2KFUA

Pknb-phosphorylated rv1827
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
162
structure length
161
Chain Sequence
VTDMNPDIEKDQTSDEVTVETSVFRADFLSELDAPAQAGTESAVSGVEGLPPGSALLVVKRGPNAGSRFLLDQAITSAGRHPDSDIFLDDVTVSRRHAEFRLENNEFNVVDVGSLNGTYVNREPVDSAVLANGDEVQIGKFRLVFLTGPKQGEDDGSTGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An intramolecular switch regulates phosphoindependent FHA domain interactions in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein binding
molecule keywords Rv1827 pThr 22
total genus 22
structure length 161
sequence length 162
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2kfuA01
2JQIA 3PO8A 3UNMA 3UMZA 1K2NA 2KKLA 4G2SA 3UV0A 2G1LA 3OUNA 1J4PA 2AFFA 2KB4A 3ELVA 2W3OA 1FHRA 1K2MA 4EGXA 1LGPA 2JQJA 1MZKA 2KFUA 3GQSA 4QCJA 3HUEA 5DJOA 1K3QA 3VPYA 1FHQA 2PIEA 1UHTA 4EJQA 1J4LA 4H87A 2A0TA 3UOTA 3VA1A 4A0EA 1J4KA 2XT9B 2KB3A 3UN0A 3UNNA 2BRFA 2JPEA 3FM8A 3MDBA 3POAA 1WV3A 5A8IA 1J4QA 3ELSA 3HUFA 1WLNA 2FEZA 2CSWA 1DMZA 4JONA 3I0MA 3VA4A 1K3NA 1K3JA 2EH0A 3HX1A 3I6WA 1G3GA 1QU5A 1LGQA 2FF4A 3I6UA 1G6GA 1J4OA 2LC1A 4D9VA 1R21A 1YJMA 2JKDA 2JQLA 3KT9A 1UJXA 5E50A 3I0NA 1YJ5C 1GXCA
chains in the Genus database with same CATH superfamily
3DSHA 1KHXA 1J2FA 2KKLA 4G2SA 2AN1A 3UV0A 1SUWA 1U7VA 1FHRA 4EGXA 1U7FA 2KFUA 4QCJA 3VPYA 1FHQA 3VZCA 1J4LA 3UOTA 2XT9B 3UN0A 3FM8A 5EJIA 3AFOA 3PFNA 2JGRA 3HUFA 2FEZA 5DHPA 3I0MA 1DD1A 5DHRA 2EH0A 1LGQA 1MK2A 3T5PA 1ZOQA 2LC1A 1YJMA 1Z0SA 1U0RA 1Z0UA 2JKDA 1UJXA 4EJQA 5E50A 5C4VA 1YJ5C 5DHSA 5JELA 4WRRA 5DHTA 2QV7A 3OUNA 1J4PA 1K2MA 2W3OA 4A4YA 3GQSA 2PIEA 1U0TA 1UHTA 4H87A 1G88A 2JPEA 2XXSA 3ELSA 1U7FB 1Z0ZA 2CSWA 3VZDA 3HX1A 4WERA 3I6UA 1J4OA 1R21A 3V8MA 4KU0D 1MJSA 3DITA 1DMZA 2JQIA 3UMZA 1K2NA 3V80A 1QWTA 2G1LA 3A77A 3ELVA 3V7WA 5EJFA 1LGPA 1MZKA 5JEJA 5DJOA 3V8RA 2A0TA 5JEOA 4DY6A 1Y3IA 1J4KA 4A0EA 1Y3HA 2BRFA 3POAA 3MDBA 1WV3A 2I2AA 2I29A 1J4QA 5JEMA 2I2CA 2I2FA 5DHUA 1K3NA 5DHQA 1YGSA 3I6WA 1G3GA 2FF4A 1U7VB 3V8QA 3V8NA 3V7UA 2QVLA 3KT9A 3I0NA 4L02A 4JIWD 5JEKA 3PO8A 4R9PA 2AFFA 2I2DA 2KB4A 3GMJA 3V8PA 5JERA 2JQJA 2BONA 2Q5FA 4V24A 3HUEA 1K3QA 1MR1A 5EJGA 3VA1A 4HAOA 1YT5A 2KB3A 3UNNA 1DEVA 5BVIA 5A8IA 2I2BA 2I1WA 3VZBA 1WLNA 1K3JA 2P1RA 4JONA 3VA4A 3S40A 1QU5A 1G6GA 3V7YA 4D9VA 4JIVD 2JQLA 3UNMA 5EJHA 1KHUA 1GXCA
chains in the Genus database with same CATH topology
