2KG7A

Structure and features of the complex formed by the tuberculosis virulence factors rv0287 and rv0288
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the M. tuberculosis EsxG-EsxH complex: functional implications and comparisons with other M. tuberculosis Esx family complexes
rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Uncharacterized protein esxG (PE family protein)
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2kg7A00
4I0XB 4LWSA 3Q4HB 3ZBHA 3Q4HA 3FAVA 2KG7B 3OGIB 3FD9A 2KG7A 3FAVB 2VRZA 3GWKC 4GZRB 1WA8B 3GVMA 2DE0X 3TXQA 1WA8A 4ABMA 3G80A 3O9OA 3TXSA 2B9ZA 2AZ2A 2AZ0A 4I0XA 4LWSB 2VS0A 3HR0A
chains in the Genus database with same CATH superfamily
1LUVA 1YTFD 4R6ZA 3PJSK 5J2TB 3ZS8C 4NXNO 4EB6B 3X2QB 5LA6A 2WLIB 1FFXB 4OX9B 3CCEV 2N04A 3FX7A 4RUEA 3MDSA 5H6QA 4JAAA 3ETGA 3VQYA 4AI8A 4FZ0A 4X1KA 2A3QA 4X66O 5JH7A 1WLEA 2ZKOA 5JH7B 4NR1A 3G6EV 3RYFA 4FLYA 3ABLC 4DW0A 5DEDA 2WLKA 2WLNA 4X88A 3K08A 4GKJB 3F5TA 4DR7O 1LUWA 2ZINA 2EIMC 1Q6UA 3ZHUA 5BY1A 1I5XA 1G8MA 1WAZA 4JYAO 3T4DA 1XNQB 4JI5O 3L71H 3CRQA 4RQEA 4KUMA 2XAFA 3JD1A 3DC6A 1KMIZ 3RYFB 2HR3A 1IBLO 3VOUA 4BAYA 1Q43A 5FL7G 1XNRO 1CEZA 2F95B 4H37A 2JJ1G 5LMUB 4NYKA 4PDMA 4DYLA 2XAQA 3SJAC 5LA6B 4DR7B 1FXVA 2ARHA 5CA1B 4K0KB 5J9PC 1KC8W 4TV9B 2D3OW 3AG3B 5LL6Y 2IBZH 2RCVA 3NR7A 1FYJA 1SQFA 4FM0A 3JD3A 1WPBA 4CC5A 3BAAA 1NTMH 3AG1B 4D6TH 1U96A 1Z2GA 2CDYA 1H2NA 5ITZA 1US6A 1JFFA 2F93B 3ETDA 5EYPB 5LOVB 2Q8VA 5FLXN 2FMLA 5KHGA 1XMQB 1FD9A 3K9SA 3E8GA 4JYBA 3CD6V 3ICXA 3SPIA 1VQPV 4EEQA 2YXHA 2CTRA 4IHJB 5CBFA 1V54B 1HW7A 1DTOA 2UXNA 4MVRA 3CP1A 4B7KA 1S3JA 2PTMA 2OWOA 4TUYB 3OUSA 3CCUV 3OW2U 4LF5O 4KP4A 4I9QA 3CB2A 3WU2Z 2IH3C 4JAUA 1JVMA 2WWWA 1NS1A 2V1DA 4CS4A 3A0RA 1VF5B 4TWKA 1ZL8B 4DK0A 1K9MW 1H38A 4FVMA 1VP7A 3EXAA 3AK2A 5CA0B 1QLEB 1A32A 5D5QA 4PDRA 1B06A 3DGEA 4DR5O 2GBOA 3CE2A 5EK0A 3UCSC 