2KG4A

Three-dimensional structure of human gadd45alpha in solution by nmr
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
165
structure length
165
Chain Sequence
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth arrest and DNA-damage-inducible protein GADD45 alpha
publication title Solution structure of human growth arrest and DNA damage 45alpha (Gadd45alpha) and its interactions with proliferating cell nuclear antigen (PCNA) and Aurora A kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 40
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2009-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2kg4A00
3LWRC 3LWVC 3N4YA 3CCMF 3CCJF 1YHQF 3LWOC 3NK6A 1W2BF 1E7KA 3SIUA 2JNBA 3ON1A 2AIFA 3CXCF 1VQ5F 2HVYD 3OW2F 2VGNA 3CPQA 3PAFA 1VQ9F 1SDSA 1M1KH 3CCVF 1M90H 5GANK 3CCUF 1VQ6F 2OZBA 1KC8H 5FLXM 1K73H 1GZ0A 1W41A 2VGMA 1VQMF 1XBIA 3AGKA 1W42A 1VQOF 1VQ4F 5EWRA 1VQKF 2BO1A 2QA4F 4BW0B 1Q86H 3O85A 1S72F 1QVGF 3RA5A 1W3EX 3G4SF 1VQPF 3VI6A 2CZWA 1VQ7F 2OTJF 3OBYA 5FJ4C 1K8AH 3J80M 1CN7A 5G4VC 4BY9D 5GIPC 2QI2A 2WALA 3CD6F 2FC3A 3J81M 3LWPC 1YJ9F 1YJWF 3I56F 3SIVA 3IR9A 3CMAF 1Q82H 1VQLF 3CMEF 1VQNF 3PLAC 3J7AR 1GO0A 1ZWZA 3G6EF 1T0KB 5GAPK 1NMUB 3CCSF 2I6DA 3CCRF 3N4ZA 2LBXA 3NVKE 3E20B 3JAMM 1DT9A 1W40A 3CG6A 1X7OA 1H7MA 4X3LA 3HJWC 3NMUC 4LCKA 3VMFB 5G4UC 3NK7A 1NJIH 1IPAA 1KD1H 4X3MA 5IT9M 3LFOA 2KTVA 2OTLF 1YI2F 3JCMM 5DCVA 1QVFF 2QEXF 2LBWA 3CC2F 3V7QA 1YIJF 3CC7F 5A2QM 5GINC 1PXWA 1CK2A 3CC4F 3CCQF 3OBWA 3CPWF 1YJNF 3NVIB 1X7PA 2ALEA 1N8RH 3HAXD 3RA6A 1Q7YH 1YITF 3I55F 3CCLF 3CCEF 1KQSF 2KG4A 2OHWA 4NUTA 1Q81H 5EO3A 4C4WC 3MCAB 3LWQC 5GIOC 3G71F 3WXMB 3E1YA 1JJ2F 3FFMA 1GO1A 1RLGA 2KTUA 3V7EA 4TZZA 1VQ8F 3GYQA 1RA4A 1K9MH 1X52A
chains in the Genus database with same CATH superfamily
