGF 3F21A 1YFHA 3K4MA 3IHUA 3G71I 1CGPA 3BPVA 3KX2A 4HV5A 2LD5A 3WTZA 3TL4X 1YITI 1UHSA 2E5NA 3DBRB 1WJAA 2BZTA 1ZR4A 1POGA 5FRMA 1JI8A 4J00A 2X4HA 1YHQI 2HWVA 3DWLE 3VPRA 3HSEA 3FX3A 3CUQC 1X4OA 1OCPA 1X1BA 5HOOA 2ZB9A 2EFNA 2CW7A 2COBA 3F23A 1FX7A 2MABA 3GCMA 3K2AA 3LSRA 1U8RA 4F52A 2OCEA 2R7ZJ 3FBNB 1PP7U 2MD5A 2VI6A 3W2AA 3ZMZA 2LRDA 3WHCA 1APLC 3U2RA 2DU9A 4CZCA 4HV6A 5IP6A 2RC4A 5K5QA 2M0MA 4HRIA 4BAYA 4FE7A 4Y33A 2DTZA 2K4BA 3B6CA 1TWHJ 1S72I 5FFXA 3H9QA 3OS2A 2E1CA 2JQ7A 1WVRA 3ISPA 2VKDA 3X2QH 2IT0A 3GFJA 2L5QA 2O0YA 2Z3YA 5JVTA 4I99C 2HOSA 1Y8QB 4ZZDA 2CUFA 4CO8A 2ZSIB 3GFLA 4E7LA 1FSHA 1RIOH 4EGZA 3H3VK 3GXOA 3DBLB 4MEXF 4M3BA 2EFPA 4DGWB 2K3FA 2W4SA 2GXBA 1TTYA 2PMZN 1GXPA 2VT3A 1T0FC 5E17F 2XF5A 4OIPF 2NRAC 1MNEA 3LSGA 1F9NA 1PP8F 1ZG3A 2L9NA 2Y2ZA 1HOMA 3P9IA 5L3EA 3KIOA 2E34A 2LH9A 4HEA2 4PFPA 1FT9A 2LK2A 1R36A 1FOXA 1W5CC 4DOZA 1GV5A 2A05A 2WAQA 1IRFA 3ZRGA 1SD6A 1ZHFA 4YFKF 3G73A 3P5JA 2VL8A 4WK8F 2FA5A 2OTJI 2HOTA 4BY1J 1NG7A 3TOBA 3C18A 3JRGA 3S1MJ 3CCRI 1YRNA 3GFMA 4CCMA 2GOXB 2XUBA 3KFWX 4II3A 5DM7F 3SEZA 2M7BA 2XKPA 3S16J 4ZH4F 3S2DJ 3LA2A 2FMLA 4Q47A 4XOPA 1EJ9A 2M45A 1FNNA 3FMSA 1MMGA 3NRVA 4AIHA 1MBEA 1OLTA 2WY8Q 1SVOA 1XTAA 1V5EA 1ZGWA 3JTHA 1DPUA 2L4AA 4FE4A 1S7OA 1FBQA 1MW7A 5H6QA 2Z9OA 3QYEA 1WI9A 2OC6A 3VODA 3VB2A 4A3IJ 2RQQA 4AIKA 3CESA 3VSLA 4U87A 1WZ2A 1OCZH 4PCQA 5HLTA 5C3EJ 5CYVA 5K7FA 1LFBA 4Y52J 1EV7A 1TZLA 3FK7A 1JXSA 3HSFA 4RAGA 1HF0A 2DA6A 2QQ8A 1OCRH 3BG6A 5ERIA 3RI4A 2F5CA 2A07F 4LB6B 4E6KG 3FMQA 2FRHA 3N97A 4WXCA 2OUMA 1MIJA 2DO7A 2EPFA 3WTTC 1JTYA 4CICA 3WU2C 5HDKA 1W4MA 1EH7A 2JMWA 2HKXA 1LDKB 3CP8A 1VI0A 5HNFA 4BQNA 1P9QC 4BE0A 3HOXJ 3BQZA 1UB9A 4IOCF 1L3LA 3ONQA 2ZXHA 4DZJA 1JJ8C 1I6HJ 5D5WB 2VKVA 3I5UA 4KUMA 1UMQA 2B7EA 2E35A 5J8CA 3J7AY 2ZXWH 2LY9A 2LF7A 1H9TA 2IA2A 1UZCA 4HDVA 2PN6A 4YEJA 4ON0A 4E7HA 1FIAA 1MGTA 3AL0B 1LFUP 2MA3A 2M9HA 4C2TA 3T1BA 5IOYA 1XN7A 3W6VA 3QYFA 3BROA 3E97A 4ASNA 2K02A 3IH2A 2XSJC 1NK2P 3RQ4A 1QZYA 3KZYA 2ISYA 4LFUA 2XRLA 1KZHA 4AIJA 2CV0A 3DKXA 3GW2A 2ETHA 2GM4A 4L0YB 1TQPA 5GP9A 5LGUA 1UHWA 2VE8A 3GO5A 3P7NA 3A01A 1R23A 2WV0A 4BQAA 4NUBA 4B3AA 4E4HA 2R5YB 1QVTA 3BJAA 2IAIA 4P96A 3KZZA 5LD2C 3BR3A 2G7UA 3RYRA 4CCJA 5ILUA 1IRXA 3AG4H 4HF0A 4M3FA 3ZOBA 3ZQHA 4A6EA 4E7KA 3EDPA 2ZJQF 5GTHC 5LRRA 2E7WA 1SC7A 3BP8A 4CUGA 4MQ9F 1FC3A 1B9MA 3I0TA 2HYJA 3SXYA 4E70A 3K70D 5IP7J 3FBIB 2EINH 3M8EA 2P6TA 1G3TA 3IKTA 3TGNA 4O5VA 2ELJA 1A6QA 2YU3A 4LGWA 4HF1A 2GZWA 2AO9A 2ICWG 2GWRA 3H5NA 4D7MA 3NEUA 1IUYA 1HBXG 4BBSJ 4N4OB 3IKVA 3AG1H 1MMNA 1FBUA 4C3IJ 1W7PD 3CC4I 1ETVA 5GAHJ 5J47A 3HRSA 2XPUA 3PSFA 2DA3A 5IYCJ 2ZNYA 1SD5A 5HDNA 3K10A 2LP0A 1Z6RA 5HLIA 2MBFA 4C30A 3U1DA 4CSWA 3KP4A 3PIPF 5M5WJ 5KVRA 4DNCA 1MJAA 4BQQA 1XMXA 2GBYA 1ZLJA 2KRFA 1X3ZB 1FEXA 1ORKA 3W2VA 3K6GA 3JRDA 4NB5A 3JTGA 1TWAJ 4XOTA 3BCBA 1HSJA 1P2FA 3IRQA 4IHVA 2ME0A 2DMNA 2HXIA 3LQQA 3ABMH 3BZ6A 3C2HA 1GLNA 3MFKA 3QPTA 3EUHC 3CUQA 2JJ7A 1OMIA 3CQZJ 5J4YA 4G12A 1HW2A 1OYWA 5D8LB 2H1KA 2JK3A 3TP0A 4XKVA 2M5WA 2DMUA 5AIPA 4C2MJ 5HNHA 1ZARA 4OINF 2EB7A 2P0WA 5LHGA 4CXFA 2XAFA 3BJOA 3OYHA 3QPSA 3ZQIA 4ZYHA 2J5PA 3CCQI 4I02A 5EEAA 1JT0A 4EJWA 1VQKI 1SAUA 1RKTA 1IXCA 1TWFJ 2FQ3A 5B1AH 2JVGA 1W0TA 1MDMB 4AYBN 4O6JA 1SVLA 3M9AA 1YIOA 1JUMA 5M5YJ 1G4DA 2WADA 1MZBA 3B02A 2FU4A 2W82A 4A3BJ 1ACIA 1Z6TA 2H27A 5B5EC 4X1EA 3GF2A 3E6BA 2HYGD 3IH3A 2KZVA 3HOZJ 2CGPA 3CLOA 4XLAA 4UB6C 1LE8A 2DA7A 4L9VA 2AXLA 2IA0A 3TEDA 2VJ4A 3L2UA 5K5RA 1BOAA 4MGRA 2Y75A 4L5EA 5CJ9A 2L7FP 3E6CC 2V7FA 4ZDPA 2HZTA 4D5FA 3TO9A 4BY7J 3LA7A 3GTQJ 2BVLA 1XCVA 3RIRA 2YX7A 2JVHA 3R0AA 1USSA 4IHXA 3HGGA 3S3MA 3H35A 1J9IA 1S9HA 2DTRA 1SFXA 2EZHA 3OSFA 4RGRA 2GIZA 3JRFA 4CGZA 2XB5A 4IEJA 1O57A 3BG9A 1I5ZA 4RDUA 3K1MA 2GXAA 2CQ7A 1E3OC 4RLFA 4B09A 3GX4X 5BPIA 2OU2A 2P81A 2XPWA 3DPUA 4Y13A 4MEYF 4JK1X 3TW6A 5F27A 2VPRA 4QIWN 4MO7A 2LYCA 4OAYA 2B0LA 4ZTFA 2X1DA 2VODA 3DPLC 2LBFA 3GZ5A 2QLZA 2AXTC 5HODA 4PJNA 2R7QA 1X4PA 4EATA 2VXZA 3OWTA 4QTRA 4RB3C 5LRSA 2CUZA 3E5UA 4S04A 2AS5F 4D0PA 3G3ZA 3DEWA 2C6YA 3F6VA 1VQ5I 3HTUA 3WE2A 3K0LA 5KCMA 3IC7A 1OCCH 4A3JJ 5D5VB 2IXSA 4FX4A 2V6CA 5FKOA 5CVRA 4HX7A 1P7IA 2Z99A 3L2VA 1Z7LA 2EFWA 3I56I 1IAWA 1DPRA 2LDUA 3G2BA 3HC7A 1UAAA 3HOYJ 3J81K 4G6QA 5EZHA 5LLQA 1HW5A 5IOZA 2HFHA 2H94A 2CV1A 2BY1A 2IJLA 4MHGA 1Y6IA 2K5CA 3CO6C 2NVQJ 3OOPA 1BC8C 3GVAA 5FB2A 4BJ5C 2BY3A 5DV5A 2OF7A 4A0XA 3QODA 3WE3A 3Q5FA 3KE2A 3FWEA 1P7JA 1WJEA 3D1NI 4F91B 3BPXA 1SFKA 2EA2A 3DFGA 4GGGA 2E71A 1MMAA 2EV0A 5HS7A 4MTEA 2B9SA 1A5JA 3E1SA 3IUOA 2A6TA 3IL2A 1R49A 1J5YA 3HZJA 4OMYA 3DKWA 5FO5A 3BOQA 2W85A 2QBYB 4UUSB 3QAHA 1A6IA 1V54H 4IQJA 1D0XA 2K85A 2NVYJ 2P4WA 3QPHA 1EKEA 3AFHA 4M6XA 1WCMJ 1T2KA 2HDWA 4HLXA 1MBHA 1X1CA 1D1CA 3ULQB 1RETA 4CCKA 5TRDA 3GTGJ 4A6DA 3S2WA 4ZYAA 1PUFB 1WGXA 3F8CA 3GTJJ 1LKXA 4GDFA 4KICA 1G59A 1IW7F 1ENHA 2MC3A 3TOAA 