2KG7A

Structure and features of the complex formed by the tuberculosis virulence factors rv0287 and rv0288
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein esxG (PE family protein)
publication title Solution structure of the M. tuberculosis EsxG-EsxH complex: functional implications and comparisons with other M. tuberculosis Esx family complexes
rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2kg7A00
1WA8A 2KG7B 3G80A 4GZRB 3Q4HB 4ABMA 3HR0A 4LWSB 3FD9A 3FAVB 2VS0A 4I0XA 3TXSA 2B9ZA 2AZ2A 2DE0X 2KG7A 3Q4HA 4LWSA 3FAVA 2AZ0A 3GVMA 3ZBHA 3OGIB 1WA8B 2VRZA 3GWKC 3O9OA 3TXQA 4I0XB
chains in the Genus database with same CATH superfamily
2Y4UA 1DF5A 2LGWA 5IY5B 4JI2O 1NTMH 2ZM6B 1DLBA 2E3CA 2R9IA 4JTDB 3KG2A 5LOVA 1ZWIC 3Q4HA 3ABLC 1NVPD 3MHHC 4X65O 5D5QA 1HR0O 3K59A 5L3FA 3OEEG 1JJ2U 1Y76A 4FZ0A 4DRXB 2VQFO 1XMQO 3U0ZA 4AI8A 3CCRV 2KQXA 4PA3A 3TK1A 4YHHO 3ABLB 2JK5C 4U3JB 2ZT9B 1VQ8V 2ZIMA 4BWAA 5C8YB 1FPOA 1K7DA 1SC5B 2V4DA 2QEXV 5KMGB 1YF2A 2QWQB 3JD3A 1SESA 3UT5A 1FXKC 4CS2A 3ZHVA 1KU9A 2YXYA 3K0GA 5E1AC 3T1CA 1GN6A 3SPHA 1M56B 3HKCA 1Y67A 2ZD9A 4ZOLA 3P3PA 4JYYA 1N4CA 4ZHQA 2YICA 1E1QG 4O4HA 3ZHSA 5FPRA 1K3EA 3HR0A 4WBNA 3QO8A 4P30A 4BW5A 1VF5B 4DV0O 4JASA 2EILC 1FXKB 1H2GA 2CTRA 4UCRA 4J9ZB 2DJVA 3E83A 1MNGA 3K5OA 1G6UA 4DV7O 4DR4B 5FPOA 4JI7B 1IBKB 5DEDA 3CHXA 1N8RW 2BCCH 5CBGA 3K03A 5IYZB 1GN3A 3RYHB 4J42A 4U3FH 1J5EB 5LA6A 2DOSA 3IC9A 2QKSA 3ZN1A 1VF7A 1X4TA 2EILB 5KLVH 1VQPV 1WLEA 4B3SB 1YTFD 1PPJH 1GM9A 2GUZA 5GONA 4GX0A 1S72V 2WPDG 3UCSC 4DK0A 4CH6A 4AHCA 3AG3B 2XOKG 3GB7C 1K8AW 1Z2GA 3FFQA 5JWPA 3K0DA 1IXMA 1YCIA 1MZEA 4B3TO 3LUTB 4FK5C 5J2UA 2ITCC 4RO2A 5F2VO 3SPJA 4H13B 2WWWA 3OTOO 3CCJV 3P32A 1Q43A 5DM6V 4Q6GA 1GN2A 3UKMA 3OW2U 1R73A 2RMKB 5KHHA 4IL6Z 4FM2A 5IYDO 2RQ6A 4GKJO 2DQ3A 2ARHA 3JALA 4MVSA 5CB4A 3CRAA 1QNMA 4JI3O 1N32B 2PUSA 3ABUA 1S5LZ 2F43G 1NS1A 3BRCA 2V7QG 4Z1MG 3GWKC 2BTOA 3M7MX 4J7JA 2CTWA 3T1YO 2BE3A 5JJNB 4DUYO 2WA4A 4GX2A 3ABTA 4DV2O 1OZ0A 4FFKA 3ZS8C 4LF4O 1QU7A 4H33A 5KHJA 1KP2A 1I94O 3C3SA 4I4TB 1QHTA 1Q90D 4DR3B 1GTOA 1ZUQA 1YEWA 3BCCH 3JD0A 3WB1A 1K5QA 5KHKA 3A0HZ 2IU3A 3SDLA 1R1BA 4LF9O 1BQZA 4DW1A 1F23A 3DGEA 3B09A 1X59A 5KAFZ 3LDEA 4DRXA 1L0NH 1XNRB 4KFMA 4P9PA 3C3TA 3ZHRA 1QLEC 2QM8A 3OGIB 1JR9A 5A9GA 4RQFA 3ASNC 4GYCB 5CBFA 4X62O 4LF7B 4JI4O 3JAKA 4GT1A 2AW9A 3CJHB 5C8YA 3SYQA 2MW2B 3T4ZA 1M5IA 4PDMA 1VQKV 3ZHTA 4OPAA 4LWSA 2ZIOA 3B8NA 2DMXA 3C90A 3TCUA 4JI1B 3E35A 1QLEB 4RUFA 1XI1A 2HR3A 4OGQB 2JS5A 1NKDA 3ZMUA 3SYAA 1GRJA 3ASNB 4UCVA 1M90W 3RYIB 1Q86W 4DV6B 4MSWC 3VQYA 1VQOV 5FLXN 1MOFA 2F1MA 3KZIZ 3SJCC 2P90A 2R9RB 4IGGA 3RYCA 1XILA 2DYSB 5GW7A 3CCEV 2XTAA 1RPRA 3W7UA 5LYJA 2CUGA 2CTPA 2PF4E 3DC6A 4H44B 3TJTA 4KUMA 3SJQC 2IW5A 3G6EV 2OYQA 4UVAA 3RWRD 4U7OA 3X2QC 2M7WA 1QQCA 4PELA 1MZFA 4JI8B 4DV1B 3I55V 4PI2A 1D2DA 4WFBV 2WSSG 2ETNA 2GTAA 2Y0PA 3FB6C 2ITDC 3F5WC 4YJ2A 1W0KG 4YY3B 3G4SV 2CDYA 2AGAA 2YXHA 2ADPA 3R65A 1F4MA 4UCSA 1HNWO 2PYJA 1W2BU 2Q9LA 3ZEDA 2VQEB 2UU9O 2DYRC 5B1NA 3ML0A 4QNHB 4LF5B 1A32A 3L71H 3X2QB 3STLC 3JATA 4H0LB 2P67A 1RPOA 3BFRA 2ZR2A 4FZ1A 5LHGA 4DR2B 4BIOA 1B04A 1CP9A 4FLTA 2CH7A 4LF8O 3IC7A 4FLZA 4X64B 1Y74B 4O2AA 2QWPB 3CRQA 2DYRB 4MTFA 3IFXA 1W59A 2ZE5A 1TVKA 2PZSA 3OR6C 1ZLZA 3Q4HB 1VP7A 1GN4A 1N0JA 3J7AU 1IXBA 1GAXA 2CTQA 2AZ2A 1KKDA 1OCRC 1YSCA 5J2TA 4I7ZB 5EZYA 2P06A 2EIJC 1Y76B 2H8PC 2RN9A 2QSAA 3WB2A 3ZBHA 5K1PA 1YTFB 5H5NA 2VRZA 1P7BA 3B40A 4UUJC 2P4KA 4OXSA 3UO2A 3K9SA 4B3RO 1Q6HA 1ZAUA 2QGNA 4KHPO 4JF3A 1OCRB 2AZ0A 4X8AA 2UXCB 2BTQB 2EIJB 1YJNV 4JYAO 4TUYA 1N34O 4JI5B 1QR8A 1HNXO 3ZMTA 4I5SA 3ZMSA 1N33B 1L0LH 5IWAB 1NU1H 4Q20A 5EBMC 1WB7A 3UT5B 5LBQA 1YIJV 1SQBH 4D7TA 4LFBB 1DGSA 3D3QA 5LHHA 2YI9A 3HKCB 4LCUC 4UFZA 4ZOLB 2YDEA 4PI0A 4MT8A 4GKKB 5L3EA 5B1AC 1CPYA 1E1RG 4O4HB 3OE7G 4EEQA 2NR5A 