5B3SB 4DK1A 3ZHRA 4FLWA 1XL4A 4PV1B 1QR8A 2XTAA 4O4JA 4IT5A 4R8CA 1SESA 4WBNA 3G80A 3BHPA 2MW2B 1EBOA 1TA8A 3B8MA 3ZRXA 2ZE7A 4YIPA 4YJ2B 5E79Z 1R6NA 3ZN1A 3AG7A 1JR9A 2VQEO 1AR4A 2VWJA 2RNBA 5CBHA 4UVAA 4LF7O 4W4KA 3OMNB 1YSCA 5BZBA 4X65B 2ZDIC 2A0LA 1JMKC 5KMGA 2AHZA 3SJCC 5JQGA 3ABKC 2FB5A 4J7ZA 4LF4B 2OYQA 1M56B 3OR7C 1FXKC 4U3JA 1Q5OA 1Y74A 3GWKC 3K03A 4GKKO 1BHAA 1Q3EA 3RYCB 1OCRB 3I56V 2LFSA 3MHSC 5JCOC 1EZVH 3HR0A 1VQNV 5GW7A 1JFFB 1QBZA 4F4LA 1J5EB 1SQVH 2KG7A 4BW9A 2VWKA 2GTAA 2MK3A 3UO2A 2EJ7A 3G71V 2Y69C 3ASNB 2LJ2A 4KFMA 5BMVA 4UXNA 4ABMA 2PUSA 4IGGA 4AQYB 1NZ6A 1R3KC 2F1MA 2CUGA 2DYRC 2QWRB 2YI9A 3TGUH 2XASA 5B1OA 2HEPA 2ZCEA 4B08A 2X0LA 3EVKA 5F2VO 3P3NA 4H44B 1GO3F 5K1XA 3A8TA 4X62B 3IJ4A 1W0JG 2GHYA 1BZKA 4BIOA 1YIJV 3LNNA 4U7NA 1RPOA 3BA9A 3E89A 1SRYA 1WB7A 1F23A 1NH2B 3JATA 2LGWA 4LC1A 1XNQO 4ZI7B 1PV0A 1K92A 2H94A 3B40A 4FJCC 3TETA 3OMAB 4IIJA 2AXTZ 4GKJO 1IX9A 2YC0A 1OCCC 1VF6C 2Q69A 4AILC 4DXWA 2UXBO 1K8AW 1PD3A 2JS5A 5JQGB 3OGIB 4G27B 5KHHA 1F7YA 1I7FA 2A9HA 2QE7G 3HKBA 1EFRG 4JTCB 4DUZB 1RM1C 1KP2A 2NN4A 4ZOLB 3AK3A 4WBNB 3JAMN 1NKDA 1VF7A 2QDOA 1URFA 4N23A 4PA9A 4F6EA 4GT1A 2F43G 2F66C 4Z1VA 3ABMB 2E5LB 2ZE8A 1M4UA 2CGNA 3FB6C 2CK3G 3WG7B 2HHHB 1N0JA 3AG2C 2QWNB 2PF4E 4K3AA 5IJ9B 1HWYA 1UPGA 2YXLA 1HNZB 2LW7A 5BR8O 5LMUO 3MD0A 2QA4V 2Y0IA 4GX0A 1ZWIC 4Z1MG 4X1IB 1FKAO 2BOBC 1R6TA 2NR5A 5L3CA 4HZ3A 1JA8A 5EC2C 1FXKB 2P4KA 1W0KG 1YITV 4FFKA 2ITCC 3IGAC 4O2AA 4JZGA 1YJWV 4O2AB 2ZDIA 3E8FA 2F4VO 4TUYA 2N74A 3ETQA 2R9AA 2HLDG 2R9RB 2AZ2A 3E83A 4O4LB 3ZRSA 2JK5C 3ASOC 3M7MX 4FK5C 1VQ6V 2ITDC 3L9DA 3JCZA 4BIUA 5FPRA 3DXRA 2VQFB 5KUMA 4J80A 1WA8B 3OEHG 4AQYO 3SYQA 3ABUA 3SDLA 5DM6V 1RPRA 4FFBB 1SQBH 2IJIA 4YY3B 3ZMUA 1NVPD 3LDEA 4MTGA 3OAAG 1Y76A 3FKSG 1OCZB 5EZYB 4UV8A 2CE4A 3FB8C 2QTSA 4DV0O 3E86A 1NT2B 2QWPB 4FZ1A 4X1YB 5LHHA 2AW9A 2VRZA 2PYJA 1HDJA 1EM1A 4U7OA 