1K4SA 3JSOA 5CLSA 3ZMUA 3GMEA 4HQEA 3A0BC 4HLYA 1ZQ3P 1WH5A 3HHGA 5ICFA 2PJPA 2XB0X 2ECBA 2TCTA 5J1YA 1GHCA 4YFXF 4M6VA 1J2XA 3TW7A 1SAXA 1DU0A 3VYUB 4DW6A 3PNTA 2F4OB 3FXLA 3SYTA 2DA1A 3HOVJ 3RYPA 5ILSA 3K4NA 1SD7A 4XM3A 4Q4ZF 2ECCA 4XNFA 2O61A 1K4TA 2LF8A 1UFMA 1Z67A 4CHUA 4U88A 4M74A 2QWWA 3ZN0A 3HPGA 3RZOJ 3HKZN 1H9GA 4L5IA 1NTCA 1ZH5A 3G1OA 1LVKA 2WC2A 3K4JA 3CDIA 1BR1A 2IA1A 1QRYA 4CH7A 3BZKA 4WXHA 2M4GA 5J40A 2VKEA 2XAQA 1HQCA 3CMEI 1N75A 2Q0OA 2HOAA 3SFZA 5E3NA 1QHGA 2NVXJ 2PFBA 3COAC 4IHTA 1TT5B 4H4KC 2DT5A 5CQGA 3KPHA 3CCVI 1HKQA 2R7OA 2K9LA 1YW7A 1RKWA 1OISA 2EFQA 2CSOA 4WWCA 1MJ9A 4RA2A 2VOOA 2XAGA 2HDDA 1ODDA 4M6YA 2IS2A 2VE9A 3LSKA 1ETXA 3SDGA 4EMSA 4ENNA 1IN5A 2STTA 3HJEA 3MD2A 4JX4A 4FTHA 3UKGA 2HPMA 5FD5A 3KEOA 3Q0WA 4N4NB 1UJ8A 2DA2A 2KPMA 2R3SA 1ZR2A 2ELHA 3W2WA 4U0VA 1ZRFA 2JPBA 3EUHA 4B8XA 2KRCA 5HS8A 1ETWA 3P9CA 1HKTA 2X9DA 3JRAA 1MDMA 2ELKA 3BG7A 2XVCA 4ENKA 2DQRA 2QENA 4XRSG 3LSTA 1T08B 3HYIA 4KFCA 5FLXK 4M3DA 2EV5A 5IT9Z 2X85A 4UUVA 5JI6A 3HRUA 5HS9A 2Y9ZA 2MLGA 2VQCA 3OIOA 3V8KA 4QSHA 3RJPA 3KP6A 2KIMA 1FOKA 4A2UA 4IJAA 4HA8A 4R1HA 5TJJA 3ZMTA 4DBRA 2RN7A 2ME6A 5GAGJ 2RDPA 2O5RA 3KLNA 3ZMVA 5LBQA 2IPQX 1Y0NA 3FXRA 2F6CA 5E1XA 5D8KB 1O3RA 3F9KA 2DYSH 2XC7A 4LLNA 3DTIA 1XGNA 1Z77A 2YSRA 4CYCB 3DEUA 1LB2A 1FOWA 2RNGA 4KMUX 1CF7A 3FIWA 1YJ9I 1ZN2A 1OPCA 3QP5A 2Q8KA 1B72A 3OOUA 4W1UA 2QQBA 1G3SA 4A3MJ 1FP1D 3HPHA 3TO6A 3L2RA 1G6NA 1I50J 2PBIA 3BZCA 1ITYA 2H1LA 5DD4A 1KU2A 2HU9A 3LSIA 2O8KA 1K78A 3LNQA 3ZQQA 3BT9A 3CZ6A 2G7HA 1Z7UA 3PO3J 4JX5A 1Y56A 2LVSA 2L02A 1V5GA 3HUGB 2UV1A 1OYYA 4PDKA 1BW6A 5DYMA 4A0YA 4LG3A 2ZMEB 5FROA 4WCGA 3T0YA 1MNMC 5DCMB 4A3LJ 2CW0F 1TQMA 4UNOA 2RVCA 2D1VA 4EM0B 4Z6YA 2Z33A 2XGXA 1LEAA 2TRTA 3C7JA 2OD5A 2XF6A 3OYJA 4X0GA 4RS8A 1FYLA 2XGDA 1BN5A 3RPUD 2PJRA 2FOKA 1JJ6C 4BGDA 3GEZA 3UNGC 1OR7A 1Z05A 2BGCA 1OJLA 2R0QC 3SQNA 2ID6A 5EGOA 3GWZA 3OS0A 2HXOA 1AKHA 2LSOA 3K2ZA 1FJLA 1ERDA 5AIQA 2PMHA 4XRFA 4F55A 2XHKA 1HC8A 3BC8A 5J6XA 3SZGA 2LLKA 4CZZA 2EWNA 3OR2C 1R5GA 3ZQ7A 2E2JJ 1EA3A 3CF5F 4GFBA 1T98A 2RKHA 4I01A 3T5XA 3CCJI 2JA6J 1KQ8A 4BS9A 3HDDA 3OYEA 2V26A 4FASD 1IN8A 5E79C 3L7WA 4WXDA 3MZYA 2QEXI 2P8TA 3KEYA 1WI3A 2A6EF 4IRGA 2DPUA 3MZHA 2HEOA 1OKRA 3CJQB 4V19K 2MGQA 1B8IA 2NVTJ 5BS6A 2QGUA 1W36D 2W7NA 2QM3A 1IDZA 1DGWY 4G7ZF 4N9HA 2HKOA 3I59B 5LFAA 3ZP5A 4UHTA 1R6RA 2VLAA 3CMAI 2KT0A 2JSCA 3J80K 2DFIA 4ZTJA 3PL8A 2W48A 2NS8A 5F0HA 2NOJB 2QQAA 1W7PA 1I1SA 1AU7A 2JSPA 5LHHA 1TW2A 3KLOA 3O3KA 1JKRC 2L54A 1RZ4A 2W57A 3E3VA 4GCVA 4M72A 3IAM2 4EJUA 1SMTA 2LC2A 3GTOJ 2Q2EB 2CO5A 9ANTA 2NNYA 2KISA 3I4MJ 2F5DA 2R5ZB 1STZA 5F64A 3R6SA 3MKYB 2VJJA 2GOMA 2XDVA 2Y0MA 5CVUA 4EGYA 1FY7A 5DEQA 5F04A 2NXNB 2VJ5A 2EJRA 3I55I 2JA5J 2OQRA 3CCLI 1MNDA 4HQMA 4XONA 1TT0A 4ANJA 3MKLA 1SFEA 3PQJA 1SVMA 3R61A 2B63J 3GTKJ 5M5XJ 2E1OA 3DTKA 3LWFA 3RKXA 2PG4A 3KCCA 1LNWA 4AWXB 2M7AA 2L9VA 3M1EA 1FIPA 3MMYB 1NH3A 5GADJ 4ZDOA 1VQ6I 1IV8A 1IDYA 3C3WA 1VQ7I 1D0ZA 2KZGA 4B3XA 2DDBA 1W0UA 3WU0A 1IC8A 3T8TA 4BJTA 4JX6A 4HF2A 3OMYA 3RZDJ 3PUFA 3H92A 4NHJA 4XRMA 1MKMA 1X1DA 2V9KA 4A0ZA 2O03A 1JT6A 3CCSI 1V55H 2HR3A 4ZYGA 2XAJA 1HA8A 2XGEA 3S14J 4DJAA 2IRFG 3AG2H 1YW8A 1IV6A 4FHTA 3U1KA 4JBAA 2DMTA 3V7CA 2ZJ2A 1XMAA 3IWZA 5CVVA 1WKMA 2QSHX 3OL4A 1VQNI 2P7VB 2YPRA 1AOYA 2DFFA 3C2BA 4IRHA 1YYVA 1BJZA 4YRVA 2F2EA 4DIQA 2LREA 2UUZA 3VYRB 3H9GA 3ZCOA 4L9NA 5JLXA 1ZREA 4KITB 1H88C 4MFEA 3WG9A 1WJ5A 4S0HB 1Z0XA 1U2WA 4NC7A 1YS7A 3Q0UA 2JWTA 3ERED 3S2HJ 1L0OC 2IS6A 4OAZA 2DK5A 3L2WA 3VEPA 3OSGA 4LD5A 1D1AA 3KP2A 2XAUA 2QA4I 1XSDA 3ZXSA 2BXYA 2VBYA 2BY0A 4I0AA 1Y0UA 3L1PA 1WHUA 4XICA 2L7KA 4KMFA 2ID3A 4LLLA 3JR9A 5A2QK 3DU6A 1KU9A 3PM1A 2HQNA 2VJIA 2WAQN 1VQOI 3OYBA 4A3DJ 4GRIA 1MSEC 4EQQA 5EDNA 4J19A 1MJBA 1T38A 4CYCA 2ZCWA 4G9YA 1Y1WJ 5E3MA 4RB1A 3IV5A 2X6OA 4FX0A 1XG1A 3RPQA 5EG0B 3FXOA 2EK5A 1KYZA 4I76A 2ZXIA 5EF6A 2HTSA 2F5EA 3EYIA 1FP2A 4Y15A 4BH9A 4OU0A 3W6KB 3CCYA 2V1XA 2LFBA 3KP7A 4G8XA 3MZ8A 3TQNA 4ZC3A 2HI3A 2XAHA 2EIMH 2VQHA 3FMRA 2QF7A 1R00A 2K40A 4ITVA 2BXZA 1FOYA 5J1RA 1LFPA 4IKFA 5M3FJ 3B6AA 3CLQA 1ETYA 1ETOA 3RCOA 1ULYA 3JSPA 4UV8A 2HVSA 3PFIA 1BR4A 2D45A 2V9VA 2WB1N 2BYVE 5ILVA 4HG2A 4HNTA 2EH3A 2BBYA 3OYKA 5K7ZA 2QUFA 3PJRA 4KDPA 4BEHB 5FRNA 4I98B 2BE5F 4F7ZA 2MD0A 2X1CA 4MFDA 5JHUA 2LY2A 3ABKH 1QNTA 1ZGAA 2OBPA 3WTSC 3FM5A 2QKMB 1OCOH 1YOVB 1WH7A 1Z21A 1ZK8A 5ICEA 3W3CA 4BHPA 4HPQA 4R8HA 5LEKA 3JRCA 1YX3A 3L2QA 4L18B 4PSXA 2Z1DA 4HZFA 1BI1A 1MH4A 2Z16A 1WWXA 3BG3A 1P6RA 5C4XJ 3KP5A 2CFXA 3WTYC 3OY9A 4WF2A 3ZR8X 2M3AA 5DDGA 1Q1VA 2PX9A 2DXIA 1S7AA 2YUSA 3SZTA 1K79A 4M71A 3TMOA 5AONA 1Z3YA 3L2CA 2KJCA 1A31A 2FOWA 1GUUA 4EM2A 5BQTA 2R7UA 2H6BA 5B66C 4IX7A 2HNHA 5GPCA 3KEQA 4MQVA 1F4KA 3O8HA 3H9JA 3QWLA 4ETSA 5BNGA 3J81Z 5EZGA 1ON2A 4I09A 4P1WA 2BW3B 1B1BA 2XKOA 1GV2A 4OIOF 1H0MA 1JUPA 2DOAA 3I71A 2EIJH 2A5WA 2WAFA 3SEQA 2D2WA