3CRRA 2WLJA 4WBNB 1RSOA 4KL1A 1P7GA 4UVBA 5EC2C 4CH3A 1OCZC 2NLJC 1XL4A 3B77A 4NYKA 1HNZB 4JYCA 4FMTA 1UPGA 4YXWG 2IJJA 3F5TA 3A0RA 1Y66A 5B1AB 3W7WA 2ZKOA 2JEUA 1FKAO 3O9OA 4QIWF 4XDJA 5LA6B 2FMLA 1IBMO 4E4EA 5EBLC 1S5JA 1S5HC 4BR6A 3LSQA 1OCZB 4JI0B 2C2AA 2JDIG 1R3JC 2YUAA 5JCOA 3ASOC 1B3QA 2GUZB 3NR7A 5GONB 1SQFA 2YIAA 2R70A 1XREA 3BY6A 4B3MO 2UXDB 2QR4A 4D6TH 5J2UB 4EFBA 2E76B 1S76D 1XNQO 2VWKA 4DK1A 3ETEA 5J9PC 3H1LH 3SYPA 4BIUA 3F7YC 4JI2B 1H2KA 3ASOB 3JALB 3S3WA 5CB4B 1V54C 3RT3C 5JVDA 2OT5A 4J9YB 2A9HA 1URFA 2UUCO 4O4IA 1N0NA 3APOA 4CC6A 5BMVB 1BS3A 4X65B 4D7SA 4EB6A 3RFRA 4IIJB 1SS3A 1EM1A 5JQGA 3SYCA 2DN9A 3N2KA 3P30A 2XASA 1FJGB 4RUEA 1SA0A 4MTOA 1FXVA 3OD4A 3K08A 1V54B 2FTKA 3S3XA 3ZX6A 1FFXA 2F23A 1CXZB 3CS5A 3H01A 1FD9A 2BSKB 1Q6IA 3JCUZ 4F6EA 2JGUA 5LMNB 2Y4TA 2Z3YA 5EBWC 1WP7A 3M99B 1Q3EA 1IBLO 4GX5A 2H94A 5BR8O 1G4YB 4MVUA 4MW3A 5B1OA 1XMOB 1M56C 4H37A 1NR1A 2HFEC 3BAAA 2Q8VA 3JAKB 3LNNA 4FLUA 5HFMA 3FYEB 4R6ZA 1N36B 2Q5ZA 5LHIA 1EN5A 4DV0B 4LP8A 2BTQA 4WF9V 1O9GA 2DQ0A 4JYBA 4JTAB 4LWSB 2HP8A 2Q67A 4FFBA 1NH2B 4FM1A 3CRMA 5C93A 2X7RB 1EZJA 3CCUV 2A7WA 4TV8A 4PV1B 3ZJZA 2ZM6O 4DV3B 4DV5B 3KCYA 2ZNJA 3AEIA 5KUKA 2FKXA 4DUZB 1BHAA 3RN4A 1K33A 2ZNIA 1MG1A 4OX9B 4X1YA 4X1IA 3FB7C 4OPHA 4A5UB 1QLNA 3MDSA 3RYCB 4FLYA 4O4JA 2V1DA 1R3KC 3BABA 5LYJB 5AG2A 4WFFA 4WFHA 1XEQA 1ZL8A 3I56V 3SPIA 4WCEV 2HEPA 3EVKA 3D3IA 3OMNB 4B3TB 3ZRSA 2F93B 3AG3C 2IBZH 2PI4A 1V55C 1GK9A 1JOYA 4AQYB 4ASUG 4FJCC 2XAJA 1WB8A 1NZ6A 1IVSA 1H38A 4EKWA 1MMMA 5KUMA 4BIZA 4YJ2B 3VOUA 2QDOA 3J81N 3MD0A 3SPGA 2ADQB 1PV0A 2ZE8A 3CB2A 3AG2C 1BMFG 1I0HA 2IU0A 1E79G 1V55B 1QVGU 1FYJA 3BPZA 1K4CC 3JATB 3CCVV 4FIPC 1EN4A 2N74A 4QGPA 4CS3A 4L87A 4UCTA 4J10A 2CH7B 4DR4O 4GZRB 3KCXA 4JI7O 3AG2B 4CS4A 3E8GA 3JSNA 3CSXA 3LSSA 4O2AB 3CPWU 4P9OA 3RGBA 4LF6B 4LR3A 1BGYH 3CYOA 3F7VC 1SZXA 1TVKB 1J5EO 2UUBB 2ODMA 5BMVA 4UB8Z 1H8HG 4IIJA 2QE7G 3K5NA 2GHYA 2IJIA 1D5AA 4B3SO 5J2TB 3UM7A 5EZYB 1RP3B 4FLWA 4K0KB 3JARA 5B5EZ 1MSDA 3MHSC 3O65A 3JD1A 2W0FC 1EZVH 2BSKA 3E22A 3RVZA 1YITV 3W7TA 1WJZA 2WLIA 1KYOF 1WNSA 1THZA 3JYCA 1V9PA 2GSMB 4JPRA 2GV9A 2ZDIA 3SJBC 1KC8W 4TUYB 3H1IH 2UXNA 1R3IC 1QR9A 3P3NA 3AK1A 2JRIA 3STZC 2Q7EA 1N32O 4TQFA 5EIBD 1YJ9V 4P2ZA 1DTOA 2QTSA 3U11A 3CRCA 3G71V 3HB3B 5LL6Y 3H1JH 4CZZA 5KHIA 4YJ3A 2FL4A 2RCVA 3CEIA 2KG7A 2P4VA 5D5PA 1K34A 2DYSC 1K9MW 2JJ1G 4J11A 1WPXA 4JI6O 2XAHA 1RSOB 3OFNG 1GMGA 1GO3F 3CMEV 1P4RA 2X6AA 1SETA 1WA8A 3G80A 5JCOC 3FD9A 2PI5A 1BQ0A 1Q81W 2DW4A 1AR4A 5CMUA 4QE7A 1VIBA 2ZINA 5LMUB 3IJ4A 1VQ9V 4ZI7A 2FYUH 1AI7A 3DXRB 4MS2A 4LFAB 3CCMV 1JX9A 5L3CA 4MVMA 4G28B 2GBOA 1XNRO 1VQ6V 1YI2V 2HKOA 2UUAB 2WLHA 1KUQA 4LF7O 2EJRA 4LNUA 3E8FA 2Q7HA 4DR6B 1JVMA 1SQQH 2YXLA 2E5LB 4QE9A 2EX3A 5K1XA 1K5SA 1SRYA 2A06H 5EC1C 1JQ0A 4JAAA 2WLMA 4JI1O 5JH7A 4I50A 1SQXH 3RVYA 4DV6O 1UFIA 5JVDB 3CCLV 2A0LA 4G2KA 2LJ2A 2QM7A 4O4IB 1WN7A 2F4VB 3FYIB 4EB6B 4QPKA 2XAFA 1S3JA 1XHZA 3SR2C 1AJPA 3QVNA 4X89A 3TXSA 5EK0A 5JQGB 1XBLA 4Z1VA 3N2KB 1SA0B 1NH2D 3QF7A 1PNLA 4LFCB 2Y69C 2CGNA 1FFXB 5LGNA 5FNVB 2IH1C 5LXTA 1YDXA 4DR1B 4C7UA 5DN6G 4NXNB 4IYIA 4JI8O 3UQ8A 2HJDA 4DV1O 2HHHB 1G8MA 4NKGB 4ZIBA 3B4SA 1EBOA 4I55A 1LUWA 3HKEA 4YY3O 3FB8C 3WB0A 1OCCB 2Y69B 1QVFU 5H2FZ 5DECA 4DR7B 3L75H 1JCHA 4LF5O 3E8BA 2XNDG 1M57C 4MVQA 2B1IA 4XBFA 3K06A 1D5NA 4TOIA 3HKBA 4DR2O 1JA8A 1M93A 4B7EA 4LH6A 4NTXA 4IT5A 3CCSV 5JJEB 2UXBB 1H2NA 2OIEA 4X64O 4FFBB 3VQWA 2CAZC 3SJAC 1NJIW 1IZ3A 1WP8A 2RJZA 1VQNV 3T1HB 1OJHA 4TWKA 2OTJV 3K58A 4TV8B 2P6JA 3ZCCA 4NR1A 1M57B 5GTHZ 4NXMB 5KA6A 4HYOA 2ATKC 1LUVA 1NBMG 1WAZA 3IGAC 2E74B 2IJHA 4HBNA 4QPJA 2JS3A 4LC1A 4X1YB 4X1IB 5CN0A 4PDVA 1VQ5V 5CBHA 4MW8A 4X66O 4O4JB 4CH4A 4ZBMA 3SGIA 1Y4MA 1SZTA 1OCOB 1HP8A 2OCCC 1SQVH 5IJ0A 5EIBC 3CXHF 4NVPA 2R9AA 1ZL8B 2YIDA 5CA1A 4FM0A 3CMAV 1IX9A 1JPXA 2OCHA 