2KG4A

Three-dimensional structure of human gadd45alpha in solution by nmr
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
165
structure length
165
Chain Sequence
b'MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth arrest and DNA-damage-inducible protein GADD45 alpha
molecule tags Cell cycle
source organism Homo sapiens
publication title Solution structure of human growth arrest and DNA damage 45alpha (Gadd45alpha) and its interactions with proliferating cell nuclear antigen (PCNA) and Aurora A kinase
pubmed doi rcsb
total genus 40
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2009-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2kg4A00
3I55F 3VI6A 5GAPK 1YHQF 1VQ6F 3JAMM 1YJWF 3JCMM 1N8RH 3RA6A 3CCQF 1VQ9F 1T0KB 3CPWF 1YJNF 3GYQA 1W41A 4LCKA 3IR9A 1SDSA 1PXWA 3V7EA 2OTJF 1K73H 3CD6F 5GIPC 1M90H 1VQ8F 1YI2F 3LWQC 5G4UC 1RLGA 5DCVA 2VGMA 5EO3A 1YITF 1YJ9F 2HVYD 1VQOF 1VQKF 3LFOA 3CC4F 4C4WC 3O85A 1IPAA 1KD1H 3CG6A 3CCMF 1NJIH 3LWRC 2LBXA 2KTVA 3G4SF 3CCSF 3CC7F 2QA4F 3LWOC 3NK7A 1GO0A 2FC3A 1ZWZA 3CCLF 1VQ5F 1W3EX 2I6DA 1QVFF 1RA4A 1K9MH 3RA5A 5FJ4C 2QI2A 2VGNA 2QEXF 3OBWA 5GANK 3VMFB 1VQ7F 3G6EF 2OTLF 1E7KA 3MCAB 3AGKA 3V7QA 1GZ0A 1X52A 5GIOC 5GINC 2OHWA 4X3LA 3CXCF 1VQNF 2ALEA 3OW2F 3PAFA 4TZZA 1DT9A 1YIJF 5IT9M 1KC8H 3NVIB 5FLXM 3G71F 2KG4A 2JNBA 3CCRF 3J81M 3CCUF 1W42A 3OBYA 1QVGF 3HAXD 1VQLF 3HJWC 3CPQA 1K8AH 3I56F 3LWPC 1VQPF 3J80M 3ON1A 3CC2F 1W40A 4NUTA 1VQ4F 1GO1A 2LBWA 3WXMB 4BY9D 3SIUA 5G4VC 1S72F 3CCVF 4BW0B 3CCEF 3N4ZA 3E20B 3J7AR 3FFMA 1X7PA 2CZWA 3N4YA 1X7OA 1Q7YH 3CMAF 2KTUA 1VQMF 3LWVC 1M1KH 3CCJF 1CK2A 1W2BF 1H7MA 1CN7A 1XBIA 3NK6A 1KQSF 2OZBA 3SIVA 1Q86H 3E1YA 5A2QM 3CMEF 3NVKE 2AIFA 1NMUB 2WALA 2BO1A 5EWRA 1Q82H 4X3MA 1Q81H 1JJ2F 3NMUC 3PLAC
chains in the Genus database with same CATH superfamily