chains in the Genus database with same CATH topology
2B7EA 2JUCA 2KISA 2L9VA 2KFDA 4FQGA 2KZGA 2K85A 2DOFA 2KIQA 2LKSA 2CQNA 2DODA 1UZCA 2E71A 2DOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7E A;  2JUC A;  2KIS A;  2L9V A;  2KFD A;  4FQG A;  2KZG A;  2K85 A;  2DOF A;  2KIQ A;  2LKS A;  2CQN A;  2DOD A;  1UZC A;  2E71 A;  2DOE A; 
#chains in the Genus database with same CATH topology
 1IUF A;  3K4L A;  1BBY A;  3K7A J;  1T56 A;  1IN6 A;  2L3D A;  3L09 A;  3WU1 B;  3RQI A;  2WWY A;  2JPC A;  1MBG A;  3K4C A;  2ZJP F;  4LG0 B;  3LA3 A;  1KGS A;  4HW0 A;  4KYW A;  3NAU A;  4D5C A;  2Y9Y A;  2VKH A;  5IY5 H;  1U0J A;  1YX5 A;  2I5U A;  1U5T B;  1X1P A;  3TP3 A;  1FLI A;  4BNC A;  4AUX A;  2AQF A;  2O6G E;  3FF5 A;  3I53 A;  1F43 A;  1GVJ A;  3F6O A;  1D5V A;  4I0B A;  2XRO A;  5HLG A;  2R5Z A;  4P5O A;  2VON A;  1TBX A;  4UVA A;  3S15 J;  4IHS A;  5F1J A;  2P5V A;  5KK1 A;  2D1H A;  2GA1 A;  2X51 A;  3NWS A;  1GDT A;  2EV6 A;  5BOX A;  1OR7 C;  6PAX A;  3HM5 A;  2ZBK A;  2AHQ A;  2VPL A;  2ADU A;  2HQ5 A;  2F4M B;  4A3C J;  4A5M A;  1M1E B;  1I27 A;  3ZQF A;  2I10 A;  2YX4 A;  3AG3 H;  3L9F A;  4B47 A;  2HVR A;  3CMM A;  1D8J A;  4MTD A;  1U9N A;  1CQT A;  3AKZ A;  2FQ4 A;  1PUE E;  3QOP A;  1SEU A;  4ZJZ A;  4XLE A;  1T95 A;  2DJI A;  1KU3 A;  4M3E A;  4IRI A;  1IN4 A;  1R9T J;  2E5Z A;  2QYO A;  2FF4 A;  2ZC2 A;  1OFC X;  1XCB A;  4G94 A;  5K7H A;  3G6E I;  4FT8 A;  2H8R A;  3I54 A;  1IRG A;  2PEX A;  3SZP A;  4A3E J;  1MMD A;  2FBK A;  1R5I D;  2K9S A;  4M3G A;  1YIJ I;  5FKK A;  3K70 C;  4IQ4 A;  4C2U A;  5FD6 A;  1J59 A;  3BCA A;  1OCT C;  2GXG A;  2K4J A;  4I2O A;  2GLO A;  1R71 A;  1D3Y A;  1K6Y A;  3PNY A;  2PQ8 A;  2GQQ A;  1R22 A;  1E3P A;  4UVC A;  3I4N J;  1K6O A;  4XOR A;  2M4K A;  1FBS A;  2X48 A;  3CJT B;  3F0C A;  5F0C A;  5E1Z B;  2OZU A;  4HAM A;  3ELK A;  3FDY A;  2MFZ A;  1W5T A;  1P4A A;  2OZ6 A;  3PFY A;  2Q1Z B;  4XKB A;  4RLQ A;  2GAU A;  1WRJ A;  4XN0 A;  3EUK L;  5HVQ C;  5IPA A;  1O3T A;  1E2X A;  4JYK A;  2RV8 A;  3BR0 A;  3I58 A;  3M8J A;  2R7S A;  2N8G A;  3FZV A;  3D5S C;  4JOM A;  3SDB A;  4EM1 A;  3G1L A;  4PFO A;  4J01 A;  2IS4 A;  3FXK A;  3IAS 2;  3ERM A;  2MSY A;  5HDG A;  3VWB A;  3M07 A;  3LSJ A;  4BXX J;  4XLH A;  4BUP A;  4BAC A;  1IG7 A;  2JT1 A;  2P5L C;  1B6A A;  2NAZ A;  1R58 A;  2EQR A;  1GVD A;  1LDJ A;  3OYF A;  3QU3 A;  2R5Y A;  3DU5 A;  3QYB A;  4F92 B;  3HL2 A;  4RMN A;  3V7S A;  3HG9 A;  3E6D A;  3RPU A;  3OYL A;  4CCN A;  5FLX Z;  3BR5 A;  3HHH A;  2QVO A;  3H1C A;  3LFK A;  4ZZL A;  2V4J C;  3K9T A;  1ZYR F;  2O9L A;  1R1V A;  4BE1 A;  4U7B A;  1YO5 C;  2IVM A;  4CCL A;  2DK8 A;  4LK0 F;  2EBI A;  4GYG A;  2L2O A;  2O7O A;  3R0J A;  4HDU A;  3VYT B;  5D4R A;  3S1N J;  4LOC A;  3MWM A;  5FKN A;  4AVP A;  2DFH A;  4RAY A;  1C0W A;  1A35 A;  2F4I A;  2VXD A;  3FXM A;  3FHZ A;  3ASN H;  2DLL A;  1DGR M;  3EUA A;  3I64 A;  4CA0 A;  3GYH X;  3F3X A;  1WJF A;  1X19 A;  1U9O A;  1RI7 A;  1XSV A;  4YII A;  3HEF A;  4G7H F;  1TNT A;  2R7W A;  3DTE A;  2JA7 J;  2M1B A;  2XGC A;  4OWR B;  2CQQ A;  4E7Z A;  4E7S A;  1RR8 C;  2HPI A;  2DOD A;  3GFI A;  1QZE A;  3WTU C;  4B48 A;  4E7I A;  3JAM K;  1DDN A;  1AA7 A;  5DUK A;  4QLC U;  3CJN A;  1RUO A;  1B59 A;  2FXA A;  5E3O A;  3ZGK A;  5H2F C;  1D8K A;  1F1Z A;  2HGC A;  3U9G A;  5D5X B;  2DMP A;  2Y0S N;  3MAJ A;  2DYR H;  1TLH B;  4MIM A;  5L3D A;  1D1B A;  3WG7 H;  1BOB A;  4LIV A;  4BHC A;  2X6Y A;  3H0D A;  2ZJR F;  4KA4 A;  5M3M J;  1BM9 A;  2DI3 A;  4EV0 A;  1B4A A;  2IBD A;  2KRH A;  2L7Z A;  2KQR A;  2JN6 A;  5DCF A;  4BYY A;  3SJM A;  1XGO A;  2CV2 A;  2IP2 A;  2XIG A;  1R4N B;  3TKY A;  3OS1 A;  4L9J A;  1A36 A;  5LHI A;  4Y3O A;  2R93 J;  5JVG F;  1V5F A;  1EH6 A;  2R7F A;  5E8I A;  3OYC A;  1LEB A;  2KIQ A;  3W6J B;  1LVA A;  4L9T A;  4Y17 A;  1F5T A;  3DV8 A;  2G0E A;  1N78 A;  2DA4 A;  1P92 A;  3LL7 A;  1P4X A;  2CW8 A;  2M2E A;  3E5Q A;  3VDX A;  2STW A;  3BTI A;  2L9R A;  3EET A;  2QSG X;  4HX4 A;  1T39 A;  4D1Q A;  4XR6 A;  3OYI A;  4M9Z A;  1EH8 A;  5J3L A;  5DUI A;  4KT6 A;  1R1U A;  2PMZ A;  4G7O F;  2HDC A;  2COM A;  2KL4 A;  3D0S A;  3NWT A;  5E1W A;  3OYG A;  1D5Y A;  4NBQ A;  1YS6 A;  1AWC A;  1IN7 A;  4B1R A;  1QHH D;  4V2F A;  4F93 B;  2OCC H;  1RES A;  4Q5S F;  2LR8 A;  1O3Q A;  3RSN A;  3H0G J;  3WGG A;  2KHM A;  5H6R A;  4KN7 X;  4IO9 F;  4EJO A;  2MLK A;  1IJW C;  2VT2 A;  4ABZ A;  1DQU A;  3BJ6 A;  4KJZ A;  4LG0 A;  1BL0 A;  2EA4 A;  5CVI A;  2E1M B;  3ZQL A;  4GYI A;  2ZME C;  2X6X A;  3V7R A;  1W5S A;  2DBB A;  1IZ1 A;  1U5T A;  1G2H A;  3S3O A;  4XLC A;  1FYK A;  4A3G J;  2M0C A;  2KIF A;  2X0L A;  3F22 A;  2WY7 Q;  5DTD A;  5D5U B;  1SFO J;  1K7A A;  5FLV A;  2E1N A;  3DQV C;  1BR2 A;  2UXN A;  1Y1V