4I50B 5J2UB 3CCJF 3NK6A 1W2BF 2HX0A 3VCZA 3FBAA 3UT5A 3CPQA 3ZOPA 4BVRA 2BTQB 1M90H 1IV3A 1VQ6F 1RQ7A 1KC8H 1K73H 4TV9B 2CVLA 3RYCA 4G4VA 3F0GA 3S06A 3KE1A 1VQOF 3RYIA 1W59A 1VQKF 5CA1B 3IKFA 5C8YA 3O85A 2LBTA 3VOBA 4X1IA 3FPIA 4O2BA 4WBNA 4DRXB 1S72F 1QVGF 1COMA 3G4SF 1VQPF 3K0TA 3OBYA 4BVTA 5LXTA 3HKDB 5JCOC 5G4VC 3FD6A 5GIPC 5ITZA 4U3JB 3IEWA 3ZP4A 4BT2A 4O4HB 5HP8A 1TUBA 3CMEF 5JQGA 1GO0A 1ZWZA 3GTZA 3G6EF 1FFXA 3RYFA 1U3LA 1NMUB 2I6DA 1JY8A 5LYJA 3DDNA 2LBXA 3NVKE 4HNAA 3MBMA 3ZO8A 2CW4A 1VHAA 3TD5A 4B62A 1UFYA 4I55B 3S0WA 1FSZA 3CG6A 1VK3A 2RHLA 3VYUC 2MQEA 2UYNA 3JAWB 3NMUC 4LCKA 3WGLA 1IPAA 5MN4A 3HKCB 5IT9M 2Q1YA 3CYPB 4G4XA 4RQOA 4ZHYB 2KTVA 1YI2F 4BVQA 4TUYA 2GVIA 1JFFA 1QVFF 2GLZA 1NQ3A 3V7QA 3JALB 3HKEB 1OAPA 4G4WA 5J2TA 4C81A 5LOVB 3OBWA 2Z1EA 1SA0A 1X7PA 3N2GB 1N8RH 4YJ2A 3RA6A 1Q7YH 1U40A 5CA0A 5GONB 5EZYB 3S03A 1KQSF 2KG4A 1ODEA 2OHWA 5EYPA 5LP6A 1Q81H 5BMVA 4E6EA 4IIJA 5HY0A 3WXMB 2H8CA 3K12A 1JJ2F 3LMEA 2KTUA 4BVSA 5KX5B 3ERNA 5HXZA 3WGKA 1K9MH 4X20A 1PF5A 4ZI7A 5HY2A 3LWVC 4ZK7A 4O4IA 1E7KA 3VO8A 3ON1A 3B6NA 1VQ5F 5EIBC 2N48A 2NMUA 1YGYA 4B46A 1W5AA 1M1KH 4BT6A 3WGNA 3E22B 3JASA 1TVKB 5LA6A 3K2XA 1GZ0A 2F9ZC 2VGMA 3JVHA 1VQMF 2BTOA 3JAKB 3AGKA 1UI9A 1W42A 1VQ4F 5CB4A 1W5BA 5IYZB 2BTUA 2DT4A 4O4JB 3S02A 2PHNA 4DXDA 3MDOA 2OTMA 3DC2A 1W3EX 5HP7A 2CZWA 3JARA 1W57A 2P6YA 5FJ4C 4FFBB 4BT7A 3RE3A 4EB6B 4F6RA 4C8IA 2HP3A 2ZAUA 3S0HA 4EI7A 1YQNA 4I50A 3UT5B 5J2UA 1YJWF 3I56F 3S0YA 1Q82H 4B5CA 1VQLF 2UZHA 1VQNF 1T0KB 3M1XA 4ZOLB 3LYBA 3R0PA 1W5EA 3N4ZA 4TV9A 3RYIB 3WPWA 2VAPA 5EAZA 1X7OA 3HKBB 3ELCA 3IEQA 2L26A 4X1IB 1QAHA 2CWJA 3D54A 2VXYA 3IMPA 4DRXA 3CB2A 5LXTB 2KGWA 4IHJA 1XHOA 2HP0B 1XRGA 1FNJA 4BT3A 3CC2F 1ONIA 3HKDA 1XV2A 5A2QM 5GINC 4TV8B 2R751 4G88A 5JCOA 1JN1A 4U3JA 4O4LB 4I4TB 2Z1FA 2RHJA 3P0ZA 3P4EA 4O4HA 4X1YB 2IQQA 3T80A 1H48A 3D00A 4BT4A 2VAMA 4XCQA 2H6LA 1U3PA 3G71F 3HTNA 3VTIC 3D01A 3F0EA 1Z5VA 3V4DA 3MQWA 4R40B 2QTPA 1RA4A 4BY9D 4C4WC 5IJ9B 3LWRC 2UYPA 4YJ3B 3CCMF 1YHQF 1OFUA 3LWOC 3SIUA 4EI8A 1Q8RA 3HKCA 2HVYD 3JATB 3PAFA 1SDSA 4LNUB 1IV4A 2HS0A 3CCVF 5GANK 3CCUF 3BYQA 2IG8A 2RHOA 4KWEA 1SA0B 2R6R1 1KNJA 3HKEA 3KHNA 1W41A 5LOVA 1DBFA 1XBIA 3N2GA 1X25A 5EWRA 5LP6B 3IKEA 5GONA 5EZYA 1FNKA 1GX1A 4IIJB 3ESJA 4BW0B 1Q86H 5HWEA 5MN5A 4ERHA 3TD4A 3I7TA 3RA5A 2OTJF 1VQ7F 1W55A 5FNVA 2Q1XA 3CYQA 4X1KB 1W581 4M8IA 3FD5A 2RB9A 3CD6F 5JH7B 3J81M 4O2AB 3LWPC 3CMAF 3N2KB 