3I55F 3VI6A 4EB6A 3M84A 3T80A 4O4LA 3JAMM 5JCOA 1ODEA 4BVSA 3U0OA 3ZP4A 2OTMA 5EB1B 1VHAA 3RA6A 3F0FA 3HKDB 4IHJA 4O4HA 2CSLA 5BMVA 4FFBB 3FBAA 3GYQA 3IR9A 3VTIC 4B46A 4X1IA 3F0DA 2ZVYA 2K1SA 1W55A 2R751 3K2XA 3FPIA 3I7TA 1VK3A 5CA0A 5LA6B 5LP6A 1H47A 3RYHA 2W8BC 4YJ2B 1FFXA 3DDNA 5IYZB 2CHTA 2HS0A 4BT5A 4LNUA 4X20A 3I3FA 3LWRC 1UI9A 2ZAUA 3C9RA 5JCOC 4G4XA 4EI9A 1IV2A 2NMUA 1OFUA 4G4WA 1RQ2A 1W3EX 1VQ5F 1Z5VA 4X1YB 4I4TB 4U3JB 3D01A 3JALA 1RA4A 4ZHWA 4C8IA 2DT4A 2VAMA 3JAWA 3ESJA 5FJ4C 3S02A 5IYZA 2QEXF 1XV2A 2RHHA 5JVDB 3VMFB 4HNAB 5CA1B 5CB4A 2OTLF 3AGKA 1QD9A 1GZ0A 3GHZA 4TV9A 3CXCF 2ALEA 3OW2F 4RHAA 4BT7A 1DT9A 1W5BA 2VAWA 3FD5A 2VAPA 3CYQA 3WGLA 2HP3A 4ZK7A 4BT3A 3ZO8A 3K0TA 5JQGA 4BT6A 3E22A 3HTNA 3CC2F 3WJRA 2HS3A 1VQ4F 1IV1A 2LBWA 3RYCB 4BT4A 4BY9D 2L26A 3C9TA 2CW4A 4EB6B 5G4VC 4O4JA 3WJPA 3CYPB 1SA0B 4G88A 1OAPA 5AVMA 3RYFB 3J7AR 2HQSC 2KTUA 5EZYA 1VQMF 5LXTB 5HXZA 5HY4A 2H8EA 3TD3A 2UYNA 2HRYA 5HXUA 3HWUA 3VYUC 4EI8A 2OZBA 4ZHVA 1COMA 3KHNA 5A2QM 2AIFA 2ZVZA 3JARA 2G9IA 2PMPA 3N2GB 3D54A 3B6NA 5MN4A 4ZOLB 2Z1EA 3TD4A 1VQ6F 3K14A 3HKCB 3MDOA 4O2AA 2GZLA 5HWEA 5LP6C 3OONA 1T0KB 1JD1A 3VYTC 4EI7A 4LCKA 5ITZA 2UYKA 3EORA 3MBMA 3V7EA 4TV8A 4F6RA 1U3LA 4DRXB 4LNUB 3S03A 1M90H 2ZOVA 2B33A 2GLZA 5EYPA 1YI2F 3IEWA 4X1KA 2VGMA 1YJ9F 2HVYD 5IJ9A 3P10A 2AMTA 3LFOA 3CC4F 4C4WC 5J2UB 4ZOLA 3P4EA 3CCMF 1FNKA 3N2KB 4O4IB 1W5AA 2HX0A 3ELCA 4O2BA 2QA4F 2R6R1 5FNVB 2ZF8A 4B5CA 1ZWZA 1W59A 3CCLF 1PF5A 2UYPA 5EYPB 1JN1A 3LYBA 3ZOPA 4TV8B 4WBNA 3UT5A 5KMGA 5GANK 3VOAA 3G6EF 1VQ7F 3C9UA 5EAZA 5EZYB 3VIUA 1X52A 3JASB 2OHWA 4X3LA 5ITZB 2GVIA 2H8CA 2V9YA 1YIJF 3HKCA 1KC8H 2KG4A 2JNBA 4BVRA 1W42A 4ZI7B 5LP6B 3S0HA 4C8GA 2UZHA 3QHDA 1IV3A 2YXZA 5HY0A 1VQLF 3HJWC 1RQ7A 3WJQA 2CWJA 3JATB 3F0EA 5LYJB 3S0YA 1S72F 2DYYA 3CCEF 4RQOA 5BMVB 3N4ZA 3E20B 1FSZA 4G4VA 1UFYA 3N4YA 5LYJA 1X7OA 1Q7YH 3LWVC 2RHLA 1M1KH 3CCJF 4X1KB 4I55A 1W2BF 1H7MA 3NK6A 5KMGB 5MN5A 4I4TA 4U3JA 5MN6A 2RHOA 4O4JB 2HP0B 3MCQA 2WALA 2BTQB 1H48A 1Q81H 3NMUC 4WBNB 3FD6A 5GAPK 3F6MA 5JH7A 5HP8A 3JVHA 5JQGB 1N8RH 1W5EA 4G4YA 2F9ZC 3CCQF 3C9SA 5EIBC 3CPWF 1KNKA 3IEQA 1W41A 2CVLA 2UYJA 3LDTA 1JFFB 4X1IB 4IIJA 3RE3A 3KJJA 3HKEA 1YGYA 3JATA 5CA1A 1U40A 1VH8A 5GIPC 4C82A 1TUBB 5JH7B 3LWQC 1GX1A 4O4LB 2IAFA 1RLGA 5DCVA 5EO3A 3RYFA 1VQOF 3VO8A 1IPAA 4G4ZA 2ZODA 3CG6A 5LOVB 1XHOA 2HP0A 1TVKB 1SA0A 3G4SF 4B45A 3LWOC 3S0WA 2Q1XA 3VCZA 1GO0A 3WGNA 3VYSC 2MQEA 1J7HA 5IJ0B 2Z1UA 5LOVA 1SZQA 2I6DA 5LA6A 3V4DA 1K9MH 1R1MA 4KWEA 2QI2A 3OBWA 1E7KA 1YQNA 1QAHA 3MCAB 1FNJA 4FFBA 3L7QA 1XRGA 3GTZA 3RYIB 5KX5A 5GINC 4O4IA 5GIOC 1VQNF 1U3PA 3N2GA 1JFFA 4TZZA 1CLIA 3ERNA 5IT9M 2KGWA 5J2UA 3IKFA 3NVIB 3G71F 3CCRF 1QVGF 3HAXD 3IMPA 4PWTA 2Z01A 4ZHQB 4ZI7A 1NQ3A 3JAWB 2IQQA 3LWPC 3ON1A 4NUTA 1GO1A 4DRXA 3WXMB 4F6RB 2HRUA 5IJ0A 4ZHYB 2Z1TA 3CCVF 3K12A 3DC2A 2EWCA 3E22B 1W581 3FFMA 1X7PA 2CZWA 3S06A 4BVTA 2LBTA 5CA0B 1DBFA 1U43A 4YJ2A 4I50A 1CK2A 4TV9B 4I55B 3MQWA 5FNVA 1CN7A 1XBIA 4HNAA 3SIVA 5JVDA 3ZP7A 3CMEF 3NVKE 3JARB 1NMUB 2BO1A 2BTUA 5EWRA 3RYIA 5KX5B 2H6LA 4C81A 4X1YA 5B8FA 5CB4B 3PLAC 1VQVA 1YHQF 2PHNA 5GONA 1YJWF 3JCMM 3KIZA 3JAKB 1IV4A 1VQ9F 1YJNF 2IG8A 1SDSA 1PXWA 2OTJF 3JAKA 3F0GA 3RYCA 1W57A 2Z1FA 5C8YA 5HY1A 1K73H 4X20B 3CD6F 3R0PA 1VQ8F 3V3TA 4U39A 5GONB 5G4UC 3VOBA 4BT2A 4C8EA 1YITF 1T0AA 4YJ3A 2P6YA 1VQKF 2AIZP 4M8IA 2N48A 3O85A 1KD1H 3WGMA 1NJIH 3IKEA 2LBXA 2KTVA 3D00A 3WPWA 3CB2A 3CCSF 3CC7F 3TD5A 3NK7A 2VXYA 2LCAA 4DXDA 2FC3A 1RLUA 3HKDA 3Q8HA 4IHJB 4O4HB 5HY2A 5J2TB 3N2KA 5LXTA 3BYQA 1QVFF 4I50B 1W5FA 3KE1A 3RA5A 5IJ9B 2RHJA 2VGNA 5EIBD 4TUYA 1Q8RA 2YYEA 5C8YB 1X25A 4E6EA 1KNJA 1TVKA 4NQ3A 2FGYA 3V7QA 3M1XA 3PAFA 5FLXM 3UT5B 2Q1YA 3J81M 3CCUF 3OBYA 3QUWA 1FFXB 3CPQA 3WGJA 4ZHQA 1K8AH 3RYHB 3I56F 4O2AB 2I6RA 2RB9A 3J80M 3LMEA 1VQPF 1W40A 1JY8A 4IIJB 3SIUA 4BW0B 1TUBA 4O2BB 4XCQA 4YJ3B 3HKEB 1Z5WA 2BTOA 1QU9A 3CMAF 3QTYA 5EB0A 2QTPA 3JALB 2UYNB 2CHSA 3C8LA 3P0ZA 3KJKA 3WPXA 4ERHA 1KQSF 4NWOB 4TUYB 1Q86H 3E1YA 4B62A 2HS4A 1ONIA 3HKBB 3JASA 3HKBA 3M4SA 5HP7A 1Q82H 4X3MA 3WGKA 4BVQA 1JJ2F 5J2TA 4R40B
chains in the Genus database with same CATH topology
3I55F 3VI6A 5GAPK 1YHQF 1VQ6F 3JAMM 1YJWF 3JCMM 4BVSA 1N8RH 3RA6A 2F9ZC 3CCQF 5HWEA 1VQ9F 1T0KB 3CPWF 4EI7A 1YJNF 3GYQA 1W41A 4LCKA 3IR9A 1SDSA 1PXWA 3V7EA 2OTJF 5HY1A 1K73H 3CD6F 5GIPC 1M90H 1VQ8F 2GLZA 1YI2F 3V3TA 3LWQC 5G4UC 1RLGA 5DCVA 2VGMA 5EO3A 1YITF 1YJ9F 2HVYD 1VQOF 1VQKF 3LFOA 3CC4F 4C4WC 3O85A 1IPAA 1KD1H 3CG6A 3CCMF 1NJIH 3LWRC 2LBXA 2KTVA 3D00A 3G4SF 4EI9A 3CCSF 