1O9HA 2UXCO 2W0XA 2BOBC 3DXRA 3ZIAG 1AVMA 4JI5O 4U7NA 3OMAB 2QKAA 1N33O 1B06A 2CE4A 3L70H 2PY5A 5HFLA 2EINC 5FL7G 4LFBO 1COWG 2OCCB 2ZXWB 2M6YA 1I5YA 3K57A 2E75B 4GKKO 3LSUA 3ZRXA 1P84F 3QNEA 4DR5B 4TQDA 5LP6C 3CP1A 4JV5B 4WFEA 1K4DC 3AG1C 2K9PA 3OR7C 2FB5A 3K04A 2QJ1A 1AB3A 2EZOA 3KKYA 2HJFC 1I08A 2EINB 4X88A 1PNKA 3BA9A 3CE2A 1YJWV 4R8CA 1LNQA 1WPBA 1K97A 1XL6A 2W6JG 1PL4A 1VQMV 4IYHA 3TETA 1TUBA 3G67A 2ZQMA 4R7CA 3ZHUA 3HPLC 4JAUA 3CCQV 4PDLA 1YHQV 1AI6A 4UVCA 4LH7A 2D3OW 5LP6B 1SQPH 4KP4A 5B66Z 4N23A 1HR0B 3CC4V 3AG1B 2YEVA 1F4NA 3GVMA 3W7XA 1Q8IA 2W6IG 4O4LB 1IBLB 1TGOA 3D8CA 2VQFB 4JI0O 1XMQB 2ZDIC 1GKFA 1AP5A 1IDSA 3JARB 1VF6A 5FNVA 5KA5A 4YHHB 3PN1A 1ZTEA 3E22B 2WLKA 2Q7GA 3TGUH 3ICXA 2UXDO 4DV4O 1YZBA 5BXZA 2NNUA 3N2GA 2XHBA 5IJ9A 2WLIB 1AP6A 3JAWA 1SKVA 3ETDA 3THOA 1F51A 2XAGA 4X1KA 3WFVA 3FX7A 2QM4A 4JZGA 2Q0OC 2AXTZ 1BSMA 1S77D 1I7FA 3CC2V 4BW9A 2KB1A 4I0XA 4PHZA 1SQGA 4MTGA 1KP3A 4J7ZA 4GUNA 1ZSPA 3ZMVA 2JVDA 3CWBH 5H9CA 1M9NA 4YJ3B 4FLVA 4IHJA 2KG7B 1FJGO 4O2BA 4UV8A 2LGQA 1JFFA 3AK3A 3R66A 4DV7B 1T5EA 1ORQC 2Z0AA 1BHBA 5E79Z 1L8DA 5H6RA 4Z2WA 1FAFA 3LNMB 1AR1B 2HVJC 1WA8B 3L72H 3ZRWA 5LMNO 3I5DA 2Q73A 2IM9A 2WLNA 1NTZH 3D36A 3OUSA 2K1EA 3J80N 2PYLA 1PP9H 4ZI7B 2WA3A 1M4UA 3JD4A 3G6BA 4ICGA 1QCEA 3K3WA 2WLLA 3OT7A 5KHGA 1NI8A 2CGOA 1XMOO 2NN4A 4GCZA 4LNUB 4YIOA 4ABMA 3BEHA 1N36O 3JASA 4TV9B 1JJOA 3AK2A 3OTOB 1HWYA 4PA6A 4HZ3A 5IDJA 2N05A 1VEWA 2R72A 5JH7B 2QA4V 1Q5OA 4GKJB 5LGUA 1Z5WA 3M8AA 4KXRA 4I50B 1PNMA 4DV3O 1KECA 4DV5O 5GTIZ 4JI3B 1AI5A 3QG5A 3CC7V 4DUZO 1LR1A 4AILC 4PJ0Z 1P49A 4E2LA 3ZRVA 4L8JA 4OX9O 4XDLA 2UXXA 3ZMZA 3T1YB 4DUYB 2L6LA 3QTCA 3OUFA 4DV2B 2JJ2G 3H1KH 4LF4B 4X20B 2LO1A 2AHZA 5IE9A 1I94B 3AG7A 2Y48A 2QWNB 2OWOA 1TUEB 1IBKO 4DO2A 4J80A 2IJKA 4K8XA 1OHHG 2DE0X 1JMKC 3QO7A 3EFFK 3EHBB 5LXTB 2JGDA 4NTYA 2YC0A 5KX5A 5LP6A 1XHXA 4AQYO 1NQTA 2RDCA 4LF9B 3HKDA 1PM9A 1PKXA 3JSLA 3CX5F 4O4LA 4X9QA 1KQSU 1H2SB 4I55B 1PL0A 2YS8A 3HKEB 2X6CA 5KAIZ 1AILA 2B9ZA 5CA3A 1R6KA 1VARA 4FVMA 1M1KW 1BT8A 1ENVA 3FAVA 1VMGA 1US6A 4X62B 4JI4B 4FLXA 1H2MA 3TXQA 1DK1A 4CBCA 2EZPA 3RYFA 2EULA 1QBZA 4F6RB 4GLXA 5CA0B 1RM1C 5BZBA 2OTLV 3HKBB 4JI6B 1AJNA 4DW0A 3B8MA 3A0BZ 2KSDA 4GX1A 1H8EG 1KMIZ 2QWOB 1ROPA 1H2LA 3T4DA 4LF6O 3WU2Z 4JAVA 1TAEA 3K5MA 4HNAB 1XQ8A 2RNBA 1MABG 1KB9F 2UUBO 1U96A 1K92A 2O57A 1RM1B 4B08A 1NT2B 3CXCU 2ZE7A 2PTMA 4I9QA 4LBEC 3RW0A 3E8HA 5A2QN 1BZKA 3A8TA 1F7YA 3APQA 5LGTA 2GDSA 2HG5C 4K0KO 1SF9A 4U3JA 3NXSA 4N21A 5IJ0B 4DR3O 1KKCA 3PJSK 5KMGA 5CA1B 1Q7YW 3OTFA 2LFRA 4PDRA 1PD3A 4G27B 3OAAG 2D2CB 2HLDG 1I5XA 1Z5VA 4CH5A 2Q6AA 4PA7A 2KKWA 1HNWB 1AI4A 3EXAA 2UU9B 1NVPB 3QO5A 1TA8A 4UCUA 2B1GA 2EBOA 4TV9A 2A3QA 1FS0G 1FXKA 2ZE6A 3E2EA 4RWUA 3ABKC 1J95A 3W7SA 1R6NA 3T2MA 4TSFG 4LF8B 1K73W 1S0VA 1G1XB 4DYLA 3U10A 2IH3C 5IYZA 3RYHA 2YSUB 1U97A 1TUBB 2Q68A 3B2EE 3AG4C 4PA4A 4F4LA 1VF6C 3JCZA 4DXWA 5LMUO 4RQEA 4EFEA 3K79A 2DWEC 3ABKB 1Q82W 4LFAO 1HDJA 5ITZB 5EYPB 2YEVB 3VQXA 4X20A 1ZX3A 5IT9N 2UUAO 1R3LC 4I9WA 4PD4F 4W4KA 1AR5A 3K9AA 1OCCC 1CEZA 1DF4A 2LQTA 3OEHG 1XUQA 3AG4B 4DR6O 4UB6Z 4B3RB 2E5LO 4KHPB 2AHYA 3OMIB 4W4LA 3N27A 4MVOA 3DC5A 3N2GB 5IJ9B 3BHPA 4RAIA 1GM7A 4JYAB 4WFGA 3RBZA 3JAWB 1N34B 1HNXB 3H9VA 1EFRG 4X1KB 3ABMC 1AJQA 2Q0AA 2F66C 5L3GA 4MVZA 4XDKA 2VQEO 4I0XB 5LOVB 1R6TA 2B5UA 5BY1A 1UJWB 1HW7A 3UO3A 4FPPA 2F4VO 1NTKH 4F6RA 3L9DA 1MA1A 5CA0A 2Q4PA 2XUMA 3BA8A 1FFTB 1GM8A 3SYOA 2XT9A 4TT3G 2YI8A 4X66B 1FXHA 3D36C 3SPCA 4MTXA 3ABMB 4IHJB 1VQLV 5IYBO 2BOCC 2Z5UA 2WAMA 4I4TA 3L74H 4O2BB 3H1HH 1KD1W 4LFCO 3GWOA 2Y0IA 1JFFB 4BAYA 4ZKIA 1XDCA 3LDCA 4J7KA 2LW7A 2YIBA 2VS0A 4DR1O 4HNAA 1OCOC 4NXNO 3DSQA 1YVWA 3VQVA 2L35A 1Q6UA 1W0JG 2HHHO 2H3OA 1Y6XA 1BE3H 2EIKC 4K35A 5IYCO 1KBHA 2LW1A 3ZRWB 2G38A 2P5OA 2F95B 3OGCC 1MSWD 2ILMA 1IBMB 3OM3B 2QWRB 4J41A 3IAYA 