J;  3S32 A;  4XKC A;  3J7Z I;  3BR6 A;  1VF9 A;  2MYS A;  3JW4 A;  4IL6 C;  1OQY A;  3VSK A;  5J1U A;  4HSR A;  2W25 A;  4IHW A;  1HKS A;  5D6E A;  2FNP A;  2HTJ A;  3V8J A;  2W00 A;  3LQR A;  3ZPL A;  3OYN A;  1BI2 A;  2K3P A;  3CTA A;  4BU2 A;  3LMM A;  4ZYD A;  2E7X A;  5DM6 F;  4ESJ A;  1I3A A;  3HOW J;  1IXR C;  2I8D A;  3PNV A;  3VFZ A;  2KIU A;  3GTM J;  4U0W A;  4PUS A;  1K61 A;  1O3S A;  4LIU A;  1A04 A;  4PJJ A;  1G3Y A;  5F0F A;  2R92 J;  1V4R A;  2V1N A;  3NAR A;  2RAE A;  2QCO A;  1T8I A;  4LB5 A;  3ABU A;  3B73 A;  5FLM J;  3K4K A;  4RB2 C;  4GXO A;  1MBJ A;  3CO7 C;  2PLY A;  1BI3 A;  4UXN A;  3CUQ B;  2X1E A;  5IT9 K;  4XKW A;  5FGM A;  3F72 A;  2FNA A;  5K1Y A;  4OIQ F;  5E20 A;  2L9S A;  3S3N A;  3T8R A;  2VUM J;  3U21 A;  3HSR A;  4C3H J;  1LQ1 A;  3K4B A;  2JRT A;  3HXL A;  2LKS A;  2WBM A;  2Y69 H;  3DXJ F;  4IF4 A;  1TNS A;  3FKI J;  2MW8 A;  2VQG A;  1IXS B;  4OIR F;  4YG2 F;  2IGN A;  1FSE A;  5KNL A;  2FBH A;  2IGM A;  1XPX A;  1S5L C;  2PMU A;  5E3L A;  3CMY A;  1ZGJ A;  3BTC A;  5FFZ A;  3A2K A;  2LKP A;  3TDZ C;  2XV4 S;  2H09 A;  5JR3 A;  2ZFU A;  1EF4 A;  4A3K J;  1DU6 A;  2QBY A;  2P5K A;  3SHF A;  2X6W A;  4UUS A;  4D7N A;  2VAS A;  1FMW A;  3F8M A;  5E18 F;  1J0R A;  1LE8 B;  5GAE J;  1Y8R B;  2KDO A;  2NOG A;  3BG5 A;  1VQ8 I;  1S8N A;  4PJL A;  1UG0 A;  2BOL A;  1QVU A;  4RB0 A;  2E60 A;  3BTL A;  1U8B A;  1FPQ A;  2CUE A;  3CCU I;  1PUF A;  2V6E A;  3RKW A;  2CYY A;  4ESF A;  1IRZ A;  2QQ9 A;  2LKX A;  2ACJ A;  4UY8 I;  3CCM I;  2BHY A;  4XQF A;  2FEZ A;  1YI2 I;  5DD8 A;  1KU7 A;  1DP3 A;  3G1M A;  1UHM A;  2K9M A;  4P55 A;  4E7J A;  3QOE A;  2EIK H;  3BQY A;  4K2E A;  3V42 A;  4JQF A;  2FUG 2;  4HOB A;  4IZZ A;  1KYW A;  1X2N A;  5GPA A;  1R4M B;  2VOP A;  1YJN I;  5KHD A;  2GIV A;  2OV7 A;  1W1W E;  4V2G A;  5EEG A;  1X3W B;  4Q48 A;  1KA8 A;  1RPW A;  4XMY A;  4ENM A;  2DOF A;  2WTE A;  1BW5 A;  1WFX A;  1MD0 A;  3CF2 A;  3DP7 A;  3E7L A;  2DPD A;  4ZYE A;  5A2Q Z;  1YE9 A;  2VBX A;  2XAS A;  4L5J A;  2LBF B;  1VQP I;  4XLP F;  2WV1 A;  3MEX A;  4II2 A;  2KDZ A;  4M73 A;  4ENJ A;  4P9U A;  1QPM A;  2AQE A;  3V4G A;  1JKP C;  3GZN B;  2RQP A;  3ZN1 A;  4UUT A;  4IPA A;  4EEF G;  4A12 A;  2QKL B;  1G3W A;  5B3S H;  1FTT A;  1QO0 D;  4XRS A;  3HRM A;  2WB1 A;  2K7L A;  3KYD B;  2VN2 A;  2XPV A;  3I3L A;  5D6F A;  3AL0 C;  1MBK A;  3JRI A;  2NS7 A;  5E8G A;  3IH4 A;  3WTX C;  2E2H J;  1VQL I;  2QZ8 A;  4IXA A;  4HBL A;  1ETQ A;  1S29 A;  1YQA A;  3FIS A;  3PSI A;  1FYM A;  2KFD A;  1UG2 A;  1IGN A;  4BDY A;  3RDI A;  1U3E M;  1YG2 A;  4N0B A;  3ZMS A;  3E6M A;  4PJM A;  2L01 A;  3V8L A;  3KP3 A;  3CUO A;  3GTP J;  3IP4 B;  4RBO A;  3WGI A;  4PJ0 C;  1MMS A;  5EJC A;  3OIP A;  4DYR A;  3D5R C;  1NG6 A;  4XLF A;  2CH0 A;  1IF1 A;  5JHF A;  1TC3 C;  1Q1H A;  4RM3 A;  3I9V 2;  3C1D A;  4UVB A;  3PO2 J;  4AYB A;  4KIS A;  3MKZ A;  5JLW A;  2A3S A;  1VQ9 I;  1T6S A;  1O7L A;  4I6Z A;  3BWG A;  3FKJ A;  3J7A O;  2LY1 A;  3N05 A;  2VBW A;  3Q9V A;  2Y31 A;  3LFU A;  4F3Q A;  2HS5 A;  1FZP B;  4Z2Y A;  3BDD A;  3QU6 A;  3VOE A;  1QGP A;  4B4C A;  4L0Z B;  5F6F A;  2RNJ A;  1ZLK A;  2BY2 A;  1QU3 A;  3MN2 A;  1S7E A;  2FBI A;  3M7G A;  2V1D A;  4WX9 A;  4A5N A;  4CDG A;  2R7X A;  4HNU A;  3HOU J;  5CKT A;  1H8A C;  2CG4 A;  2E19 A;  2R7D A;  1I1G A;  1RR7 A;  2EFO A;  5CQE A;  4LK1 F;  4BXU A;  1BA5 A;  2K27 A;  4AM3 A;  1RC9 A;  1ZRC A;  2PI0 A;  1UEL B;  1LJ9 A;  5L3C A;  3S17 J;  2H6C A;  3H5R A;  2DN0 A;  3IWF A;  3O6B B;  3QRF F;  4YIR X;  1D0Y A;  2UXX A;  2M8G X;  4X6A J;  3R4K A;  1Z1D A;  4Y7N J;  2K9Q A;  1W36 C;  2RRE A;  2FX0 A;  5C44 J;  1E0E A;  4AID A;  4BL0 B;  3Q9S A;  2M34 A;  2P7C B;  3UR3 C;  3HUG A;  1B9N A;  3F8B A;  4BXF A;  2VC0 A;  2ZME A;  2HOE A;  3JRB A;  5DCM A;  1I6X A;  1JKQ C;  3CDL A;  3PUB A;  3H5A A;  4DYC A;  4YFN F;  5JFR A;  3MKW B;  1VND A;  1REP C;  1YTY A;  2HVQ A;  2IGO A;  2NNN A;  2CS3 A;  4PGG A;  4BDZ A;  1ZEL A;  4QPQ A;  4A69 C;  4U7D A;  2KLO A;  3GBG A;  2JA2 A;  4HYE A;  1ZG5 A;  1BC7 C;  2Y48 A;  2Y30 A;  2RGV A;  4P9F A;  2OA4 A;  5CPR B;  4EJT A;  1XDS A;  4R79 A;  4IVN A;  3ECO A;  3MCZ A;  2DJN A;  1DP7 P;  2WA0 A;  1S6L A;  5HLH A;  4D9J A;  2BEO A;  4JP0 A;  2YU9 J;  2NYX A;  4KNY A;  1J75 A;  1F36 A;  1LPQ A;  3R60 A;  2OQG A;  4Y4R A;  5BPD A;  4PZJ A;  5KAI C;  2E36 A;  2K9N A;  3BTJ A;  4N9I A;  3M3Y J;  2ESH A;  2HQR A;  2A68 F;  2JRM A;  4YEL A;  1ZRD A;  2BV6 A;  2KJB A;  1YLF A;  1FWZ A;  4BE2 A;  5ED4 A;  3A4C A;  4HNV A;  1R7J A;  4DQ2 A;  5TIS C;  4HX8 A;  2CU7 A;  3K1P A;  3O8G A;  4O3M A;  2OAZ A;  2FJ1 A;  4NQW B;  4M9X A;  4B43 A;  4XK4 A;  2BHZ A;  2LG4 A;  1TWG J;  3M8F A;  3QP6 A;  2ISZ A;  4C9Y A;  2VB6 A;  1VQM I;  1X58 A;  3A03 A;  