3CC7F 2QA4F 3LWOC 3NK7A 1GO0A 2FC3A 1ZWZA 3CCLF 1VQ5F 1W3EX 5HY2A 2I6DA 1QVFF 1RA4A 1K9MH 3RA5A 5FJ4C 2QI2A 2VGNA 2QEXF 3OBWA 3VMFB 5GANK 1VQ7F 3G6EF 2OTLF 1E7KA 3MCAB 3AGKA 3V7QA 1GZ0A 1X52A 2FGYA 4NQ3A 5GIOC 5GINC 2OHWA 4X3LA 3CXCF 1VQNF 2ALEA 3OW2F 3PAFA 4TZZA 1DT9A 1YIJF 5IT9M 1KC8H 3NVIB 5FLXM 3G71F 2KG4A 2JNBA 4BVRA 3J81M 3CCRF 1W42A 3OBYA 3CCUF 1QVGF 3HAXD 1VQLF 5HY0A 3HJWC 3CPQA 1K8AH 3I56F 3LWPC 1VQPF 3J80M 3ON1A 3CC2F 1W40A 4NUTA 1VQ4F 1GO1A 2LBWA 3WXMB 4BY9D 3SIUA 5G4VC 1S72F 3CCVF 4BW0B 3CCEF 3N4ZA 3E20B 4XCQA 3J7AR 3FFMA 1X7PA 2CZWA 3N4YA 4BVTA 1X7OA 1Q7YH 3CMAF 2KTUA 1VQMF 3LWVC 1M1KH 3CCJF 1CK2A 5HXZA 5HY4A 1W2BF 1H7MA 5HXUA 1CN7A 1XBIA 3NK6A 4EI8A 1KQSF 2OZBA 3SIVA 1Q86H 3E1YA 5A2QM 3CMEF 3NVKE 2AIFA 1NMUB 2WALA 2BO1A 5EWRA 1Q82H 4X3MA 4BVQA 1Q81H 1JJ2F 3NMUC 3PLAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 F;  3VI6 A;  5GAP K;  1YHQ F;  1VQ6 F;  3JAM M;  1YJW F;  3JCM M;  1N8R H;  3RA6 A;  3CCQ F;  1VQ9 F;  1T0K B;  3CPW F;  1YJN F;  3GYQ A;  1W41 A;  4LCK A;  3IR9 A;  1SDS A;  1PXW A;  3V7E A;  2OTJ F;  1K73 H;  3CD6 F;  5GIP C;  1M90 H;  1VQ8 F;  1YI2 F;  3LWQ C;  5G4U C;  1RLG A;  5DCV A;  2VGM A;  5EO3 A;  1YIT F;  1YJ9 F;  2HVY D;  1VQO F;  1VQK F;  3LFO A;  3CC4 F;  4C4W C;  3O85 A;  1IPA A;  1KD1 H;  3CG6 A;  3CCM F;  1NJI H;  3LWR C;  2LBX A;  2KTV A;  3G4S F;  3CCS F;  3CC7 F;  2QA4 F;  3LWO C;  3NK7 A;  1GO0 A;  2FC3 A;  1ZWZ A;  3CCL F;  1VQ5 F;  1W3E X;  2I6D A;  1QVF F;  1RA4 A;  1K9M H;  3RA5 A;  5FJ4 C;  2QI2 A;  2VGN A;  2QEX F;  3OBW A;  5GAN K;  3VMF B;  1VQ7 F;  3G6E F;  2OTL F;  1E7K A;  3MCA B;  3AGK A;  3V7Q A;  1GZ0 A;  1X52 A;  5GIO C;  5GIN C;  2OHW A;  4X3L A;  3CXC F;  1VQN F;  2ALE A;  3OW2 F;  3PAF A;  4TZZ A;  1DT9 A;  1YIJ F;  5IT9 M;  1KC8 H;  3NVI B;  5FLX M;  3G71 F;  2KG4 A;  2JNB A;  3CCR F;  3J81 M;  3CCU F;  1W42 A;  3OBY A;  1QVG F;  3HAX D;  1VQL F;  3HJW C;  3CPQ A;  1K8A H;  3I56 F;  3LWP C;  1VQP F;  3J80 M;  3ON1 A;  3CC2 F;  1W40 A;  4NUT A;  1VQ4 F;  1GO1 A;  2LBW A;  3WXM B;  4BY9 D;  3SIU A;  5G4V C;  1S72 F;  3CCV F;  4BW0 B;  