3CD6V 2QTOA 4K3AA 2VWJA 4DR7O 2WLLB 2ZR3A 3CJHA 2Q69A 2LP7A 1VQ4V 1RFYA 2ZXWC 4JZ2A 3MAQA 4ZHQB 2EIKB 2MK3A 4PA9A 4B3MB 2A79B 5TISZ 5JJJB 3JASB 5L3DA 3ETQA 1XNQB 2JIZG 2UXBO 4WFAV 3A2FA 1AROP 5IWAO 4R50A 3RYIA 3T1HO 2ZCEA 4UV9A 3FB5C 2XAQA 4NXMO 2EIMC 2UUCB 2X0LA 1L1FA 1EN6A 3E89A 3JAMN 4UCOA 2DWDC 4CC5A 2X6BA 1B6QA 2EJ7A 2QKCA 1IURA 1GH6A 3K5LA 4NTWA 2HVKC 4B7KA 4UXNA 1XOUA 4NB5A 3WG7C 1HNZO 2EIMB 3DTUB 3JD2A 4JTCB 5B1BC 3ZN0A 3VBBA 5B3SC 3ETGA 4MVRA 3L73H 4DV4B 2YIBD 2P22C 3ZHQA 3E86A 2GTSA 2JGDB 5L3BA 5KX5B 3FKSG 5ITZA 1NR7A 4JGSA 1VQ7V 2PGGA 5EYPA 4HAMA 3HKDB 2P7TC 4K8ZA 1BL8A 1YXBA 1SERA 5BR8B 3WG7B 5B1BB 5IY5C 2CK3G 1OV9A 5B3SB 2N04A 3FAVB 5H6QA 3BVOA 4QJFB 3RYFB 4DR5O 2OIGA 4YIPA 4JV5O 3LDDA 2JEXA 2LFSA 1BCCH 1Y74A
chains in the Genus database with same CATH topology
1WA8A 2KG7B 3G80A 4GZRB 3Q4HB 4ABMA 3HR0A 4LWSB 3FD9A 3FAVB 2VS0A 4I0XA 3TXSA 2B9ZA 2AZ2A 2DE0X 2KG7A 3Q4HA 4LWSA 3FAVA 2AZ0A 3GVMA 3ZBHA 3OGIB 1WA8B 2VRZA 3GWKC 3O9OA 3TXQA 4I0XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WA8 A;  2KG7 B;  3G80 A;  4GZR B;  3Q4H B;  4ABM A;  3HR0 A;  4LWS B;  3FD9 A;  3FAV B;  2VS0 A;  4I0X A;  3TXS A;  2B9Z A;  2AZ2 A;  2DE0 X;  2KG7 A;  3Q4H A;  4LWS A;  3FAV A;  2AZ0 A;  3GVM A;  3ZBH A;  3OGI B;  1WA8 B;  2VRZ A;  3GWK C;  3O9O A;  3TXQ A;  4I0X B; 
#chains in the Genus database with same CATH topology
 2Y4U A;  1DF5 A;  2LGW A;  5IY5 B;  4JI2 O;  1NTM H;  2ZM6 B;  1DLB A;  2E3C A;  2R9I A;  4JTD B;  3KG2 A;  5LOV A;  1ZWI C;  3Q4H A;  3ABL C;  1NVP D;  3MHH C;  4X65 O;  5D5Q A;  1HR0 O;  3K59 A;  5L3F A;  3OEE G;  1JJ2 U;  1Y76 A;  4FZ0 A;  4DRX B;  2VQF O;  1XMQ O;  3U0Z A;  4AI8 A;  3CCR V;  2KQX A;  4PA3 A;  3TK1 A;  4YHH O;  3ABL B;  2JK5 C;  4U3J B;  2ZT9 B;  1VQ8 V;  2ZIM A;  4BWA A;  5C8Y B;  1FPO A;  1K7D A;  1SC5 B;  2V4D A;  2QEX V;  5KMG B;  1YF2 A;  2QWQ B;  3JD3 A;  1SES A;  3UT5 A;  1FXK C;  4CS2 A;  3ZHV A;  1KU9 A;  2YXY A;  3K0G A;  5E1A C;  3T1C A;  1GN6 A;  3SPH A;  1M56 B;  3HKC A;  1Y67 A;  2ZD9 A;  4ZOL A;  3P3P A;  4JYY A;  1N4C A;  4ZHQ A;  2YIC A;  1E1Q G;  4O4H A;  3ZHS A;  5FPR A;  1K3E A;  3HR0 A;  4WBN A;  3QO8 A;  4P30 A;  4BW5 A;  1VF5 B;  4DV0 O;  4JAS A;  2EIL C;  1FXK B;  1H2G A;  2CTR A;  4UCR A;  4J9Z B;  2DJV A;  3E83 A;  1MNG A;  3K5O A;  1G6U A;  4DV7 O;  4DR4 B;  5FPO A;  4JI7 B;  1IBK B;  5DED A;  3CHX A;  1N8R W;  2BCC H;  5CBG A;  3K03 A;  5IYZ B;  1GN3 A;  3RYH B;  4J42 A;  4U3F H;  1J5E B;  5LA6 A;  2DOS A;  3IC9 A;  2QKS A;  3ZN1 A;  1VF7 A;  1X4T A;  2EIL B;  5KLV H;  1VQP V;  1WLE A;  4B3S B;  1YTF D;  1PPJ H;  1GM9 A;  2GUZ A;  5GON A;  4GX0 A;  1S72 V;  2WPD G;  3UCS C;  4DK0 A;  4CH6 A;  4AHC A;  3AG3 B;  2XOK G;  3GB7 C;  1K8A W;  1Z2G A;  3FFQ A;  5JWP A;  3K0D A;  1IXM A;  1YCI A;  1MZE A;  4B3T O;  3LUT B;  4FK5 C;  5J2U A;  2ITC C;  4RO2 A;  5F2V O;  3SPJ A;  4H13 B;  2WWW A;  3OTO O;  3CCJ V;  3P32 A;  1Q43 A;  5DM6 V;  4Q6G A;  1GN2 A;  3UKM A;  3OW2 U;  1R73 A;  2RMK B;  5KHH A;  4IL6 Z;  4FM2 A;  5IYD O;  2RQ6 A;  4GKJ O;  2DQ3 A;  2ARH A;  3JAL A;  4MVS A;  5CB4 A;  3CRA A;  1QNM A;  4JI3 O;  1N32 B;  2PUS A;  3ABU A;  1S5L Z;  2F43 G;  1NS1 A;  3BRC A;  2V7Q G;  4Z1M G;  3GWK C;  2BTO A;  3M7M X;  4J7J A;  2CTW A;  3T1Y O;  2BE3 A;  5JJN B;  4DUY O;  2WA4 A;  4GX2 A;  3ABT A;  4DV2 O;  1OZ0 A;  4FFK A;  3ZS8 C;  4LF4 O;  1QU7 A;  4H33 A;  5KHJ A;  1KP2 A;  1I94 O;  3C3S A;  4I4T B;  1QHT A;  1Q90 D;  4DR3 B;  1GTO A;  1ZUQ A;  1YEW A;  3BCC H;  3JD0 A;  3WB1 A;  1K5Q A;  5KHK A;  3A0H Z;  2IU3 A;  3SDL A;  1R1B A;  4LF9 O;  1BQZ A;  4DW1 A;  1F23 A;  3DGE A;  3B09 A;  1X59 A;  5KAF Z;  3LDE A;  4DRX A;  1L0N H;  1XNR B;  4KFM A;  4P9P A;  3C3T A;  3ZHR A;  1QLE C;  2QM8 A;  3OGI B;  1JR9 A;  5A9G A;  4RQF A;  