1H47A 3F6MA 5KMGB 3PLAC 5JVDB 5MN6A 5AVMA 4ZHVA 5GAPK 3CCSF 1R1MA 1SZQA 4G4ZA 3RYHB 3WGJA 4ZHQB 2Z1UA 1CLIA 5IJ0B 2RHHA 5EB0A 4ZHWA 3ZP7A 3JAMM 3WJPA 3OONA 1W40A 2EWCA 3TD3A 1Z5WA 3JAKA 3K14A 3HJWC 3KJKA 5IYZA 2UYKA 4O4JA 3KJJA 5G4UC 1KD1H 3KIZA 3WJQA 2ZF8A 3LFOA 5HY1A 5HY4A 4F6RB 1T0AA 4FFBA 2LBWA 2I6RA 2ZODA 4EB6A 3RYCB 1PXWA 1CK2A 3HWUA 2AMTA 2H8EA 2HQSC 3CPWF 1YJNF 2DYYA 3I3FA 3HAXD 3C9RA 3I55F 3CCLF 2ZOVA 3CCEF 3L7QA 5C8YB 4NUTA 2HS3A 3QUWA 5CA1A 3QHDA 5EO3A 4O2BB 1QD9A 3MCAB 4ZOLA 4WBNB 1RLUA 3Q8HA 3FFMA 3VYSC 1RLGA 4EI9A 3V7EA 3MCQA 1IV2A 1VQ8F 3HKBA 3GYQA 5ITZB 1X52A 3N4YA 4IHJB 2CSLA 2JNBA 1TUBB 4B45A 2AIFA 3CXCF 5JQGB 3OW2F 2VGNA 1VQ9F 3VYTC 1FFXB 4NQ3A 2HP0A 4PWTA 3RYFB 4C82A 3VIUA 5LYJB 2OZBA 5FLXM 4HNAB 4G4YA 2LCAA 4TV8A 2Z01A 4O4LA 3LDTA 1W5FA 2Z1TA 4I4TA 3WJRA 2V9YA 2BO1A 4X1YA 2UYNB 4I55A 2QA4F 1U43A 2VAWA 3GHZA 2B33A 3JAWA 3C8LA 3C9UA 3WPXA 3VI6A 1JD1A 4TUYB 3V3TA 1JFFB 3M84A 1VH8A 1K8AH 3J80M 3EORA 1CN7A 2QI2A 5J2TB 1J7HA 2WALA 1RQ2A 1IV1A 5IJ9A 2YXZA 2AIZP 3JALA 4YJ2B 2FC3A 4YJ3A 1YJ9F 5CA0B 5LP6C 3C9TA 3IR9A 3J7AR 2CHTA 3JATA 5EYPB 4LNUA 5BMVB 3F0DA 4U39A 3U0OA 2K1SA 3CCRF 5EB1B 3E20B 1VQVA 1DT9A 2HRYA 2FGYA 3VOAA 4RHAA 2HRUA 1H7MA 4X3LA 4X20B 5KX5A 4ZI7B 2W8BC 3VMFB 4O4IB 2CHSA 3NK7A 1NJIH 4X3MA 2YYEA 5FNVB 2OTLF 3JCMM 5DCVA 2QEXF 2IAFA 3JASB 2UYJA 4X1KA 5LA6B 3F0FA 1YIJF 3CC7F 3CC4F 3CCQF 4C8GA 3E22A 3NVIB 1TVKA 5JH7A 2ALEA 4O2AA 5CB4B 1YITF 3WGMA 2GZLA 4BT5A 3N2KA 5KMGA 5JVDA 3QTYA 4C8EA 5HXUA 4NWOB 3C9SA 3RYHA 5GIOC 3LWQC 4ZHQA 2ZVYA 5EIBD 3E1YA 5IJ0A 3JARB 2PMPA 1KNKA 1GO1A 5B8FA 1QU9A 2G9IA 3M4SA 4TZZA 3P10A 3SIVA 2ZVZA 2HS4A
chains in the Genus database with same CATH topology
3LWRC 5HY2A 3LWVC 3N4YA 3CCMF 3CCJF 1YHQF 3LWOC 3NK6A 1W2BF 4EI8A 1E7KA 3SIUA 2JNBA 3ON1A 2AIFA 3CXCF 1VQ5F 2HVYD 3OW2F 2VGNA 3CPQA 3PAFA 1VQ9F 1SDSA 4NQ3A 4BVRA 1M1KH 3CCVF 1M90H 5GANK 3CCUF 1VQ6F 2OZBA 1KC8H 5FLXM 1K73H 1GZ0A 1W41A 2F9ZC 2VGMA 1VQMF 1XBIA 3AGKA 1W42A 1VQOF 1VQ4F 5EWRA 1VQKF 2BO1A 2QA4F 4BW0B 1Q86H 3O85A 5HWEA 1S72F 1QVGF 3RA5A 1W3EX 3G4SF 1VQPF 3VI6A 2CZWA 1VQ7F 2OTJF 3V3TA 3OBYA 