3CCE F;  3N4Z A;  3E20 B;  3J7A R;  3FFM A;  1X7P A;  2CZW A;  3N4Y A;  1X7O A;  1Q7Y H;  3CMA F;  2KTU A;  1VQM F;  3LWV C;  1M1K H;  3CCJ F;  1CK2 A;  1W2B F;  1H7M A;  1CN7 A;  1XBI A;  3NK6 A;  1KQS F;  2OZB A;  3SIV A;  1Q86 H;  3E1Y A;  5A2Q M;  3CME F;  3NVK E;  2AIF A;  1NMU B;  2WAL A;  2BO1 A;  5EWR A;  1Q82 H;  4X3M A;  1Q81 H;  1JJ2 F;  3NMU C;  3PLA C; 
#chains in the Genus database with same CATH topology
 3I55 F;  3VI6 A;  4EB6 A;  3M84 A;  3T80 A;  4O4L A;  3JAM M;  5JCO A;  1ODE A;  4BVS A;  3U0O A;  3ZP4 A;  2OTM A;  5EB1 B;  1VHA A;  3RA6 A;  3F0F A;  3HKD B;  4IHJ A;  4O4H A;  2CSL A;  5BMV A;  4FFB B;  3FBA A;  3GYQ A;  3IR9 A;  3VTI C;  4B46 A;  4X1I A;  3F0D A;  2ZVY A;  2K1S A;  1W55 A;  2R75 1;  3K2X A;  3FPI A;  3I7T A;  1VK3 A;  5CA0 A;  5LA6 B;  5LP6 A;  1H47 A;  3RYH A;  2W8B C;  4YJ2 B;  1FFX A;  3DDN A;  5IYZ B;  2CHT A;  2HS0 A;  4BT5 A;  4LNU A;  4X20 A;  3I3F A;  3LWR C;  1UI9 A;  2ZAU A;  3C9R A;  5JCO C;  4G4X A;  4EI9 A;  1IV2 A;  2NMU A;  1OFU A;  4G4W A;  1RQ2 A;  1W3E X;  1VQ5 F;  1Z5V A;  4X1Y B;  4I4T B;  4U3J B;  3D01 A;  3JAL A;  1RA4 A;  4ZHW A;  4C8I A;  2DT4 A;  2VAM A;  3JAW A;  3ESJ A;  5FJ4 C;  3S02 A;  5IYZ A;  2QEX F;  1XV2 A;  2RHH A;  5JVD B;  3VMF B;  4HNA B;  5CA1 B;  5CB4 A;  2OTL F;  3AGK A;  1QD9 A;  1GZ0 A;  3GHZ A;  4TV9 A;  3CXC F;  2ALE A;  3OW2 F;  4RHA A;  4BT7 A;  1DT9 A;  1W5B A;  2VAW A;  3FD5 A;  2VAP A;  3CYQ A;  3WGL A;  2HP3 A;  4ZK7 A;  4BT3 A;  3ZO8 A;  3K0T A;  5JQG A;  4BT6 A;  3E22 A;  3HTN A;  3CC2 F;  3WJR A;  2HS3 A;  1VQ4 F;  1IV1 A;  2LBW A;  3RYC B;  4BT4 A;  4BY9 D;  2L26 A;  3C9T A;  2CW4 A;  4EB6 B;  5G4V C;  4O4J A;  3WJP A;  3CYP B;  1SA0 B;  4G88 A;  1OAP A;  5AVM A;  3RYF B;  3J7A R;  2HQS C;  2KTU A;  5EZY A;  1VQM F;  5LXT B;  5HXZ A;  5HY4 A;  2H8E A;  3TD3 A;  2UYN A;  2HRY A;  5HXU A;  3HWU A;  3VYU C;  4EI8 A;  2OZB A;  4ZHV A;  1COM A;  3KHN A;  5A2Q M;  2AIF A;  2ZVZ A;  3JAR A;  2G9I A;  2PMP A;  3N2G B;  3D54 A;  3B6N A;  5MN4 A;  4ZOL B;  2Z1E A;  3TD4 A;  1VQ6 F;  3K14 A;  3HKC B;  3MDO A;  4O2A A;  