3DSHA 1KHXA 1J2FA 2KKLA 4G2SA 3UV0A 1U7VA 1FHRA 4EGXA 1U7FA 2KFUA 4QCJA 3VPYA 1FHQA 3VZCA 1J4LA 3UOTA 2XT9B 3UN0A 3FM8A 2JGRA 3HUFA 2FEZA 3I0MA 1DD1A 2EH0A 1LGQA 1MK2A 3T5PA 1ZOQA 2LC1A 1YJMA 2JKDA 1UJXA 4EJQA 5E50A 5C4VA 1YJ5C 5JELA 4WRRA 2QV7A 3OUNA 1J4PA 1K2MA 2W3OA 4A4YA 3GQSA 2PIEA 1UHTA 4H87A 1G88A 2JPEA 2XXSA 3ELSA 1U7FB 2CSWA 3VZDA 3HX1A 4WERA 3I6UA 1J4OA 1R21A 4KU0D 1MJSA 3DITA 1DMZA 2JQIA 3UMZA 1K2NA 1QWTA 2G1LA 3A77A 3ELVA 1LGPA 1MZKA 5JEJA 5DJOA 2A0TA 5JEOA 4A0EA 1J4KA 2BRFA 3POAA 3MDBA 1WV3A 1J4QA 5JEMA 1K3NA 1YGSA 3I6WA 1G3GA 2FF4A 1U7VB 2QVLA 3KT9A 3I0NA 4L02A 4JIWD 5JEKA 3PO8A 4R9PA 2AFFA 2KB4A 3GMJA 5JERA 2JQJA 2BONA 4V24A 3HUEA 1K3QA 1MR1A 3VA1A 2KB3A 3UNNA 1DEVA 5BVIA 5A8IA 3VZBA 1WLNA 1K3JA 2P1RA 4JONA 3VA4A 3S40A 1QU5A 1G6GA 4D9VA 4JIVD 2JQLA 3UNMA 1KHUA 1GXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQI A;  3PO8 A;  3UNM A;  3UMZ A;  1K2N A;  2KKL A;  4G2S A;  3UV0 A;  2G1L A;  3OUN A;  1J4P A;  2AFF A;  2KB4 A;  3ELV A;  2W3O A;  1FHR A;  1K2M A;  4EGX A;  1LGP A;  2JQJ A;  1MZK A;  2KFU A;  3GQS A;  4QCJ A;  3HUE A;  5DJO A;  1K3Q A;  3VPY A;  1FHQ A;  2PIE A;  1UHT A;  4EJQ A;  1J4L A;  4H87 A;  2A0T A;  3UOT A;  3VA1 A;  4A0E A;  1J4K A;  2XT9 B;  2KB3 A;  3UN0 A;  3UNN A;  2BRF A;  2JPE A;  3FM8 A;  3MDB A;  3POA A;  1WV3 A;  5A8I A;  1J4Q A;  3ELS A;  3HUF A;  1WLN A;  2FEZ A;  2CSW A;  1DMZ A;  4JON A;  3I0M A;  3VA4 A;  1K3N A;  1K3J A;  2EH0 A;  3HX1 A;  3I6W A;  1G3G A;  1QU5 A;  1LGQ A;  2FF4 A;  3I6U A;  1G6G A;  1J4O A;  2LC1 A;  4D9V A;  1R21 A;  1YJM A;  2JKD A;  2JQL A;  3KT9 A;  1UJX A;  5E50 A;  3I0N A;  1YJ5 C;  1GXC A; 
#chains in the Genus database with same CATH topology
 3DSH A;  1KHX A;  1J2F A;  2KKL A;  4G2S A;  2AN1 A;  3UV0 A;  1SUW A;  1U7V A;  1FHR A;  4EGX A;  1U7F A;  2KFU A;  4QCJ A;  3VPY A;  1FHQ A;  3VZC A;  1J4L A;  3UOT A;  2XT9 B;  3UN0 A;  3FM8 A;  5EJI A;  3AFO A;  3PFN A;  2JGR A;  3HUF A;  2FEZ A;  5DHP A;  3I0M A;  1DD1 A;  5DHR A;  2EH0 A;  1LGQ A;  1MK2 A;  3T5P A;  1ZOQ A;  2LC1 A;  1YJM A;  1Z0S A;  1U0R A;  1Z0U A;  2JKD A;  1UJX A;  4EJQ A;  5E50 A;  5C4V A;  1YJ5 C;  5DHS A;  5JEL A;  4WRR A;  5DHT A;  2QV7 A;  3OUN A;  1J4P A;  1K2M A;  2W3O A;  4A4Y A;  3GQS A;  2PIE A;  1U0T A;  1UHT A;  4H87 A;  1G88 A;  2JPE A;  2XXS