5FJ4C 4BVTA 1K8AH 3J80M 1CN7A 5G4VC 4BY9D 5GIPC 2QI2A 2WALA 3CD6F 4EI7A 2FC3A 3J81M 3LWPC 1YJ9F 1YJWF 3I56F 3SIVA 3IR9A 3CMAF 1Q82H 1VQLF 3CMEF 1VQNF 3PLAC 3J7AR 1GO0A 1ZWZA 3G6EF 1T0KB 5GAPK 1NMUB 3CCSF 2I6DA 3CCRF 3N4ZA 2LBXA 3NVKE 3E20B 3JAMM 1DT9A 1W40A 2FGYA 3CG6A 1X7OA 1H7MA 4X3LA 3HJWC 3NMUC 4LCKA 3VMFB 5G4UC 3NK7A 1NJIH 1IPAA 1KD1H 4X3MA 5IT9M 3LFOA 2KTVA 5HY1A 2OTLF 1YI2F 4BVQA 3JCMM 5HY4A 5DCVA 1QVFF 2QEXF 2LBWA 2GLZA 3CC2F 3V7QA 1YIJF 3CC7F 5A2QM 5GINC 1PXWA 1CK2A 3CC4F 3CCQF 3OBWA 3CPWF 1YJNF 3NVIB 1X7PA 2ALEA 1N8RH 3HAXD 3RA6A 1Q7YH 1YITF 3I55F 3CCLF 3CCEF 1KQSF 2KG4A 2OHWA 4NUTA 3D00A 1Q81H 5EO3A 4C4WC 3MCAB 5HXUA 4XCQA 5GIOC 3LWQC 5HY0A 3G71F 3WXMB 3E1YA 1JJ2F 3FFMA 1GO1A 1RLGA 2KTUA 4BVSA 4EI9A 3V7EA 4TZZA 1VQ8F 5HXZA 3GYQA 1RA4A 1K9MH 1X52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWR C;  3LWV C;  3N4Y A;  3CCM F;  3CCJ F;  1YHQ F;  3LWO C;  3NK6 A;  1W2B F;  1E7K A;  3SIU A;  2JNB A;  3ON1 A;  2AIF A;  3CXC F;  1VQ5 F;  2HVY D;  3OW2 F;  2VGN A;  3CPQ A;  3PAF A;  1VQ9 F;  1SDS A;  1M1K H;  3CCV F;  1M90 H;  5GAN K;  3CCU F;  1VQ6 F;  2OZB A;  1KC8 H;  5FLX M;  1K73 H;  1GZ0 A;  1W41 A;  2VGM A;  1VQM F;  1XBI A;  3AGK A;  1W42 A;  1VQO F;  1VQ4 F;  5EWR A;  1VQK F;  2BO1 A;  2QA4 F;  4BW0 B;  1Q86 H;  3O85 A;  1S72 F;  1QVG F;  3RA5 A;  1W3E X;  3G4S F;  1VQP F;  3VI6 A;  2CZW A;  1VQ7 F;  2OTJ F;  3OBY A;  5FJ4 C;  1K8A H;  3J80 M;  1CN7 A;  5G4V C;  4BY9 D;  5GIP C;  2QI2 A;  2WAL A;  3CD6 F;  2FC3 A;  3J81 M;  3LWP C;  1YJ9 F;  1YJW F;  3I56 F;  3SIV A;  3IR9 A;  3CMA F;  1Q82 H;  1VQL F;  3CME F;  1VQN F;  3PLA C;  3J7A R;  1GO0 A;  1ZWZ A;  3G6E F;  1T0K B;  5GAP K;  1NMU B;  3CCS F;  2I6D A;  3CCR F;  3N4Z A;  2LBX A;  3NVK E;  3E20 B;  3JAM M;  1DT9 A;  1W40 A;  3CG6 A;  1X7O A;  1H7M A;  4X3L A;  3HJW C;  3NMU C;  4LCK A;  3VMF B;  5G4U C;  3NK7 A;  1NJI H;  1IPA A;  1KD1 H;  4X3M A;  5IT9 M;  3LFO A;  2KTV A;  2OTL F;  1YI2 F;  3JCM M;  5DCV A;  1QVF F;  2QEX F;  2LBW A;  3CC2 F;  3V7Q A;  1YIJ F;  3CC7 F;  5A2Q M;  5GIN C;  1PXW A;  1CK2 A;  3CC4 F;  3CCQ F;  