3ASN C;  4GYC B;  5CBF A;  4X62 O;  4LF7 B;  4JI4 O;  3JAK A;  4GT1 A;  2AW9 A;  3CJH B;  5C8Y A;  3SYQ A;  2MW2 B;  3T4Z A;  1M5I A;  4PDM A;  1VQK V;  3ZHT A;  4OPA A;  4LWS A;  2ZIO A;  3B8N A;  2DMX A;  3C90 A;  3TCU A;  4JI1 B;  3E35 A;  1QLE B;  4RUF A;  1XI1 A;  2HR3 A;  4OGQ B;  2JS5 A;  1NKD A;  3ZMU A;  3SYA A;  1GRJ A;  3ASN B;  4UCV A;  1M90 W;  3RYI B;  1Q86 W;  4DV6 B;  4MSW C;  3VQY A;  1VQO V;  5FLX N;  1MOF A;  2F1M A;  3KZI Z;  3SJC C;  2P90 A;  2R9R B;  4IGG A;  3RYC A;  1XIL A;  2DYS B;  5GW7 A;  3CCE V;  2XTA A;  1RPR A;  3W7U A;  5LYJ A;  2CUG A;  2CTP A;  2PF4 E;  3DC6 A;  4H44 B;  3TJT A;  4KUM A;  3SJQ C;  2IW5 A;  3G6E V;  2OYQ A;  4UVA A;  3RWR D;  4U7O A;  3X2Q C;  2M7W A;  1QQC A;  4PEL A;  1MZF A;  4JI8 B;  4DV1 B;  3I55 V;  4PI2 A;  1D2D A;  4WFB V;  2WSS G;  2ETN A;  2GTA A;  2Y0P A;  3FB6 C;  2ITD C;  3F5W C;  4YJ2 A;  1W0K G;  4YY3 B;  3G4S V;  2CDY A;  2AGA A;  2YXH A;  2ADP A;  3R65 A;  1F4M A;  4UCS A;  1HNW O;  2PYJ A;  1W2B U;  2Q9L A;  3ZED A;  2VQE B;  2UU9 O;  2DYR C;  5B1N A;  3ML0 A;  4QNH B;  4LF5 B;  1A32 A;  3L71 H;  3X2Q B;  3STL C;  3JAT A;  4H0L B;  2P67 A;  1RPO A;  3BFR A;  2ZR2 A;  4FZ1 A;  5LHG A;  4DR2 B;  4BIO A;  1B04 A;  1CP9 A;  4FLT A;  2CH7 A;  4LF8 O;  3IC7 A;  4FLZ A;  4X64 B;  1Y74 B;  4O2A A;  2QWP B;  3CRQ A;  2DYR B;  4MTF A;  3IFX A;  1W59 A;  2ZE5 A;  1TVK A;  2PZS A;  3OR6 C;  1ZLZ A;  3Q4H B;  1VP7 A;  1GN4 A;  1N0J A;  3J7A U;  1IXB A;  1GAX A;  2CTQ A;  2AZ2 A;  1KKD A;  1OCR C;  1YSC A;  5J2T A;  4I7Z B;  5EZY A;  2P06 A;  2EIJ C;  1Y76 B;  2H8P C;  2RN9 A;  2QSA A;  3WB2 A;  3ZBH A;  5K1P A;  1YTF B;  5H5N A;  2VRZ A;  1P7B A;  3B40 A;  4UUJ C;  2P4K A;  4OXS A;  3UO2 A;  3K9S A;  4B3R O;  1Q6H A;  1ZAU A;  2QGN A;  4KHP O;  4JF3 A;  1OCR B;  2AZ0 A;  4X8A A;  2UXC B;  2BTQ B;  2EIJ B;  1YJN V;  4JYA O;  4TUY A;  1N34 O;  4JI5 B;  1QR8 A;  1HNX O;  3ZMT A;  4I5S A;  3ZMS A;  1N33 B;  1L0L H;  5IWA B;  1NU1 H;  4Q20 A;  5EBM C;  1WB7 A;  3UT5 B;  5LBQ A;  1YIJ V;  1SQB H;  4D7T A;  4LFB B;  1DGS A;  3D3Q A;  5LHH A;  2YI9 A;  3HKC B;  4LCU C;  4UFZ A;  4ZOL B;  2YDE A;  4PI0 A;  4MT8 A;  4GKK B;  5L3E A;  5B1A C;  1CPY A;  1E1R G;  4O4H B;  3OE7 G;  4EEQ A;  2NR5 A;  3CRR A;  2WLJ A;  4WBN B;  1RSO A;  4KL1 A;  1P7G A;  4UVB A;  5EC2 C;  4CH3 A;  1OCZ C;  2NLJ C;  1XL4 A;  3B77 A;  4NYK A;  1HNZ B;  4JYC A;  4FMT A;  1UPG A;  4YXW G;  2IJJ A;  3F5T A;  3A0R A;  1Y66 A;  5B1A B;  3W7W A;  2ZKO A;  2JEU A;  1FKA O;  3O9O A;  4QIW F;  4XDJ A;  5LA6 B;  2FML A;  1IBM O;  4E4E A;  5EBL C;  1S5J A;  1S5H C;  4BR6 A;  3LSQ A;  1OCZ B;  4JI0 B;  2C2A A;  2JDI G;  1R3J C;  2YUA A;  5JCO A;  3ASO C;  1B3Q A;  2GUZ B;  3NR7 A;  5GON B;  1SQF A;  2YIA A;  2R70 A;  1XRE A;  3BY6 A;  4B3M O;  2UXD B;  2QR4 A;  4D6T H;  5J2U B;  4EFB A;  2E76 B;  1S76 D;  1XNQ O;  2VWK A;  4DK1 A;  3ETE A;  5J9P C;  3H1L H;  3SYP A;  4BIU A;  3F7Y C;  4JI2 B;  1H2K A;  3ASO B;  3JAL B;  3S3W A;  5CB4 B;  1V54 C;  3RT3 C;  5JVD A;  2OT5 A;  4J9Y B;  2A9H A;  1URF A;  2UUC O;  4O4I A;  1N0N A;  3APO A;  4CC6 A;  5BMV B;  1BS3 A;  4X65 B;  4D7S A;  4EB6 A;  3RFR A;  4IIJ B;  1SS3 A;  1EM1 A;  5JQG A;  3SYC A;  2DN9 A;  3N2K A;  3P30 A;  2XAS A;  1FJG B;  4RUE A;  1SA0 A;  4MTO A;  1FXV A;  3OD4 A;  3K08 A;  1V54 B;  2FTK A;  3S3X A;  3ZX6 A;  1FFX A;  2F23 A;  1CXZ B;  3CS5 A;  3H01 A;  1FD9 A;  2BSK B;  1Q6I A;  3JCU Z;  4F6E A;  2JGU A;  5LMN B;  2Y4T A;  2Z3Y A;  5EBW C;  1WP7 A;  3M99 B;  1Q3E A;  1IBL O;  4GX5 A;  2H94 A;  5BR8 O;  1G4Y B;  4MVU A;  4MW3 A;  5B1O A;  1XMO B;  1M56 C;  4H37 A;  1NR1 A;  2HFE C;  3BAA A;  2Q8V A;  3JAK B;  3LNN A;  4FLU A;  5HFM A;  3FYE B;  4R6Z A;  1N36 B;  2Q5Z A;  5LHI A;  1EN5 A;  4DV0 B;  4LP8 A;  2BTQ A;  4WF9 V;  1O9G A;  2DQ0 A;  4JYB A;  4JTA B;  4LWS B;  2HP8 A;  2Q67 A;  4FFB A;  1NH2 B;  4FM1 A;  3CRM A;  5C93 A;  2X7R B;  1EZJ A;  3CCU V;  2A7W A;  4TV8 A;  4PV1 B;  3ZJZ A;  2ZM6 O;  4DV3 B;  4DV5 B;  3KCY A;  2ZNJ A;  3AEI A;  5KUK A;  2FKX A;  4DUZ B;  1BHA A;  3RN4 A;  1K33 A;  2ZNI A;  1MG1 A;  4OX9 B;  4X1Y A;  4X1I A;  3FB7 C;  4OPH A;  4A5U B;  1QLN A;  3MDS A;  3RYC B;  4FLY A;  4O4J A;  2V1D A;  1R3K C;  3BAB A;  5LYJ B;  5AG2 A;  4WFF A;  4WFH A;  1XEQ A;  1ZL8 A;  3I56 V;  3SPI A;  4WCE V;  2HEP A;  3EVK A;  3D3I A;  3OMN B;  4B3T B;  3ZRS A;  2F93 B;  3AG3 C;  2IBZ H;  2PI4 A;  1V55 C;  1GK9 A;  1JOY A;  4AQY B;  4ASU G;  4FJC C;  2XAJ A;  1WB8 A;  1NZ6 A;  1IVS A;  1H38 A;  4EKW A;  1MMM A;  5KUM A;  4BIZ A;  4YJ2 B;  3VOU A;  2QDO A;  3J81 N;  3MD0 A;  3SPG A;  2ADQ B;  1PV0 A;  2ZE8 A;  3CB2 A;  3AG2 C;  1BMF G;  1I0H A;  2IU0 A;  1E79 G;  1V55 B;  1QVG U;  1FYJ A;  3BPZ A;  1K4C C;  3JAT B;  3CCV V;  4FIP C;  1EN4 A;  2N74 A;  4QGP A;  4CS3 A;  4L87 A;  4UCT A;  4J10 A;  2CH7 B;  4DR4 O;  4GZR B;  3KCX A;  4JI7 O;  3AG2 B;  4CS4 A;  3E8G A;  3JSN A;  3CSX A;  3LSS A;  4O2A B;  3CPW U;  4P9O A;  3RGB A;  4LF6 B;  4LR3 A;  1BGY H;  3CYO A;  3F7V C;  1SZX A;  1TVK B;  1J5E O;  2UUB B;  2ODM A;  5BMV A;  4UB8 Z;  1H8H G;  4IIJ A;  2QE7 G;  3K5N A;  2GHY A;  2IJI A;  1D5A A;  4B3S O;  5J2T B;  3UM7 A;  5EZY B;  1RP3 B;  4FLW A;  4K0K B;  3JAR A;  5B5E Z;  1MSD A;  3MHS C;  3O65 A;  3JD1 A;  2W0F C;  1EZV H;  2BSK A;  3E22 A;  3RVZ A;  1YIT V;  3W7T A;  1WJZ A;  2WLI A;  1KYO F;  1WNS A;  1THZ A;  3JYC A;  1V9P A;  2GSM B;  4JPR A;  2GV9 A;  2ZDI A;  3SJB C;  1KC8 W;  4TUY B;  3H1I H;  2UXN A;  1R3I C;  1QR9 A;  3P3N A;  3AK1 A;  2JRI A;  3STZ C;  2Q7E A;  1N32 O;  4TQF A;  5EIB D;  1YJ9 V;  4P2Z A;  1DTO A;  2QTS A;  3U11 A;  3CRC A;  3G71 V;  3HB3 B;  5LL6 Y;  3H1J H;  4CZZ A;  5KHI A;  4YJ3 A;  2FL4 A;  2RCV A;  3CEI A;  2KG7 A;  2P4V A;  5D5P A;  1K34 A;  2DYS C;  1K9M W;  2JJ1 G;  4J11 A;  1WPX A;  4JI6 O;  2XAH A;  1RSO B;  3OFN G;  1GMG A;  1GO3 F;  3CME V;  1P4R A;  2X6A A;  1SET A;  1WA8 A;  3G80 A;  5JCO C;  3FD9 A;  2PI5 A;  1BQ0 A;  1Q81 W;  2DW4 A;  1AR4 A;  5CMU A;  4QE7 A;  1VIB A;  2ZIN A;  5LMU B;  3IJ4 A;  1VQ9 V;  4ZI7 A;  2FYU H;  1AI7 A;  3DXR B;  4MS2 A;  4LFA B;  3CCM V;  1JX9 A;  5L3C A;  4MVM A;  4G28 B;  2GBO A;  1XNR O;  1VQ6 V;  1YI2 V;  2HKO A;  2UUA B;  2WLH A;  1KUQ A;  4LF7 O;  2EJR A;  4LNU A;  3E8F A;  2Q7H A;  4DR6 B;  1JVM A;  1SQQ H;  2YXL A;  2E5L B;  4QE9 A;  2EX3 A;  5K1X A;  1K5S A;  1SRY A;  2A06 H;  5EC1 C;  1JQ0 A;  4JAA A;  2WLM A;  4JI1 O;  5JH7 A;  4I50 A;  1SQX H;  3RVY A;  4DV6 O;  1UFI A;  5JVD B;  3CCL V;  2A0L A;  4G2K A;  2LJ2 A;  2QM7 A;  4O4I B;  1WN7 A;  2F4V B;  3FYI B;  4EB6 B;  4QPK A;  2XAF A;  1S3J A;  1XHZ A;  3SR2 C;  1AJP A;  3QVN A;  4X89 A;  3TXS A;  5EK0 A;  5JQG B;  1XBL A;  4Z1V A;  3N2K B;  1SA0 B;  1NH2 D;  3QF7 A;  1PNL A;  4LFC B;  2Y69 C;  2CGN A;  1FFX B;  5LGN A;  5FNV B;  2IH1 C;  5LXT A;  1YDX A;  4DR1 B;  4C7U A;  5DN6 G;  4NXN B;  4IYI A;  4JI8 O;  3UQ8 A;  2HJD A;  4DV1 O;  2HHH B;  1G8M A;  4NKG B;  4ZIB A;  3B4S A;  1EBO A;  4I55 A;  1LUW A;  3HKE A;  4YY3 O;  3FB8 C;  3WB0 A;  1OCC B;  2Y69 B;  1QVF U;  5H2F Z;  5DEC A;  4DR7 B;  3L75 H;  1JCH A;  4LF5 O;  3E8B A;  2XND G;  1M57 C;  4MVQ A;  2B1I A;  4XBF A;  3K06 A;  1D5N A;  4TOI A;  3HKB A;  4DR2 O;  1JA8 A;  1M93 A;  4B7E A;  4LH6 A;  4NTX A;  4IT5 A;  3CCS V;  5JJE B;  2UXB B;  1H2N A;  2OIE A;  4X64 O;  4FFB B;  3VQW A;  2CAZ C;  3SJA C;  1NJI W;  1IZ3 A;  1WP8 A;  2RJZ A;  1VQN V;  3T1H B;  1OJH A;  4TWK A;  2OTJ V;  3K58 A;  4TV8 B;  2P6J A;  3ZCC A;  4NR1 A;  1M57 B;  5GTH Z;  4NXM B;  5KA6 A;  4HYO A;  2ATK C;  1LUV A;  1NBM