3F8N A;  4KT5 C;  1VTN C;  1S3J A;  3OIQ A;  2DDA A;  1DUX C;  4FET A;  3I59 A;  1I39 A;  5ICG A;  2BVM A;  2CUJ A;  2FD5 A;  3OYM A;  3GZ6 A;  1AHD P;  3OYD A;  3LSH A;  1PJR A;  2MC4 A;  4FIS A;  1XDU A;  1JUS A;  1U5T C;  2JUG A;  1HLV A;  1OYI A;  1V3F A;  4S05 A;  3HOS A;  1UCR A;  4C3J J;  1U6G A;  4PK4 A;  3H3U A;  4XL9 A;  1T33 A;  2M30 A;  5EEH A;  1Y39 A;  2V9P A;  3ECH A;  4KIB A;  1X1A A;  2ZO4 A;  1SAN A;  4HST A;  4RAF A;  1CF7 B;  2Q2E A;  3ROU A;  1T0F A;  4H0E A;  1IO2 A;  4AD9 A;  4LMY A;  1B72 B;  1XX5 A;  1BJA A;  2LNB A;  3BLY A;  1WJD A;  3DEE A;  3HOT A;  3N4M A;  1ZG1 A;  1K83 J;  2EZI A;  5J8F A;  4LIT A;  5ICC A;  3OYA A;  1MSF C;  1K78 B;  4I7H A;  1PDN C;  3CDH A;  3MQ0 A;  2ZKZ A;  3OL3 A;  2W1O A;  3GUD A;  3VYS B;  3CC2 I;  3LOC A;  4UV9 A;  4TV7 A;  1R1T A;  2WAE A;  2V79 A;  3P9K A;  4MLO A;  1VZ0 A;  3RKQ A;  3WGH A;  1VQ4 I;  3DPT A;  1XGS A;  2JTV A;  4NNJ A;  4RAZ A;  2JA8 J;  3OR1 C;  2FSW A;  1G8X A;  3HKZ A;  3Q0V A;  2ZFW A;  1QA6 A;  1SMY F;  2EZL A;  5DS9 A;  5L3F A;  2L7M P;  5CVJ A;  2XF7 A;  1ONV A;  1R5H A;  1QQI A;  4A3F J;  2CQX A;  2MG4 A;  3J7Y J;  1TW3 A;  2DAO A;  2PJR B;  5B1B H;  2LTP A;  3HIF A;  3WOD F;  4BQO A;  4RM2 A;  3M1C A;  2CQK A;  2Z5U A;  1GXQ A;  5F1R A;  1JGG A;  1HXD A;  5EGO B;  3D5L A;  1AKH B;  1HW1 A;  4YIF A;  1HDD C;  4KIF A;  2KMU A;  3ZMD A;  2IW5 A;  2M8E A;  2R7R A;  3TDU C;  5F08 A;  3WTV C;  4A93 J;  2DT7 B;  2A61 A;  2F48 A;  2L0K A;  1LDD A;  3KZI C;  2DMQ A;  2EIL H;  3REO A;  2DQL A;  4XSZ F;  2Y0S A;  1QZZ A;  2JZY A;  2UZK A;  3EQL F;  1WPK A;  4XID A;  1E3H A;  5BMZ A;  2YS9 A;  1RRJ A;  2EZK A;  2ZSH B;  3L00 A;  4XLN F;  3TO7 A;  3ZQG A;  3JAM Z;  1Z9C A;  2KP6 A;  2IGK A;  2F5V A;  4XSX F;  4AU7 A;  1JGS A;  2F5F A;  1YJW I;  1B8I B;  2IEK A;  4CYD A;  1BI0 A;  3DLL F;  1P4W A;  2DOE A;  4RGU A;  3RTR A;  4AVZ A;  2TDX A;  2MH2 A;  3TBI A;  3LSP A;  5IYB J;  1QPI A;  3S8P A;  3OV8 A;  1JTX A;  4AC0 A;  1ZTR A;  4GO1 A;  1NHA A;  1ZKG A;  5FJ8 J;  1RNL A;  2FMY A;  1Z3X A;  3FXQ A;  1SD4 A;  1U78 A;  2G9W A;  3PQK A;  1ETK A;  4FQG A;  4RGX A;  4MNU A;  1VFC A;  2L4M A;  3O2P E;  1W7P B;  5K5O A;  2VIX A;  1TL8 A;  3ESW B;  2OPT A;  3I4P A;  1J09 A;  5TGT A;  5L3B A;  1WJC A;  1XMK A;  3LAP A;  2CWE A;  3BR2 A;  2ESN A;  3MVP A;  4OMZ A;  2DW4 A;  3KYL A;  4PSW A;  3M4O J;  5EG0 A;  3GTL J;  2J5O A;  2H8W A;  3G4S I;  1YRN B;  3H3Z A;  2A6H F;  2YR2 A;  2A69 F;  2VC1 A;  2R4G A;  2NVU B;  2R7T A;  2OTL I;  1N77 A;  3FK6 A;  2GA2 A;  4U0Y A;  3HTS B;  2CMP A;  1TP4 A;  1E17 A;  1LUJ B;  2O3F A;  4NC8 A;  3EYY A;  2LMD A;  2P6S A;  3ABT A;  4KIG A;  4QWQ A;  3ABL H;  3QPL A;  3Q3S A;  5H20 A;  5C4J J;  1BIA A;  4PGH A;  5IP9 J;  1NK3 P;  4DBQ A;  2UWM A;  4EJV A;  1FMV A;  1X3U A;  3C2G A;  1HDP A;  3BR1 A;  3FHN A;  1XB4 A;  2LOO A;  3LAJ A;  4BEH A;  4BBR J;  1ON1 A;  2NS0 A;  4FCY A;  1KQ0 A;  4NC6 A;  2FE3 A;  3FXJ A;  1JKO C;  2CQN A;  1PVE A;  4LJZ F;  2CJJ A;  4XBF A;  4G6D A;  3ZQC A;  2A5Y B;  1I3Q J;  4BKX A;  4B44 A;  2D5V A;  2JUC A;  3A02 A;  3JRE A;  3E5X A;  4IOA F;  3DKY A;  3JRH A;  2V1U A;  2CFO A;  4DZP A;  4M9S A;  4G6T B;  3DBH B;  1KQ9 A;  3ASO H;  1WQ2 A;  3NQO A;  3DLA A;  2Z2S B;  3GLX A;  2DCE A;  5FKM A;  1O7F A;  1JHF A;  5L3G A;  3CD6 I;  3A0H C;  3HBL A;  4OOI A;  4UB8 C;  2OJE D;  1H89 C;  1HCR A;  1YW9 A;  3FXU A;  5EYR A;  1JHH A;  2KKO A;  3PIO F;  2QSF X;  3DCF A;  1MH3 A;  3JCU C;  4BHB A;  2O8X A;  2IS1 A;  4RGS A;  5J4V A;  2W24 A;  3CP2 A;  5LGT A;  1UST A;  4NQW A;  3RKY A;  4DYQ A;  2ZNZ A;  3IRR A;  1KON A;  3QQA A;  4KN4 X;  4ESB A;  2M87 A;  2XRN A;  4QPO A;  1XD7 A;  1RUN A;  2BW3 A;  4CCO A;  1QBJ A;  2W84 A;  3BY6 A;  1PYV A;  3KYC B;  2DFE A;  3WHB A;  2XSD C;  3F8F A;  5D4S A;  2R7V A;  1TQI A;  3FM3 A;  3AAF A;  2VQL A;  2E1M C;  3ML6 A;  3K69 A;  1TWC J;  1WJB A;  2HYF A;  3A1Y A;  2HQA A;  3HRT A;  2DT6 A;  1JE8 A;  1HST A;  4EVI A;  2ZXJ A;  1N25 A;  3A01 B;  2CRG A;  2K86 A;  3CC7 I;  5LGN A;  5IT3 A;  1MBF A;  3HGY A;  4BJ6 C;  3GLL A;  1J7K A;  5LEJ A;  4ZDL A;  1XSX A;  5GTI C;  2E2I J;  3S93 A;  1GT0 C;  4IHY A;  3LSM A;  5IYD J;  1ZAO A;  2DA5 A;  1XGM A;  2VBZ A;  1O4X A;  3K1N A;  2HZD A;  3J80 Z;  3SFI A;  1Z91 A;  1X2M A;  1FTZ A;  2MH9 A;  3EPZ A;  1SFU A;  5KAF C;  3CCE I;  3HB9 A;  5FKL A;  3KET A;  3E0J B;  3CJR B;  4XN3 A;  3S1Q J;  4W97 A;  4NDL A;  1WSU A;  1BIB A;  1XS9 A;  1XC5 A;  3S1R J;  3H36 A;  3DF8 A;  3WTW C;  4LLG F;  3F21 A;  1YFH A;  3K4M A;  3IHU A;  3G71 I;  1CGP A;  3BPV A;  3KX2 A;  4HV5 A;  2LD5 A;  3WTZ A;  3TL4 X;  1YIT I;  1UHS A;  2E5N A;  3DBR B;  1WJA A;  2BZT A;  1ZR4 A;  1POG A;  5FRM A;  1JI8 A;  4J00 A;  2X4H A;  1YHQ I;  2HWV A;  3DWL E;  3VPR A;  3HSE A;  