A;  3ELS A;  1U7F B;  1Z0Z A;  2CSW A;  3VZD A;  3HX1 A;  4WER A;  3I6U A;  1J4O A;  1R21 A;  3V8M A;  4KU0 D;  1MJS A;  3DIT A;  1DMZ A;  2JQI A;  3UMZ A;  1K2N A;  3V80 A;  1QWT A;  2G1L A;  3A77 A;  3ELV A;  3V7W A;  5EJF A;  1LGP A;  1MZK A;  5JEJ A;  5DJO A;  3V8R A;  2A0T A;  5JEO A;  4DY6 A;  1Y3I A;  1J4K A;  4A0E A;  1Y3H A;  2BRF A;  3POA A;  3MDB A;  1WV3 A;  2I2A A;  2I29 A;  1J4Q A;  5JEM A;  2I2C A;  2I2F A;  5DHU A;  1K3N A;  5DHQ A;  1YGS A;  3I6W A;  1G3G A;  2FF4 A;  1U7V B;  3V8Q A;  3V8N A;  3V7U A;  2QVL A;  3KT9 A;  3I0N A;  4L02 A;  4JIW D;  5JEK A;  3PO8 A;  4R9P A;  2AFF A;  2I2D A;  2KB4 A;  3GMJ A;  3V8P A;  5JER A;  2JQJ A;  2BON A;  2Q5F A;  4V24 A;  3HUE A;  1K3Q A;  1MR1 A;  5EJG A;  3VA1 A;  4HAO A;  1YT5 A;  2KB3 A;  3UNN A;  1DEV A;  5BVI A;  5A8I A;  2I2B A;  2I1W A;  3VZB A;  1WLN A;  1K3J A;  2P1R A;  4JON A;  3VA4 A;  3S40 A;  1QU5 A;  1G6G A;  3V7Y A;  4D9V A;  4JIV D;  2JQL A;  3UNM A;  5EJH A;  1KHU A;  1GXC A; 
#chains in the Genus database with same CATH homology
 3DSH A;  1KHX A;  1J2F A;  2KKL A;  4G2S A;  3UV0 A;  1U7V A;  1FHR A;  4EGX A;  1U7F A;  2KFU A;  4QCJ A;  3VPY A;  1FHQ A;  3VZC A;  1J4L A;  3UOT A;  2XT9 B;  3UN0 A;  3FM8 A;  2JGR A;  3HUF A;  2FEZ A;  3I0M A;  1DD1 A;  2EH0 A;  1LGQ A;  1MK2 A;  3T5P A;  1ZOQ A;  2LC1 A;  1YJM A;  2JKD A;  1UJX A;  4EJQ A;  5E50 A;  5C4V A;  1YJ5 C;  5JEL A;  4WRR A;  2QV7 A;  3OUN A;  1J4P A;  1K2M A;  2W3O A;  4A4Y A;  3GQS A;  2PIE A;  1UHT A;  4H87 A;  1G88 A;  2JPE A;  2XXS A;  3ELS A;  1U7F B;  2CSW A;  3VZD A;  3HX1 A;  4WER A;  3I6U A;  1J4O A;  1R21 A;  4KU0 D;  1MJS A;  3DIT A;  1DMZ A;  2JQI A;  3UMZ A;  1K2N A;  1QWT A;  2G1L A;  3A77 A;  3ELV A;  1LGP A;  1MZK A;  5JEJ A;  5DJO A;  2A0T A;  5JEO A;  4A0E A;  1J4K A;  2BRF A;  3POA A;  3MDB A;  1WV3 A;  1J4Q A;  5JEM A;  1K3N A;  1YGS A;  3I6W A;  1G3G A;  2FF4 A;  1U7V B;  2QVL A;  3KT9 A;  3I0N A;  4L02 A;  4JIW D;  5JEK A;  3PO8 A;  4R9P A;  2AFF A;  2KB4 A;  3GMJ A;  5JER A;  2JQJ A;  2BON A;  4V24 A;  3HUE A;  1K3Q A;  1MR1 A;  3VA1 A;  2KB3 A;  3UNN A;  1DEV A;  5BVI A;  5A8I A;  3VZB A;  1WLN A;  1K3J A;  2P1R A;  4JON A;  3VA4 A;  3S40 A;  1QU5 A;  1G6G A;  4D9V A;  4JIV D;  2JQL A;  3UNM A;  1KHU A;  1GXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...