3OBW A;  3CPW F;  1YJN F;  3NVI B;  1X7P A;  2ALE A;  1N8R H;  3HAX D;  3RA6 A;  1Q7Y H;  1YIT F;  3I55 F;  3CCL F;  3CCE F;  1KQS F;  2KG4 A;  2OHW A;  4NUT A;  1Q81 H;  5EO3 A;  4C4W C;  3MCA B;  3LWQ C;  5GIO C;  3G71 F;  3WXM B;  3E1Y A;  1JJ2 F;  3FFM A;  1GO1 A;  1RLG A;  2KTU A;  3V7E A;  4TZZ A;  1VQ8 F;  3GYQ A;  1RA4 A;  1K9M H;  1X52 A; 
#chains in the Genus database with same CATH topology
 4I50 B;  5J2U B;  3CCJ F;  3NK6 A;  1W2B F;  2HX0 A;  3VCZ A;  3FBA A;  3UT5 A;  3CPQ A;  3ZOP A;  4BVR A;  2BTQ B;  1M90 H;  1IV3 A;  1VQ6 F;  1RQ7 A;  1KC8 H;  1K73 H;  4TV9 B;  2CVL A;  3RYC A;  4G4V A;  3F0G A;  3S06 A;  3KE1 A;  1VQO F;  3RYI A;  1W59 A;  1VQK F;  5CA1 B;  3IKF A;  5C8Y A;  3O85 A;  2LBT A;  3VOB A;  4X1I A;  3FPI A;  4O2B A;  4WBN A;  4DRX B;  1S72 F;  1QVG F;  1COM A;  3G4S F;  1VQP F;  3K0T A;  3OBY A;  4BVT A;  5LXT A;  3HKD B;  5JCO C;  5G4V C;  3FD6 A;  5GIP C;  5ITZ A;  4U3J B;  3IEW A;  3ZP4 A;  4BT2 A;  4O4H B;  5HP8 A;  1TUB A;  3CME F;  5JQG A;  1GO0 A;  1ZWZ A;  3GTZ A;  3G6E F;  1FFX A;  3RYF A;  1U3L A;  1NMU B;  2I6D A;  1JY8 A;  5LYJ A;  3DDN A;  2LBX A;  3NVK E;  4HNA A;  3MBM A;  3ZO8 A;  2CW4 A;  1VHA A;  3TD5 A;  4B62 A;  1UFY A;  4I55 B;  3S0W A;  1FSZ A;  3CG6 A;  1VK3 A;  2RHL A;  3VYU C;  2MQE A;  2UYN A;  3JAW B;  3NMU C;  4LCK A;  3WGL A;  1IPA A;  5MN4 A;  3HKC B;  5IT9 M;  2Q1Y A;  3CYP B;  4G4X A;  4RQO A;  4ZHY B;  2KTV A;  1YI2 F;  4BVQ A;  4TUY A;  2GVI A;  1JFF A;  1QVF F;  2GLZ A;  1NQ3 A;  3V7Q A;  3JAL B;  3HKE B;  1OAP A;  4G4W A;  5J2T A;  4C81 A;  5LOV B;  3OBW A;  2Z1E A;  1SA0 A;  1X7P A;  3N2G B;  1N8R H;  4YJ2 A;  3RA6 A;  1Q7Y H;  1U40 A;  5CA0 A;  5GON B;  5EZY B;  3S03 A;  1KQS F;  2KG4 A;  1ODE A;  2OHW A;  5EYP A;  5LP6 A;  1Q81 H;  5BMV A;  4E6E A;  4IIJ A;  5HY0 A;  3WXM B;  2H8C A;  3K12 A;  1JJ2 F;  3LME A;  2KTU A;  4BVS A;  5KX5 B;  3ERN A;  5HXZ A;  3WGK A;  1K9M H;  4X20 A;  1PF5 A;  4ZI7 A;  5HY2 A;  3LWV C;  4ZK7 A;  4O4I A;  1E7K A;  3VO8 A;  3ON1 A;  3B6N A;  1VQ5 F;  5EIB C;  2N48 A;  2NMU A;  1YGY A;  4B46 A;  1W5A