3FX3 A;  3CUQ C;  1X4O A;  1OCP A;  1X1B A;  5HOO A;  2ZB9 A;  2EFN A;  2CW7 A;  2COB A;  3F23 A;  1FX7 A;  2MAB A;  3GCM A;  3K2A A;  3LSR A;  1U8R A;  4F52 A;  2OCE A;  2R7Z J;  3FBN B;  1PP7 U;  2MD5 A;  2VI6 A;  3W2A A;  3ZMZ A;  2LRD A;  3WHC A;  1APL C;  3U2R A;  2DU9 A;  4CZC A;  4HV6 A;  5IP6 A;  2RC4 A;  5K5Q A;  2M0M A;  4HRI A;  4BAY A;  4FE7 A;  4Y33 A;  2DTZ A;  2K4B A;  3B6C A;  1TWH J;  1S72 I;  5FFX A;  3H9Q A;  3OS2 A;  2E1C A;  2JQ7 A;  1WVR A;  3ISP A;  2VKD A;  3X2Q H;  2IT0 A;  3GFJ A;  2L5Q A;  2O0Y A;  2Z3Y A;  5JVT A;  4I99 C;  2HOS A;  1Y8Q B;  4ZZD A;  2CUF A;  4CO8 A;  2ZSI B;  3GFL A;  4E7L A;  1FSH A;  1RIO H;  4EGZ A;  3H3V K;  3GXO A;  3DBL B;  4MEX F;  4M3B A;  2EFP A;  4DGW B;  2K3F A;  2W4S A;  2GXB A;  1TTY A;  2PMZ N;  1GXP A;  2VT3 A;  1T0F C;  5E17 F;  2XF5 A;  4OIP F;  2NRA C;  1MNE A;  3LSG A;  1F9N A;  1PP8 F;  1ZG3 A;  2L9N A;  2Y2Z A;  1HOM A;  3P9I A;  5L3E A;  3KIO A;  2E34 A;  2LH9 A;  4HEA 2;  4PFP A;  1FT9 A;  2LK2 A;  1R36 A;  1FOX A;  1W5C C;  4DOZ A;  1GV5 A;  2A05 A;  2WAQ A;  1IRF A;  3ZRG A;  1SD6 A;  1ZHF A;  4YFK F;  3G73 A;  3P5J A;  2VL8 A;  4WK8 F;  2FA5 A;  2OTJ I;  2HOT A;  4BY1 J;  1NG7 A;  3TOB A;  3C18 A;  3JRG A;  3S1M J;  3CCR I;  1YRN A;  3GFM A;  4CCM A;  2GOX B;  2XUB A;  3KFW X;  4II3 A;  5DM7 F;  3SEZ A;  2M7B A;  2XKP A;  3S16 J;  4ZH4 F;  3S2D J;  3LA2 A;  2FML A;  4Q47 A;  4XOP A;  1EJ9 A;  2M45 A;  1FNN A;  3FMS A;  1MMG A;  3NRV A;  4AIH A;  1MBE A;  1OLT A;  2WY8 Q;  1SVO A;  1XTA A;  1V5E A;  1ZGW A;  3JTH A;  1DPU A;  2L4A A;  4FE4 A;  1S7O A;  1FBQ A;  1MW7 A;  5H6Q A;  2Z9O A;  3QYE A;  1WI9 A;  2OC6 A;  3VOD A;  3VB2 A;  4A3I J;  2RQQ A;  4AIK A;  3CES A;  3VSL A;  4U87 A;  1WZ2 A;  1OCZ H;  4PCQ A;  5HLT A;  5C3E J;  5CYV A;  5K7F A;  1LFB A;  4Y52 J;  1EV7 A;  1TZL A;  3FK7 A;  1JXS A;  3HSF A;  4RAG A;  1HF0 A;  2DA6 A;  2QQ8 A;  1OCR H;  3BG6 A;  5ERI A;  3RI4 A;  2F5C A;  2A07 F;  4LB6 B;  4E6K G;  3FMQ A;  2FRH A;  3N97 A;  4WXC A;  2OUM A;  1MIJ A;  2DO7 A;  2EPF A;  3WTT C;  1JTY A;  4CIC A;  3WU2 C;  5HDK A;  1W4M A;  1EH7 A;  2JMW A;  2HKX A;  1LDK B;  3CP8 A;  1VI0 A;  5HNF A;  4BQN A;  1P9Q C;  4BE0 A;  3HOX J;  3BQZ A;  1UB9 A;  4IOC F;  1L3L A;  3ONQ A;  2ZXH A;  4DZJ A;  1JJ8 C;  1I6H J;  5D5W B;  2VKV A;  3I5U A;  4KUM A;  1UMQ A;  2B7E A;  2E35 A;  5J8C A;  3J7A Y;  2ZXW H;  2LY9 A;  2LF7 A;  1H9T A;  2IA2 A;  1UZC A;  4HDV A;  2PN6 A;  4YEJ A;  4ON0 A;  4E7H A;  1FIA A;  1MGT A;  3AL0 B;  1LFU P;  2MA3 A;  2M9H A;  4C2T A;  3T1B A;  5IOY A;  1XN7 A;  3W6V A;  3QYF A;  3BRO A;  3E97 A;  4ASN A;  2K02 A;  3IH2 A;  2XSJ C;  1NK2 P;  3RQ4 A;  1QZY A;  3KZY A;  2ISY A;  4LFU A;  2XRL A;  1KZH A;  4AIJ A;  2CV0 A;  3DKX A;  3GW2 A;  2ETH A;  2GM4 A;  4L0Y B;  1TQP A;  5GP9 A;  5LGU A;  1UHW A;  2VE8 A;  3GO5 A;  3P7N A;  3A01 A;  1R23 A;  2WV0 A;  4BQA A;  4NUB A;  4B3A A;  4E4H A;  2R5Y B;  1QVT A;  3BJA A;  2IAI A;  4P96 A;  3KZZ A;  5LD2 C;  3BR3 A;  2G7U A;  3RYR A;  4CCJ A;  5ILU A;  1IRX A;  3AG4 H;  4HF0 A;  4M3F A;  3ZOB A;  3ZQH A;  4A6E A;  4E7K A;  3EDP A;  2ZJQ F;  5GTH C;  5LRR A;  2E7W A;  1SC7 A;  3BP8 A;  4CUG A;  4MQ9 F;  1FC3 A;  1B9M A;  3I0T A;  2HYJ A;  3SXY A;  4E70 A;  3K70 D;  5IP7 J;  3FBI B;  2EIN H;  3M8E A;  2P6T A;  1G3T A;  3IKT A;  3TGN A;  4O5V A;  2ELJ A;  1A6Q A;  2YU3 A;  4LGW A;  4HF1 A;  2GZW A;  2AO9 A;  2ICW G;  2GWR A;  3H5N A;  4D7M A;  3NEU A;  1IUY A;  1HBX G;  4BBS J;  4N4O B;  3IKV A;  3AG1 H;  1MMN A;  1FBU A;  4C3I J;  1W7P D;  3CC4 I;  1ETV A;  5GAH J;  5J47 A;  3HRS A;  2XPU A;  3PSF A;  2DA3 A;  5IYC J;  2ZNY A;  1SD5 A;  5HDN A;  3K10 A;  2LP0 A;  1Z6R A;  5HLI A;  2MBF A;  4C30 A;  3U1D A;  4CSW A;  3KP4 A;  3PIP F;  5M5W J;  5KVR A;  4DNC A;  1MJA A;  4BQQ A;  1XMX A;  2GBY A;  1ZLJ A;  2KRF A;  1X3Z B;  1FEX A;  1ORK A;  3W2V A;  3K6G A;  3JRD A;  4NB5 A;  3JTG A;  1TWA J;  4XOT A;  3BCB A;  1HSJ A;  1P2F A;  3IRQ A;  4IHV A;  2ME0 A;  2DMN A;  2HXI A;  3LQQ A;  3ABM H;  3BZ6 A;  3C2H A;  1GLN A;  3MFK A;  3QPT A;  3EUH C;  3CUQ A;  2JJ7 A;  1OMI A;  3CQZ J;  5J4Y A;  4G12 A;  1HW2 A;  1OYW A;  5D8L B;  2H1K A;  2JK3 A;  3TP0 A;  4XKV A;  2M5W A;  2DMU A;  5AIP A;  4C2M J;  5HNH A;  1ZAR A;  4OIN F;  2EB7 A;  2P0W A;  5LHG A;  4CXF A;  2XAF A;  3BJO A;  3OYH A;  3QPS A;  3ZQI A;  4ZYH A;  2J5P A;  3CCQ I;  4I02 A;  5EEA A;  1JT0 A;  4EJW A;  1VQK I;  1SAU A;  1RKT A;  1IXC A;  1TWF J;  2FQ3 A;  5B1A H;  2JVG A;  1W0T A;  1MDM B;  4AYB N;  4O6J A;  1SVL A;  3M9A A;  1YIO A;  1JUM A;  5M5Y J;  1G4D A;  2WAD A;  1MZB A;  3B02 A;  2FU4 A;  2W82 A;  4A3B J;  1ACI A;  1Z6T A;  2H27 A;  5B5E C;  4X1E A;  3GF2 A;  3E6B A;  2HYG D;  3IH3 A;  2KZV A;  3HOZ J;  2CGP A;  3CLO A;  4XLA A;  4UB6 C;  1LE8 