2GZL A;  5HWE A;  5LP6 C;  3OON A;  1T0K B;  1JD1 A;  3VYT C;  4EI7 A;  4LCK A;  5ITZ A;  2UYK A;  3EOR A;  3MBM A;  3V7E A;  4TV8 A;  4F6R A;  1U3L A;  4DRX B;  4LNU B;  3S03 A;  1M90 H;  2ZOV A;  2B33 A;  2GLZ A;  5EYP A;  1YI2 F;  3IEW A;  4X1K A;  2VGM A;  1YJ9 F;  2HVY D;  5IJ9 A;  3P10 A;  2AMT A;  3LFO A;  3CC4 F;  4C4W C;  5J2U B;  4ZOL A;  3P4E A;  3CCM F;  1FNK A;  3N2K B;  4O4I B;  1W5A A;  2HX0 A;  3ELC A;  4O2B A;  2QA4 F;  2R6R 1;  5FNV B;  2ZF8 A;  4B5C A;  1ZWZ A;  1W59 A;  3CCL F;  1PF5 A;  2UYP A;  5EYP B;  1JN1 A;  3LYB A;  3ZOP A;  4TV8 B;  4WBN A;  3UT5 A;  5KMG A;  5GAN K;  3VOA A;  3G6E F;  1VQ7 F;  3C9U A;  5EAZ A;  5EZY B;  3VIU A;  1X52 A;  3JAS B;  2OHW A;  4X3L A;  5ITZ B;  2GVI A;  2H8C A;  2V9Y A;  1YIJ F;  3HKC A;  1KC8 H;  2KG4 A;  2JNB A;  4BVR A;  1W42 A;  4ZI7 B;  5LP6 B;  3S0H A;  4C8G A;  2UZH A;  3QHD A;  1IV3 A;  2YXZ A;  5HY0 A;  1VQL F;  3HJW C;  1RQ7 A;  3WJQ A;  2CWJ A;  3JAT B;  3F0E A;  5LYJ B;  3S0Y A;  1S72 F;  2DYY A;  3CCE F;  4RQO A;  5BMV B;  3N4Z A;  3E20 B;  1FSZ A;  4G4V A;  1UFY A;  3N4Y A;  5LYJ A;  1X7O A;  1Q7Y H;  3LWV C;  2RHL A;  1M1K H;  3CCJ F;  4X1K B;  4I55 A;  1W2B F;  1H7M A;  3NK6 A;  5KMG B;  5MN5 A;  4I4T A;  4U3J A;  5MN6 A;  2RHO A;  4O4J B;  2HP0 B;  3MCQ A;  2WAL A;  2BTQ B;  1H48 A;  1Q81 H;  3NMU C;  4WBN B;  3FD6 A;  5GAP K;  3F6M A;  5JH7 A;  5HP8 A;  3JVH A;  5JQG B;  1N8R H;  1W5E A;  4G4Y A;  2F9Z C;  3CCQ F;  3C9S A;  5EIB C;  3CPW F;  1KNK A;  3IEQ A;  1W41 A;  2CVL A;  2UYJ A;  3LDT A;  1JFF B;  4X1I B;  4IIJ A;  3RE3 A;  3KJJ A;  3HKE A;  1YGY A;  3JAT A;  5CA1 A;  1U40 A;  1VH8 A;  5GIP C;  4C82 A;  1TUB B;  5JH7 B;  3LWQ C;  1GX1 A;  4O4L B;  2IAF A;  1RLG A;  5DCV A;  5EO3 A;  3RYF A;  1VQO F;  3VO8 A;  1IPA A;  4G4Z A;  2ZOD A;  3CG6 A;  5LOV B;  1XHO A;  2HP0 A;  1TVK B;  1SA0 A;  3G4S F;  4B45 A;  3LWO C;  3S0W A;  2Q1X A;  3VCZ A;  1GO0 A;  3WGN A;  3VYS C;  2MQE A;  1J7H A;  5IJ0 B;  2Z1U A;  5LOV A;  1SZQ A;  2I6D A;  5LA6 A;  3V4D A;  1K9M H;  1R1M A;  4KWE A;  2QI2 A;  3OBW A;  1E7K A;  1YQN A;  1QAH A;  3MCA