A;  1M1K H;  4BT6 A;  3WGN A;  3E22 B;  3JAS A;  1TVK B;  5LA6 A;  3K2X A;  1GZ0 A;  2F9Z C;  2VGM A;  3JVH A;  1VQM F;  2BTO A;  3JAK B;  3AGK A;  1UI9 A;  1W42 A;  1VQ4 F;  5CB4 A;  1W5B A;  5IYZ B;  2BTU A;  2DT4 A;  4O4J B;  3S02 A;  2PHN A;  4DXD A;  3MDO A;  2OTM A;  3DC2 A;  1W3E X;  5HP7 A;  2CZW A;  3JAR A;  1W57 A;  2P6Y A;  5FJ4 C;  4FFB B;  4BT7 A;  3RE3 A;  4EB6 B;  4F6R A;  4C8I A;  2HP3 A;  2ZAU A;  3S0H A;  4EI7 A;  1YQN A;  4I50 A;  3UT5 B;  5J2U A;  1YJW F;  3I56 F;  3S0Y A;  1Q82 H;  4B5C A;  1VQL F;  2UZH A;  1VQN F;  1T0K B;  3M1X A;  4ZOL B;  3LYB A;  3R0P A;  1W5E A;  3N4Z A;  4TV9 A;  3RYI B;  3WPW A;  2VAP A;  5EAZ A;  1X7O A;  3HKB B;  3ELC A;  3IEQ A;  2L26 A;  4X1I B;  1QAH A;  2CWJ A;  3D54 A;  2VXY A;  3IMP A;  4DRX A;  3CB2 A;  5LXT B;  2KGW A;  4IHJ A;  1XHO A;  2HP0 B;  1XRG A;  1FNJ A;  4BT3 A;  3CC2 F;  1ONI A;  3HKD A;  1XV2 A;  5A2Q M;  5GIN C;  4TV8 B;  2R75 1;  4G88 A;  5JCO A;  1JN1 A;  4U3J A;  4O4L B;  4I4T B;  2Z1F A;  2RHJ A;  3P0Z A;  3P4E A;  4O4H A;  4X1Y B;  2IQQ A;  3T80 A;  1H48 A;  3D00 A;  4BT4 A;  2VAM A;  4XCQ A;  2H6L A;  1U3P A;  3G71 F;  3HTN A;  3VTI C;  3D01 A;  3F0E A;  1Z5V A;  3V4D A;  3MQW A;  4R40 B;  2QTP A;  1RA4 A;  4BY9 D;  4C4W C;  5IJ9 B;  3LWR C;  2UYP A;  4YJ3 B;  3CCM F;  1YHQ F;  1OFU A;  3LWO C;  3SIU A;  4EI8 A;  1Q8R A;  3HKC A;  2HVY D;  3JAT B;  3PAF A;  1SDS A;  4LNU B;  1IV4 A;  2HS0 A;  3CCV F;  5GAN K;  3CCU F;  3BYQ A;  2IG8 A;  2RHO A;  4KWE A;  1SA0 B;  2R6R 1;  1KNJ A;  3HKE A;  3KHN A;  1W41 A;  5LOV A;  1DBF A;  1XBI A;  3N2G A;  1X25 A;  5EWR A;  5LP6 B;  3IKE A;  5GON A;  5EZY A;  1FNK A;  1GX1 A;  4IIJ B;  3ESJ A;  4BW0 B;  1Q86 H;  5HWE A;  5MN5 A;  4ERH A;  3TD4 A;  3I7T A;  3RA5 A;  2OTJ F;  1VQ7 F;  1W55 A;  5FNV A;  2Q1X A;  3CYQ A;  4X1K B;  1W58 1;  4M8I A;  3FD5 A;  2RB9 A;  3CD6 F;  5JH7 B;  3J81 M;  4O2A B;  3LWP C;  3CMA F;  3N2K B;  1H47 A;  3F6M A;  5KMG B;  3PLA C;  5JVD B;  5MN6 A;  5AVM A;  4ZHV A;  5GAP K;  3CCS F;  1R1M A;  1SZQ A;  4G4Z A;  3RYH B;  3WGJ A;  4ZHQ B;  2Z1U A;  1CLI A;  5IJ0 