G;  1WAZ A;  3IGA C;  2E74 B;  2IJH A;  4HBN A;  4QPJ A;  2JS3 A;  4LC1 A;  4X1Y B;  4X1I B;  5CN0 A;  4PDV A;  1VQ5 V;  5CBH A;  4MW8 A;  4X66 O;  4O4J B;  4CH4 A;  4ZBM A;  3SGI A;  1Y4M A;  1SZT A;  1OCO B;  1HP8 A;  2OCC C;  1SQV H;  5IJ0 A;  5EIB C;  3CXH F;  4NVP A;  2R9A A;  1ZL8 B;  2YID A;  5CA1 A;  4FM0 A;  3CMA V;  1IX9 A;  1JPX A;  2OCH A;  1O9H A;  2UXC O;  2W0X A;  2BOB C;  3DXR A;  3ZIA G;  1AVM A;  4JI5 O;  4U7N A;  3OMA B;  2QKA A;  1N33 O;  1B06 A;  2CE4 A;  3L70 H;  2PY5 A;  5HFL A;  2EIN C;  5FL7 G;  4LFB O;  1COW G;  2OCC B;  2ZXW B;  2M6Y A;  1I5Y A;  3K57 A;  2E75 B;  4GKK O;  3LSU A;  3ZRX A;  1P84 F;  3QNE A;  4DR5 B;  4TQD A;  5LP6 C;  3CP1 A;  4JV5 B;  4WFE A;  1K4D C;  3AG1 C;  2K9P A;  3OR7 C;  2FB5 A;  3K04 A;  2QJ1 A;  1AB3 A;  2EZO A;  3KKY A;  2HJF C;  1I08 A;  2EIN B;  4X88 A;  1PNK A;  3BA9 A;  3CE2 A;  1YJW V;  4R8C A;  1LNQ A;  1WPB A;  1K97 A;  1XL6 A;  2W6J G;  1PL4 A;  1VQM V;  4IYH A;  3TET A;  1TUB A;  3G67 A;  2ZQM A;  4R7C A;  3ZHU A;  3HPL C;  4JAU A;  3CCQ V;  4PDL A;  1YHQ V;  1AI6 A;  4UVC A;  4LH7 A;  2D3O W;  5LP6 B;  1SQP H;  4KP4 A;  5B66 Z;  4N23 A;  1HR0 B;  3CC4 V;  3AG1 B;  2YEV A;  1F4N A;  3GVM A;  3W7X A;  1Q8I A;  2W6I G;  4O4L B;  1IBL B;  1TGO A;  3D8C A;  2VQF B;  4JI0 O;  1XMQ B;  2ZDI C;  1GKF A;  1AP5 A;  1IDS A;  3JAR B;  1VF6 A;  5FNV A;  5KA5 A;  4YHH B;  3PN1 A;  1ZTE A;  3E22 B;  2WLK A;  2Q7G A;  3TGU H;  3ICX A;  2UXD O;  4DV4 O;  1YZB A;  5BXZ A;  2NNU A;  3N2G A;  2XHB A;  5IJ9 A;  2WLI B;  1AP6 A;  3JAW A;  1SKV A;  3ETD A;  3THO A;  1F51 A;  2XAG A;  4X1K A;  3WFV A;  3FX7 A;  2QM4 A;  4JZG A;  2Q0O C;  2AXT Z;  1BSM A;  1S77 D;  1I7F A;  3CC2 V;  4BW9 A;  2KB1 A;  4I0X A;  4PHZ A;  1SQG A;  4MTG A;  1KP3 A;  4J7Z A;  4GUN A;  1ZSP A;  3ZMV A;  2JVD A;  3CWB H;  5H9C A;  1M9N A;  4YJ3 B;  4FLV A;  4IHJ A;  2KG7 B;  1FJG O;  4O2B A;  4UV8 A;  2LGQ A;  1JFF A;  3AK3 A;  3R66 A;  4DV7 B;  1T5E A;  1ORQ C;  2Z0A A;  1BHB A;  5E79 Z;  1L8D A;  5H6R A;  4Z2W A;  1FAF A;  3LNM B;  1AR1 B;  2HVJ C;  1WA8 B;  3L72 H;  3ZRW A;  5LMN O;  3I5D A;  2Q73 A;  2IM9 A;  2WLN A;  1NTZ H;  3D36 A;  3OUS A;  2K1E A;  3J80 N;  2PYL A;  1PP9 H;  4ZI7 B;  2WA3 A;  1M4U A;  3JD4 A;  3G6B A;  4ICG A;  1QCE A;  3K3W A;  2WLL A;  3OT7 A;  5KHG A;  1NI8 A;  2CGO A;  1XMO O;  2NN4 A;  4GCZ A;  4LNU B;  4YIO A;  4ABM A;  3BEH A;  1N36 O;  3JAS A;  4TV9 B;  1JJO A;  3AK2 A;  3OTO B;  1HWY A;  4PA6 A;  4HZ3 A;  5IDJ A;  2N05 A;  1VEW A;  2R72 A;  5JH7 B;  2QA4 V;  1Q5O A;  4GKJ B;  5LGU A;  1Z5W A;  3M8A A;  4KXR A;  4I50 B;  1PNM A;  4DV3 O;  1KEC A;  4DV5 O;  5GTI Z;  4JI3 B;  1AI5 A;  3QG5 A;  3CC7 V;  4DUZ O;  1LR1 A;  4AIL C;  4PJ0 Z;  1P49 A;  4E2L A;  3ZRV A;  4L8J A;  4OX9 O;  4XDL A;  2UXX A;  3ZMZ A;  3T1Y B;  4DUY B;  2L6L A;  3QTC A;  3OUF A;  4DV2 B;  2JJ2 G;  3H1K H;  4LF4 B;  4X20 B;  2LO1 A;  2AHZ A;  5IE9 A;  1I94 B;  3AG7 A;  2Y48 A;  2QWN B;  2OWO A;  1TUE B;  1IBK O;  4DO2 A;  4J80 A;  2IJK A;  4K8X A;  1OHH G;  2DE0 X;  1JMK C;  3QO7 A;  3EFF K;  3EHB B;  5LXT B;  2JGD A;  4NTY A;  2YC0 A;  5KX5 A;  5LP6 A;  1XHX A;  4AQY O;  1NQT A;  2RDC A;  4LF9 B;  3HKD A;  1PM9 A;  1PKX A;  3JSL A;  3CX5 F;  4O4L A;  4X9Q A;  1KQS U;  1H2S B;  4I55 B;  1PL0 A;  2YS8 A;  3HKE B;  2X6C A;  5KAI Z;  1AIL A;  2B9Z A;  5CA3 A;  1R6K A;  1VAR A;  4FVM A;  1M1K W;  1BT8 A;  1ENV A;  3FAV A;  1VMG A;  1US6 A;  4X62 B;  4JI4 B;  4FLX A;  1H2M A;  3TXQ A;  1DK1 A;  4CBC A;  2EZP A;  3RYF A;  2EUL A;  1QBZ A;  4F6R B;  4GLX A;  5CA0 B;  1RM1 C;  5BZB A;  2OTL V;  3HKB B;  4JI6 B;  1AJN A;  4DW0 A;  3B8M A;  3A0B Z;  2KSD A;  4GX1 A;  1H8E G;  1KMI Z;  2QWO B;  1ROP A;  1H2L A;  3T4D A;  4LF6 O;  3WU2 Z;  4JAV A;  1TAE A;  3K5M A;  4HNA B;  