B;  1FNJ A;  4FFB A;  3L7Q A;  1XRG A;  3GTZ A;  3RYI B;  5KX5 A;  5GIN C;  4O4I A;  5GIO C;  1VQN F;  1U3P A;  3N2G A;  1JFF A;  4TZZ A;  1CLI A;  3ERN A;  5IT9 M;  2KGW A;  5J2U A;  3IKF A;  3NVI B;  3G71 F;  3CCR F;  1QVG F;  3HAX D;  3IMP A;  4PWT A;  2Z01 A;  4ZHQ B;  4ZI7 A;  1NQ3 A;  3JAW B;  2IQQ A;  3LWP C;  3ON1 A;  4NUT A;  1GO1 A;  4DRX A;  3WXM B;  4F6R B;  2HRU A;  5IJ0 A;  4ZHY B;  2Z1T A;  3CCV F;  3K12 A;  3DC2 A;  2EWC A;  3E22 B;  1W58 1;  3FFM A;  1X7P A;  2CZW A;  3S06 A;  4BVT A;  2LBT A;  5CA0 B;  1DBF A;  1U43 A;  4YJ2 A;  4I50 A;  1CK2 A;  4TV9 B;  4I55 B;  3MQW A;  5FNV A;  1CN7 A;  1XBI A;  4HNA A;  3SIV A;  5JVD A;  3ZP7 A;  3CME F;  3NVK E;  3JAR B;  1NMU B;  2BO1 A;  2BTU A;  5EWR A;  3RYI A;  5KX5 B;  2H6L A;  4C81 A;  4X1Y A;  5B8F A;  5CB4 B;  3PLA C;  1VQV A;  1YHQ F;  2PHN A;  5GON A;  1YJW F;  3JCM M;  3KIZ A;  3JAK B;  1IV4 A;  1VQ9 F;  1YJN F;  2IG8 A;  1SDS A;  1PXW A;  2OTJ F;  3JAK A;  3F0G A;  3RYC A;  1W57 A;  2Z1F A;  5C8Y A;  5HY1 A;  1K73 H;  4X20 B;  3CD6 F;  3R0P A;  1VQ8 F;  3V3T A;  4U39 A;  5GON B;  5G4U C;  3VOB A;  4BT2 A;  4C8E A;  1YIT F;  1T0A A;  4YJ3 A;  2P6Y A;  1VQK F;  2AIZ P;  4M8I A;  2N48 A;  3O85 A;  1KD1 H;  3WGM A;  1NJI H;  3IKE A;  2LBX A;  2KTV A;  3D00 A;  3WPW A;  3CB2 A;  3CCS F;  3CC7 F;  3TD5 A;  3NK7 A;  2VXY A;  2LCA A;  4DXD A;  2FC3 A;  1RLU A;  3HKD A;  3Q8H A;  4IHJ B;  4O4H B;  5HY2 A;  5J2T B;  3N2K A;  5LXT A;  3BYQ A;  1QVF F;  4I50 B;  1W5F A;  3KE1 A;  3RA5 A;  5IJ9 B;  2RHJ A;  2VGN A;  5EIB D;  4TUY A;  1Q8R A;  2YYE A;  5C8Y B;  1X25 A;  4E6E A;  1KNJ A;  1TVK A;  4NQ3 A;  2FGY A;  3V7Q A;  3M1X A;  3PAF A;  5FLX M;  3UT5 B;  2Q1Y A;  3J81 M;  3CCU F;  3OBY A;  3QUW A;  1FFX B;  3CPQ A;  3WGJ A;  4ZHQ A;  1K8A H;  3RYH B;  3I56 F;  4O2A B;  2I6R A;  2RB9 A;  3J80 M;  3LME A;  1VQP F;  1W40 A;  1JY8 A;  4IIJ B;  3SIU A;  4BW0 B;  1TUB A;  4O2B B;  4XCQ A;  4YJ3 B;  3HKE B;  1Z5W A;  2BTO A;  1QU9 A;  3CMA F;  3QTY A;  5EB0 A;  2QTP A;  3JAL B;  2UYN B;  2CHS A;  3C8L A;  3P0Z A;  3KJK A;  3WPX A;  4ERH A;  1KQS F;  4NWO B;  4TUY B;  1Q86 H;  3E1Y A;  4B62 A;  2HS4 A;  1ONI A;  3HKB B;  3JAS A;  3HKB A;  3M4S A;  5HP7 A;  1Q82 H;  4X3M A;  3WGK A;  4BVQ A;  1JJ2 F;  5J2T A;  4R40 B; 