B;  2RHH A;  5EB0 A;  4ZHW A;  3ZP7 A;  3JAM M;  3WJP A;  3OON A;  1W40 A;  2EWC A;  3TD3 A;  1Z5W A;  3JAK A;  3K14 A;  3HJW C;  3KJK A;  5IYZ A;  2UYK A;  4O4J A;  3KJJ A;  5G4U C;  1KD1 H;  3KIZ A;  3WJQ A;  2ZF8 A;  3LFO A;  5HY1 A;  5HY4 A;  4F6R B;  1T0A A;  4FFB A;  2LBW A;  2I6R A;  2ZOD A;  4EB6 A;  3RYC B;  1PXW A;  1CK2 A;  3HWU A;  2AMT A;  2H8E A;  2HQS C;  3CPW F;  1YJN F;  2DYY A;  3I3F A;  3HAX D;  3C9R A;  3I55 F;  3CCL F;  2ZOV A;  3CCE F;  3L7Q A;  5C8Y B;  4NUT A;  2HS3 A;  3QUW A;  5CA1 A;  3QHD A;  5EO3 A;  4O2B B;  1QD9 A;  3MCA B;  4ZOL A;  4WBN B;  1RLU A;  3Q8H A;  3FFM A;  3VYS C;  1RLG A;  4EI9 A;  3V7E A;  3MCQ A;  1IV2 A;  1VQ8 F;  3HKB A;  3GYQ A;  5ITZ B;  1X52 A;  3N4Y A;  4IHJ B;  2CSL A;  2JNB A;  1TUB B;  4B45 A;  2AIF A;  3CXC F;  5JQG B;  3OW2 F;  2VGN A;  1VQ9 F;  3VYT C;  1FFX B;  4NQ3 A;  2HP0 A;  4PWT A;  3RYF B;  4C82 A;  3VIU A;  5LYJ B;  2OZB A;  5FLX M;  4HNA B;  4G4Y A;  2LCA A;  4TV8 A;  2Z01 A;  4O4L A;  3LDT A;  1W5F A;  2Z1T A;  4I4T A;  3WJR A;  2V9Y A;  2BO1 A;  4X1Y A;  2UYN B;  4I55 A;  2QA4 F;  1U43 A;  2VAW A;  3GHZ A;  2B33 A;  3JAW A;  3C8L A;  3C9U A;  3WPX A;  3VI6 A;  1JD1 A;  4TUY B;  3V3T A;  1JFF B;  3M84 A;  1VH8 A;  1K8A H;  3J80 M;  3EOR A;  1CN7 A;  2QI2 A;  5J2T B;  1J7H A;  2WAL A;  1RQ2 A;  1IV1 A;  5IJ9 A;  2YXZ A;  2AIZ P;  3JAL A;  4YJ2 B;  2FC3 A;  4YJ3 A;  1YJ9 F;  5CA0 B;  5LP6 C;  3C9T A;  3IR9 A;  3J7A R;  2CHT A;  3JAT A;  5EYP B;  4LNU A;  5BMV B;  3F0D A;  4U39 A;  3U0O A;  2K1S A;  3CCR F;  5EB1 B;  3E20 B;  1VQV A;  1DT9 A;  2HRY A;  2FGY A;  3VOA A;  4RHA A;  2HRU A;  1H7M A;  4X3L A;  4X20 B;  5KX5 A;  4ZI7 B;  2W8B C;  3VMF B;  4O4I B;  2CHS A;  3NK7 A;  1NJI H;  4X3M A;  2YYE A;  5FNV B;  2OTL F;  3JCM M;  5DCV A;  2QEX F;  2IAF A;  3JAS B;  2UYJ A;  4X1K A;  5LA6 B;  3F0F A;  1YIJ F;  3CC7 F;  3CC4 F;  3CCQ F;  4C8G A;  3E22 A;  3NVI B;  1TVK A;  5JH7 A;  2ALE A;  4O2A A;  5CB4 B;  1YIT F;  3WGM A;  2GZL A;  4BT5 A;  3N2K A;  5KMG A;  5JVD A;  3QTY A;  4C8E A;  5HXU A;  4NWO B;  3C9S A;  3RYH A;  5GIO C;  3LWQ C;  4ZHQ A;  2ZVY A;  5EIB D;  3E1Y A;  5IJ0 A;  3JAR B;  2PMP A;  1KNK A;  1GO1 A;  5B8F A;  1QU9 A;  2G9I A;  3M4S A;  4TZZ A;  3P10 A;  3SIV A;  2ZVZ A;  2HS4 A; 