1XQ8 A;  2RNB A;  1MAB G;  1KB9 F;  2UUB O;  1U96 A;  1K92 A;  2O57 A;  1RM1 B;  4B08 A;  1NT2 B;  3CXC U;  2ZE7 A;  2PTM A;  4I9Q A;  4LBE C;  3RW0 A;  3E8H A;  5A2Q N;  1BZK A;  3A8T A;  1F7Y A;  3APQ A;  5LGT A;  2GDS A;  2HG5 C;  4K0K O;  1SF9 A;  4U3J A;  3NXS A;  4N21 A;  5IJ0 B;  4DR3 O;  1KKC A;  3PJS K;  5KMG A;  5CA1 B;  1Q7Y W;  3OTF A;  2LFR A;  4PDR A;  1PD3 A;  4G27 B;  3OAA G;  2D2C B;  2HLD G;  1I5X A;  1Z5V A;  4CH5 A;  2Q6A A;  4PA7 A;  2KKW A;  1HNW B;  1AI4 A;  3EXA A;  2UU9 B;  1NVP B;  3QO5 A;  1TA8 A;  4UCU A;  2B1G A;  2EBO A;  4TV9 A;  2A3Q A;  1FS0 G;  1FXK A;  2ZE6 A;  3E2E A;  4RWU A;  3ABK C;  1J95 A;  3W7S A;  1R6N A;  3T2M A;  4TSF G;  4LF8 B;  1K73 W;  1S0V A;  1G1X B;  4DYL A;  3U10 A;  2IH3 C;  5IYZ A;  3RYH A;  2YSU B;  1U97 A;  1TUB B;  2Q68 A;  3B2E E;  3AG4 C;  4PA4 A;  4F4L A;  1VF6 C;  3JCZ A;  4DXW A;  5LMU O;  4RQE A;  4EFE A;  3K79 A;  2DWE C;  3ABK B;  1Q82 W;  4LFA O;  1HDJ A;  5ITZ B;  5EYP B;  2YEV B;  3VQX A;  4X20 A;  1ZX3 A;  5IT9 N;  2UUA O;  1R3L C;  4I9W A;  4PD4 F;  4W4K A;  1AR5 A;  3K9A A;  1OCC C;  1CEZ A;  1DF4 A;  2LQT A;  3OEH G;  1XUQ A;  3AG4 B;  4DR6 O;  4UB6 Z;  4B3R B;  2E5L O;  4KHP B;  2AHY A;  3OMI B;  4W4L A;  3N27 A;  4MVO A;  3DC5 A;  3N2G B;  5IJ9 B;  3BHP A;  4RAI A;  1GM7 A;  4JYA B;  4WFG A;  3RBZ A;  3JAW B;  1N34 B;  1HNX B;  3H9V A;  1EFR G;  4X1K B;  3ABM C;  1AJQ A;  2Q0A A;  2F66 C;  5L3G A;  4MVZ A;  4XDK A;  2VQE O;  4I0X B;  5LOV B;  1R6T A;  2B5U A;  5BY1 A;  1UJW B;  1HW7 A;  3UO3 A;  4FPP A;  2F4V O;  1NTK H;  4F6R A;  3L9D A;  1MA1 A;  5CA0 A;  2Q4P A;  2XUM A;  3BA8 A;  1FFT B;  1GM8 A;  3SYO A;  2XT9 A;  4TT3 G;  2YI8 A;  4X66 B;  1FXH A;  3D36 C;  3SPC A;  4MTX A;  3ABM B;  4IHJ B;  1VQL V;  5IYB O;  2BOC C;  2Z5U A;  2WAM A;  4I4T A;  3L74 H;  4O2B B;  3H1H H;  1KD1 W;  4LFC O;  3GWO A;  2Y0I A;  1JFF B;  4BAY A;  4ZKI A;  1XDC A;  3LDC A;  4J7K A;  2LW7 A;  2YIB A;  2VS0 A;  4DR1 O;  4HNA A;  1OCO C;  4NXN O;  3DSQ A;  1YVW A;  3VQV A;  2L35 A;  1Q6U A;  1W0J G;  2HHH O;  2H3O A;  1Y6X A;  1BE3 H;  2EIK C;  4K35 A;  5IYC O;  1KBH A;  2LW1 A;  3ZRW B;  2G38 A;  2P5O A;  2F95 B;  3OGC C;  1MSW D;  2ILM A;  1IBM B;  3OM3 B;  2QWR B;  4J41 A;  3IAY A;  3CD6 V;  2QTO A;  4K3A A;  2VWJ A;  4DR7 O;  2WLL B;  2ZR3 A;  3CJH A;  2Q69 A;  2LP7 A;  1VQ4 V;  1RFY A;  2ZXW C;  4JZ2 A;  3MAQ A;  4ZHQ B;  2EIK B;  2MK3 A;  4PA9 A;  4B3M B;  2A79 B;  5TIS Z;  5JJJ B;  3JAS B;  5L3D A;  3ETQ A;  1XNQ B;  2JIZ G;  2UXB O;  4WFA V;  3A2F A;  1ARO P;  5IWA O;  4R50 A;  3RYI A;  3T1H O;  2ZCE A;  4UV9 A;  3FB5 C;  2XAQ A;  4NXM O;  2EIM C;  2UUC B;  2X0L A;  1L1F A;  1EN6 A;  3E89 A;  3JAM N;  4UCO A;  2DWD C;  4CC5 A;  2X6B A;  1B6Q A;  2EJ7 A;  2QKC A;  1IUR A;  1GH6 A;  3K5L A;  4NTW A;  2HVK C;  4B7K A;  4UXN A;  1XOU A;  4NB5 A;  3WG7 C;  1HNZ O;  2EIM B;  3DTU B;  3JD2 A;  4JTC B;  5B1B C;  3ZN0 A;  3VBB A;  5B3S C;  3ETG A;  4MVR A;  3L73 H;  4DV4 B;  2YIB D;  2P22 C;  3ZHQ A;  3E86 A;  2GTS A;  2JGD B;  5L3B A;  5KX5 B;  3FKS G;  5ITZ A;  1NR7 A;  4JGS A;  1VQ7 V;  2PGG A;  5EYP A;  4HAM A;  3HKD B;  2P7T C;  4K8Z A;  1BL8 A;  1YXB A;  1SER A;  5BR8 B;  3WG7 B;  5B1B B;  5IY5 C;  2CK3 G;  1OV9 A;  5B3S B;  2N04 A;  3FAV B;  5H6Q A;  3BVO A;  4QJF B;  3RYF B;  4DR5 O;  2OIG A;  4YIP A;  4JV5 O;  3LDD A;  2JEX A;  2LFS A;  1BCC H;  1Y74 A; 
#chains in the Genus database with same CATH homology
 1WA8 A;  2KG7 B;  3G80 A;  4GZR B;  3Q4H B;  4ABM A;  3HR0 A;  4LWS B;  3FD9 A;  3FAV B;  2VS0 A;  4I0X A;  3TXS A;  2B9Z A;  2AZ2 A;  2DE0 X;  2KG7 A;  3Q4H A;  4LWS A;  3FAV A;  2AZ0 A;  3GVM A;  3ZBH A;  3OGI B;  1WA8 B;  2VRZ A;  3GWK C;  3O9O A;  3TXQ A;  4I0X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...