#chains in the Genus database with same CATH homology
 3I55 F;  3VI6 A;  5GAP K;  1YHQ F;  1VQ6 F;  3JAM M;  1YJW F;  3JCM M;  4BVS A;  1N8R H;  3RA6 A;  2F9Z C;  3CCQ F;  5HWE A;  1VQ9 F;  1T0K B;  3CPW F;  4EI7 A;  1YJN F;  3GYQ A;  1W41 A;  4LCK A;  3IR9 A;  1SDS A;  1PXW A;  3V7E A;  2OTJ F;  5HY1 A;  1K73 H;  3CD6 F;  5GIP C;  1M90 H;  1VQ8 F;  2GLZ A;  1YI2 F;  3V3T A;  3LWQ C;  5G4U C;  1RLG A;  5DCV A;  2VGM A;  5EO3 A;  1YIT F;  1YJ9 F;  2HVY D;  1VQO F;  1VQK F;  3LFO A;  3CC4 F;  4C4W C;  3O85 A;  1IPA A;  1KD1 H;  3CG6 A;  3CCM F;  1NJI H;  3LWR C;  2LBX A;  2KTV A;  3D00 A;  3G4S F;  4EI9 A;  3CCS F;  3CC7 F;  2QA4 F;  3LWO C;  3NK7 A;  1GO0 A;  2FC3 A;  1ZWZ A;  3CCL F;  1VQ5 F;  1W3E X;  5HY2 A;  2I6D A;  1QVF F;  1RA4 A;  1K9M H;  3RA5 A;  5FJ4 C;  2QI2 A;  2VGN A;  2QEX F;  3OBW A;  3VMF B;  5GAN K;  1VQ7 F;  3G6E F;  2OTL F;  1E7K A;  3MCA B;  3AGK A;  3V7Q A;  1GZ0 A;  1X52 A;  2FGY A;  4NQ3 A;  5GIO C;  5GIN C;  2OHW A;  4X3L A;  3CXC F;  1VQN F;  2ALE A;  3OW2 F;  3PAF A;  4TZZ A;  1DT9 A;  1YIJ F;  5IT9 M;  1KC8 H;  3NVI B;  5FLX M;  3G71 F;  2KG4 A;  2JNB A;  4BVR A;  3J81 M;  3CCR F;  1W42 A;  3OBY A;  3CCU F;  1QVG F;  3HAX D;  1VQL F;  5HY0 A;  3HJW C;  3CPQ A;  1K8A H;  3I56 F;  3LWP C;  1VQP F;  3J80 M;  3ON1 A;  3CC2 F;  1W40 A;  4NUT A;  1VQ4 F;  1GO1 A;  2LBW A;  3WXM B;  4BY9 D;  3SIU A;  5G4V C;  1S72 F;  3CCV F;  4BW0 B;  3CCE F;  3N4Z A;  3E20 B;  4XCQ A;  3J7A R;  3FFM A;  1X7P A;  2CZW A;  3N4Y A;  4BVT A;  1X7O A;  1Q7Y H;  3CMA F;  2KTU A;  1VQM F;  3LWV C;  1M1K H;  3CCJ F;  1CK2 A;  5HXZ A;  5HY4 A;  1W2B F;  1H7M A;  5HXU A;  1CN7 A;  1XBI A;  3NK6 A;  4EI8 A;  1KQS F;  2OZB A;  3SIV A;  1Q86 H;  3E1Y A;  5A2Q M;  3CME F;  3NVK E;  2AIF A;  1NMU B;  2WAL A;  2BO1 A;  5EWR A;  1Q82 H;  4X3M A;  4BVQ A;  1Q81 H;  1JJ2 F;  3NMU C;  3PLA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...