#chains in the Genus database with same CATH homology
 3LWR C;  5HY2 A;  3LWV C;  3N4Y A;  3CCM F;  3CCJ F;  1YHQ F;  3LWO C;  3NK6 A;  1W2B F;  4EI8 A;  1E7K A;  3SIU A;  2JNB A;  3ON1 A;  2AIF A;  3CXC F;  1VQ5 F;  2HVY D;  3OW2 F;  2VGN A;  3CPQ A;  3PAF A;  1VQ9 F;  1SDS A;  4NQ3 A;  4BVR A;  1M1K H;  3CCV F;  1M90 H;  5GAN K;  3CCU F;  1VQ6 F;  2OZB A;  1KC8 H;  5FLX M;  1K73 H;  1GZ0 A;  1W41 A;  2F9Z C;  2VGM A;  1VQM F;  1XBI A;  3AGK A;  1W42 A;  1VQO F;  1VQ4 F;  5EWR A;  1VQK F;  2BO1 A;  2QA4 F;  4BW0 B;  1Q86 H;  3O85 A;  5HWE A;  1S72 F;  1QVG F;  3RA5 A;  1W3E X;  3G4S F;  1VQP F;  3VI6 A;  2CZW A;  1VQ7 F;  2OTJ F;  3V3T A;  3OBY A;  5FJ4 C;  4BVT A;  1K8A H;  3J80 M;  1CN7 A;  5G4V C;  4BY9 D;  5GIP C;  2QI2 A;  2WAL A;  3CD6 F;  4EI7 A;  2FC3 A;  3J81 M;  3LWP C;  1YJ9 F;  1YJW F;  3I56 F;  3SIV A;  3IR9 A;  3CMA F;  1Q82 H;  1VQL F;  3CME F;  1VQN F;  3PLA C;  3J7A R;  1GO0 A;  1ZWZ A;  3G6E F;  1T0K B;  5GAP K;  1NMU B;  3CCS F;  2I6D A;  3CCR F;  3N4Z A;  2LBX A;  3NVK E;  3E20 B;  3JAM M;  1DT9 A;  1W40 A;  2FGY A;  3CG6 A;  1X7O A;  1H7M A;  4X3L A;  3HJW C;  3NMU C;  4LCK A;  3VMF B;  5G4U C;  3NK7 A;  1NJI H;  1IPA A;  1KD1 H;  4X3M A;  5IT9 M;  3LFO A;  2KTV A;  5HY1 A;  2OTL F;  1YI2 F;  4BVQ A;  3JCM M;  5HY4 A;  5DCV A;  1QVF F;  2QEX F;  2LBW A;  2GLZ A;  3CC2 F;  3V7Q A;  1YIJ F;  3CC7 F;  5A2Q M;  5GIN C;  1PXW A;  1CK2 A;  3CC4 F;  3CCQ F;  3OBW A;  3CPW F;  1YJN F;  3NVI B;  1X7P A;  2ALE A;  1N8R H;  3HAX D;  3RA6 A;  1Q7Y H;  1YIT F;  3I55 F;  3CCL F;  3CCE F;  1KQS F;  2KG4 A;  2OHW A;  4NUT A;  3D00 A;  1Q81 H;  5EO3 A;  4C4W C;  3MCA B;  5HXU A;  4XCQ A;  5GIO C;  3LWQ C;  5HY0 A;  3G71 F;  3WXM B;  3E1Y A;  1JJ2 F;  3FFM A;  1GO1 A;  1RLG A;  2KTU A;  4BVS A;  4EI9 A;  3V7E A;  4TZZ A;  1VQ8 F;  5HXZ A;  3GYQ A;  1RA4 A;  1K9M H;  1X52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...