A;  2DA7 A;  4L9V A;  2AXL A;  2IA0 A;  3TED A;  2VJ4 A;  3L2U A;  5K5R A;  1BOA A;  4MGR A;  2Y75 A;  4L5E A;  5CJ9 A;  2L7F P;  3E6C C;  2V7F A;  4ZDP A;  2HZT A;  4D5F A;  3TO9 A;  4BY7 J;  3LA7 A;  3GTQ J;  2BVL A;  1XCV A;  3RIR A;  2YX7 A;  2JVH A;  3R0A A;  1USS A;  4IHX A;  3HGG A;  3S3M A;  3H35 A;  1J9I A;  1S9H A;  2DTR A;  1SFX A;  2EZH A;  3OSF A;  4RGR A;  2GIZ A;  3JRF A;  4CGZ A;  2XB5 A;  4IEJ A;  1O57 A;  3BG9 A;  1I5Z A;  4RDU A;  3K1M A;  2GXA A;  2CQ7 A;  1E3O C;  4RLF A;  4B09 A;  3GX4 X;  5BPI A;  2OU2 A;  2P81 A;  2XPW A;  3DPU A;  4Y13 A;  4MEY F;  4JK1 X;  3TW6 A;  5F27 A;  2VPR A;  4QIW N;  4MO7 A;  2LYC A;  4OAY A;  2B0L A;  4ZTF A;  2X1D A;  2VOD A;  3DPL C;  2LBF A;  3GZ5 A;  2QLZ A;  2AXT C;  5HOD A;  4PJN A;  2R7Q A;  1X4P A;  4EAT A;  2VXZ A;  3OWT A;  4QTR A;  4RB3 C;  5LRS A;  2CUZ A;  3E5U A;  4S04 A;  2AS5 F;  4D0P A;  3G3Z A;  3DEW A;  2C6Y A;  3F6V A;  1VQ5 I;  3HTU A;  3WE2 A;  3K0L A;  5KCM A;  3IC7 A;  1OCC H;  4A3J J;  5D5V B;  2IXS A;  4FX4 A;  2V6C A;  5FKO A;  5CVR A;  4HX7 A;  1P7I A;  2Z99 A;  3L2V A;  1Z7L A;  2EFW A;  3I56 I;  1IAW A;  1DPR A;  2LDU A;  3G2B A;  3HC7 A;  1UAA A;  3HOY J;  3J81 K;  4G6Q A;  5EZH A;  5LLQ A;  1HW5 A;  5IOZ A;  2HFH A;  2H94 A;  2CV1 A;  2BY1 A;  2IJL A;  4MHG A;  1Y6I A;  2K5C A;  3CO6 C;  2NVQ J;  3OOP A;  1BC8 C;  3GVA A;  5FB2 A;  4BJ5 C;  2BY3 A;  5DV5 A;  2OF7 A;  4A0X A;  3QOD A;  3WE3 A;  3Q5F A;  3KE2 A;  3FWE A;  1P7J A;  1WJE A;  3D1N I;  4F91 B;  3BPX A;  1SFK A;  2EA2 A;  3DFG A;  4GGG A;  2E71 A;  1MMA A;  2EV0 A;  5HS7 A;  4MTE A;  2B9S A;  1A5J A;  3E1S A;  3IUO A;  2A6T A;  3IL2 A;  1R49 A;  1J5Y A;  3HZJ A;  4OMY A;  3DKW A;  5FO5 A;  3BOQ A;  2W85 A;  2QBY B;  4UUS B;  3QAH A;  1A6I A;  1V54 H;  4IQJ A;  1D0X A;  2K85 A;  2NVY J;  2P4W A;  3QPH A;  1EKE A;  3AFH A;  4M6X A;  1WCM J;  1T2K A;  2HDW A;  4HLX A;  1MBH A;  1X1C A;  1D1C A;  3ULQ B;  1RET A;  4CCK A;  5TRD A;  3GTG J;  4A6D A;  3S2W A;  4ZYA A;  1PUF B;  1WGX A;  3F8C A;  3GTJ J;  1LKX A;  4GDF A;  4KIC A;  1G59 A;  1IW7 F;  1ENH A;  2MC3 A;  3TOA A;  1K4S A;  3JSO A;  5CLS A;  3ZMU A;  3GME A;  4HQE A;  3A0B C;  4HLY A;  1ZQ3 P;  1WH5 A;  3HHG A;  5ICF A;  2PJP A;  2XB0 X;  2ECB A;  2TCT A;  5J1Y A;  1GHC A;  4YFX F;  4M6V A;  1J2X A;  3TW7 A;  1SAX A;  1DU0 A;  3VYU B;  4DW6 A;  3PNT A;  2F4O B;  3FXL A;  3SYT A;  2DA1 A;  3HOV J;  3RYP A;  5ILS A;  3K4N A;  1SD7 A;  4XM3 A;  4Q4Z F;  2ECC A;  4XNF A;  2O61 A;  1K4T A;  2LF8 A;  1UFM A;  1Z67 A;  4CHU A;  4U88 A;  4M74 A;  2QWW A;  3ZN0 A;  3HPG A;  3RZO J;  3HKZ N;  1H9G A;  4L5I A;  1NTC A;  1ZH5 A;  3G1O A;  1LVK A;  2WC2 A;  3K4J A;  3CDI A;  1BR1 A;  2IA1 A;  1QRY A;  4CH7 A;  3BZK A;  4WXH A;  2M4G A;  5J40 A;  2VKE A;  2XAQ A;  1HQC A;  3CME I;  1N75 A;  2Q0O A;  2HOA A;  3SFZ A;  5E3N A;  1QHG A;  2NVX J;  2PFB A;  3COA C;  4IHT A;  1TT5 B;  4H4K C;  2DT5 A;  5CQG A;  3KPH A;  3CCV I;  1HKQ A;  2R7O A;  2K9L A;  1YW7 A;  1RKW A;  1OIS A;  2EFQ A;  2CSO A;  4WWC A;  1MJ9 A;  4RA2 A;  2VOO A;  2XAG A;  2HDD A;  1ODD A;  4M6Y A;  2IS2 A;  2VE9 A;  3LSK A;  1ETX A;  3SDG A;  4EMS A;  4ENN A;  1IN5 A;  2STT A;  3HJE A;  3MD2 A;  4JX4 A;  4FTH A;  3UKG A;  2HPM A;  5FD5 A;  3KEO A;  3Q0W A;  4N4N B;  1UJ8 A;  2DA2 A;  2KPM A;  2R3S A;  1ZR2 A;  2ELH A;  3W2W A;  4U0V A;  1ZRF A;  2JPB A;  3EUH A;  4B8X A;  2KRC A;  5HS8 A;  1ETW A;  3P9C A;  1HKT A;  2X9D A;  3JRA A;  1MDM A;  2ELK A;  3BG7 A;  2XVC A;  4ENK A;  2DQR A;  2QEN A;  4XRS G;  3LST A;  1T08 B;  3HYI A;  4KFC A;  5FLX K;  4M3D A;  2EV5 A;  5IT9 Z;  2X85 A;  4UUV A;  5JI6 A;  3HRU A;  5HS9 A;  2Y9Z A;  2MLG A;  2VQC A;  3OIO A;  3V8K A;  4QSH A;  3RJP A;  3KP6 A;  2KIM A;  1FOK A;  4A2U A;  4IJA A;  4HA8 A;  4R1H A;  5TJJ A;  3ZMT A;  4DBR A;  2RN7 A;  2ME6 A;  5GAG J;  2RDP A;  2O5R A;  3KLN A;  3ZMV A;  5LBQ A;  2IPQ X;  1Y0N A;  3FXR A;  2F6C A;  5E1X A;  5D8K B;  1O3R A;  3F9K A;  2DYS H;  2XC7 A;  4LLN A;  3DTI A;  1XGN A;  1Z77 A;  2YSR A;  4CYC B;  3DEU A;  1LB2 A;  1FOW A;  2RNG A;  4KMU X;  1CF7 A;  3FIW A;  1YJ9 I;  1ZN2 A;  1OPC A;  3QP5 A;  2Q8K A;  1B72 A;  3OOU A;  4W1U A;  2QQB A;  1G3S A;  4A3M J;  1FP1 D;  3HPH A;  3TO6 A;  3L2R A;  1G6N A;  1I50 J;  2PBI A;  3BZC A;  1ITY A;  2H1L A;  5DD4 A;  1KU2 A;  2HU9 A;  3LSI A;  2O8K A;  1K78 A;  3LNQ A;  3ZQQ A;  3BT9 A;  3CZ6 A;  2G7H A;  1Z7U A;  3PO3 J;  4JX5 A;  1Y56 A;  2LVS A;  2L02 A;  1V5G A;  3HUG B;  2UV1 A;  1OYY A;  4PDK A;  1BW6 A;  5DYM A;  4A0Y A;  4LG3 A;  2ZME B;  5FRO A;  4WCG A;  3T0Y A;  1MNM C;  5DCM B;  4A3L J;  2CW0 F;  1TQM A;  4UNO A;  2RVC A;  2D1V A;  4EM0 B;  4Z6Y A;  2Z33 A;  2XGX A;  1LEA A;  2TRT A;  3C7J A;  2OD5 A;  2XF6 A;  3OYJ A;  4X0G A;  4RS8 A;  1FYL A;  2XGD A;  1BN5 A;  3RPU D;  2PJR A;  2FOK A;  1JJ6 C;  4BGD A;  3GEZ A;  3UNG C;  1OR7 A;  1Z05 A;  2BGC A;  1OJL A;  2R0Q C;  3SQN A;  2ID6 A;  5EGO A;  3GWZ A;  3OS0 A;  2HXO A;  1AKH A;  2LSO A;  3K2Z A;  1FJL A;  1ERD A;  5AIQ A;  2PMH A;  4XRF A;  4F55 A;  2XHK A;  1HC8 A;  3BC8 A;  5J6X A;  3SZG A;  2LLK A;  4CZZ A;  2EWN A;  3OR2 C;  1R5G A;  3ZQ7 A;  2E2J J;  1EA3 A;  3CF5 F;  4GFB A;  1T98 A;  2RKH A;  4I01 A;  3T5X A;  3CCJ I;  2JA6 J;  1KQ8 A;  4BS9 A;  3HDD A;  3OYE A;  2V26 A;  4FAS D;  1IN8 A;  5E79 C;  3L7W A;  4WXD A;  3MZY A;  2QEX I;  2P8T A;  3KEY A;  1WI3 A;  2A6E F;  4IRG A;  2DPU A;  3MZH A;  2HEO A;  1OKR A;  3CJQ B;  4V19 K;  2MGQ A;  1B8I A;  2NVT J;  5BS6 A;  2QGU A;  1W36 D;  2W7N A;  2QM3 A;  1IDZ A;  1DGW Y;  4G7Z F;  4N9H A;  2HKO A;  3I59 B;  5LFA A;  3ZP5 A;  4UHT A;  1R6R A;  2VLA A;  3CMA I;  2KT0 A;  2JSC A;  3J80 K;  2DFI A;  4ZTJ A;  3PL8 A;  2W48 A;  2NS8 A;  5F0H A;  2NOJ B;  2QQA A;  1W7P A;  1I1S A;  1AU7 A;  2JSP A;  5LHH A;  1TW2 A;  3KLO A;  3O3K A;  1JKR C;  2L54 A;  1RZ4 A;  2W57 A;  3E3V A;  4GCV A;  4M72 A;  3IAM 2;  4EJU A;  1SMT A;  2LC2 A;  3GTO J;  2Q2E B;  2CO5 A;  9ANT A;  2NNY A;  2KIS A;  3I4M J;  2F5D A;  2R5Z B;  1STZ A;  5F64 A;  3R6S A;  3MKY B;  2VJJ A;  2GOM A;  2XDV A;  2Y0M A;  5CVU A;  4EGY A;  1FY7 A;  5DEQ A;  5F04 A;  2NXN B;  2VJ5 A;  2EJR A;  3I55 I;  2JA5 J;  2OQR A;  3CCL I;  1MND A;  4HQM A;  4XON A;  1TT0 A;  4ANJ A;  3MKL A;  1SFE A;  3PQJ A;  1SVM A;  3R61 A;  2B63 J;  3GTK J;  5M5X J;  2E1O A;  3DTK A;  3LWF A;  3RKX A;  2PG4 A;  3KCC A;  1LNW A;  4AWX B;  2M7A A;  2L9V A;  3M1E A;  1FIP A;  3MMY B;  1NH3 A;  5GAD J;  4ZDO A;  1VQ6 I;  1IV8 A;  1IDY A;  3C3W A;  1VQ7 I;  1D0Z A;  2KZG A;  4B3X A;  2DDB A;  1W0U A;  3WU0 A;  1IC8 A;  3T8T A;  4BJT A;  4JX6 A;  4HF2 A;  3OMY A;  3RZD J;  3PUF A;  3H92 A;  4NHJ A;  4XRM A;  1MKM A;  1X1D A;  2V9K A;  4A0Z A;  2O03 A;  1JT6 A;  3CCS I;  1V55 H;  2HR3 A;  4ZYG A;  2XAJ A;  1HA8 A;  2XGE A;  3S14 J;  4DJA A;  2IRF G;  3AG2 H;  1YW8 A;  1IV6 A;  4FHT A;  3U1K A;  4JBA A;  2DMT A;  3V7C A;  2ZJ2 A;  1XMA A;  3IWZ A;  5CVV A;  1WKM A;  2QSH X;  3OL4 A;  1VQN I;  2P7V B;  2YPR A;  1AOY A;  2DFF A;  3C2B A;  4IRH A;  1YYV A;  1BJZ A;  4YRV A;  2F2E A;  4DIQ A;  2LRE A;  2UUZ A;  3VYR B;  3H9G A;  3ZCO A;  4L9N A;  5JLX A;  1ZRE A;  4KIT B;  1H88 C;  4MFE A;  3WG9 A;  1WJ5 A;  4S0H B;  1Z0X A;  1U2W A;  4NC7 A;  1YS7 A;  3Q0U A;  2JWT A;  3ERE D;  3S2H J;  1L0O C;  2IS6 A;  4OAZ A;  2DK5 A;  3L2W A;  3VEP A;  3OSG A;  4LD5 A;  1D1A A;  3KP2 A;  2XAU A;  2QA4 I;  1XSD A;  3ZXS A;  2BXY A;  2VBY A;  2BY0 A;  4I0A A;  1Y0U A;  3L1P A;  1WHU A;  4XIC A;  2L7K A;  4KMF A;  2ID3 A;  4LLL A;  3JR9 A;  5A2Q K;  3DU6 A;  1KU9 A;  3PM1 A;  2HQN A;  2VJI A;  2WAQ N;  1VQO I;  3OYB A;  4A3D J;  4GRI A;  1MSE C;  4EQQ A;  5EDN A;  4J19 A;  1MJB A;  1T38 A;  4CYC A;  2ZCW A;  4G9Y A;  1Y1W J;  5E3M A;  4RB1 A;  3IV5 A;  2X6O A;  4FX0 A;  1XG1 A;  3RPQ A;  5EG0 B;  3FXO A;  2EK5 A;  1KYZ A;  4I76 A;  2ZXI A;  5EF6 A;  2HTS A;  2F5E A;  3EYI A;  1FP2 A;  4Y15 A;  4BH9 A;  4OU0 A;  3W6K B;  3CCY A;  2V1X A;  2LFB A;  3KP7 A;  4G8X A;  3MZ8 A;  3TQN A;  4ZC3 A;  2HI3 A;  2XAH A;  2EIM H;  2VQH A;  3FMR A;  2QF7 A;  1R00 A;  2K40 A;  4ITV A;  2BXZ A;  1FOY A;  5J1R A;  1LFP A;  4IKF A;  5M3F J;  3B6A A;  3CLQ A;  1ETY A;  1ETO A;  3RCO A;  1ULY A;  3JSP A;  4UV8 A;  2HVS A;  3PFI A;  1BR4 A;  2D45 A;  2V9V A;  2WB1 N;  2BYV E;  5ILV A;  4HG2 A;  4HNT A;  2EH3 A;  2BBY A;  3OYK A;  5K7Z A;  2QUF A;  3PJR A;  4KDP A;  4BEH B;  5FRN A;  4I98 B;  2BE5 F;  4F7Z A;  2MD0 A;  2X1C A;  4MFD A;  5JHU A;  2LY2 A;  3ABK H;  1QNT A;  1ZGA A;  2OBP A;  3WTS C;  3FM5 A;  2QKM B;  1OCO H;  1YOV B;  1WH7 A;  1Z21 A;  1ZK8 A;  5ICE A;  3W3C A;  4BHP A;  4HPQ A;  4R8H A;  5LEK A;  3JRC A;  1YX3 A;  3L2Q A;  4L18 B;  4PSX A;  2Z1D A;  4HZF A;  1BI1 A;  1MH4 A;  2Z16 A;  1WWX A;  3BG3 A;  1P6R A;  5C4X J;  3KP5 A;  2CFX A;  3WTY C;  3OY9 A;  4WF2 A;  3ZR8 X;  2M3A A;  5DDG A;  1Q1V A;  2PX9 A;  2DXI A;  1S7A A;  2YUS A;  3SZT A;  1K79 A;  4M71 A;  3TMO A;  5AON A;  1Z3Y A;  3L2C A;  2KJC A;  1A31 A;  2FOW A;  1GUU A;  4EM2 A;  5BQT A;  2R7U A;  2H6B A;  5B66 C;  4IX7 A;  2HNH A;  5GPC A;  3KEQ A;  4MQV A;  1F4K A;  3O8H A;  3H9J A;  3QWL A;  4ETS A;  5BNG A;  3J81 Z;  5EZG A;  1ON2 A;  4I09 A;  4P1W A;  2BW3 B;  1B1B A;  2XKO A;  1GV2 A;  4OIO F;  1H0M A;  1JUP A;  2DOA A;  3I71 A;  2EIJ H;  2A5W A;  2WAF A;  3SEQ A;  2D2W A; 
#chains in the Genus database with same CATH homology
 2B7E A;  2JUC A;  2KIS A;  2L9V A;  2KFD A;  4FQG A;  2KZG A;  2K85 A;  2DOF A;  2KIQ A;  2LKS A;  2CQN A;  2DOD A;  1UZC A;  2E71 A;  2DOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...