1N33B 2ZM6O 5LGUA 2R70A 4YJ3A 2OCCB 4BIZA 3BRCA 5IYDO 5EIBD 1SKVA 1N32B 1AB3A 1HNXB 3HKDA 4ZHQB 3K0GA 2KG7B 1VQOV 5JVDA 4UFZA 2Q67A 5H5NA 2WSSG 4MTOA 1R1BA 2PZSA 1XL6A 1WB8A 5L3FA 1HNWB 3T1YB 3ZRWA 4LCUC 2Z0AA 4JI4B 4B3RO 5E1AC 3SPGA 5IY5B 3JASB 2DWEC 2VQEB 1P4RA 5ITZB 2UUAO 4DO2A 4UCOA 1TGOA 4MVUA 5LGTA 2JGDA 2V4DA 3L75H 2M6YA 2JGDB 2RN9A 3ZIAG 1B3QA 5LYJA 1XMQO 2WA3A 2DJVA 4JI7O 1HR0B 1PL0A 2Y0PA 3JSLA 4FLXA 4DW1A 4E4EA 3LNMB 4I50B 1B04A 2B1IA 4OX9O 2YUAA 5JVDB 2L6LA 3Q4HA 3HKEB 1L8DA 2ZXWC 1MABG 3E2EA 4DUYO 4JI1B 1PL4A 4N21A 4O4IA 3CCJV 2BE3A 1WA8A 4G28B 2UUAB 3FFQA 1Y66A 3JASA 2NLJC 2GV9A 3G4SV 2E5LO 1WJZA 3S3WA 4JTDB 3K5LA 5IYBO 4I55B 3APOA 1K34A 3HKCA 2DYSB 1S5JA 1YDXA 1GK9A 1VQ8V 2HVJC 1SS3A 4MSWC 1F4NA 2Q5ZA 4X20A 4NXMO 3H1LH 4FLUA 3B77A 2CGOA 1L1FA 3K5NA 3K57A 1H2KA 1L0LH 4DR4O 4DRXB 5LP6B 1VQ4V 4PHZA 1COWG 2O57A 2DQ0A 4C7UA 1CPYA 1Y6XA 3BA8A 4CH5A 2ETNA 3ZMTA 1YXBA 1WNSA 2EILC 2BTQA 1ZSPA 5IWAB 1M57C 3TXQA 4BWAA 3JD2A 4JPRA 5B5EZ 4ZBMA 1PM9A 3SYCA 3WB2A 3GWOA 1E1RG 1CP9A 3L70H 4LFBO 3AG4B 4JI1O 4X66B 1TVKA 4EFBA 2QWQB 4GZRB 2XAHA 1IBKO 3APQA 3W7XA 4K8XA 2FL4A 3K3WA 4I4TB 5KA6A 1Q81W 4QPJA 4WFAV 2X6CA 1DF5A 1N34O 2XOKG 5EBLC 3ZX6A 4DR4B 2X7RB 5KA5A 4LFBB 2FKXA 4U3JB 1NH2D 1AJNA 3LSQA 4KHPO 3CMEV 1NU1H 5IWAO 4I0XA 3I5DA 1SQXH 4MVQA 1RP3B 4J7KA 3UT5A 2HHHO 3OM3B 2UXXA 1P84F 3K06A 1QNMA 3CXCU 2ZNJA 4H0LB 4QJFB 3K04A 1UJWB 4LF6O 3SYPA 5B1BC 5C93A 1OZ0A 1KKDA 1PPJH 1TUBB 2B5UA 3G67A 4UB8Z 3UM7A 4JYCA 1SQGA 3U10A 3U11A 2Y69B 2P06A 3EHBB 1SZXA 2UUBO 2UXBB 2Q4PA 3N2GA 1AP6A 2G38A 2DYRB 5LHGA 1O9HA 3CPWU 3VQWA 2ZE5A 2P90A 3OD4A 1XHZA 3DSQA 2E75B 5KHJA 1IVSA 3ZHSA 2Y4TA 5DN6G 1KUQA 3CMAV 1GMGA 4PI2A 3S3XA 4TSFG 4DUYB 4NKGB 4O2BA 2DYSC 4MVZA 4LF7B 4UVCA 2WLIA 5D5PA 4AHCA 1BGYH 1JPXA 3TCUA 4NXNB 2CH7A 2ADPA 1GN2A 1PNKA 2BTOA 2NNUA 2W6JG 3L73H 4D7TA 1YJNV 4GX1A 4NXMB 4QGPA 4Q6GA 1JOYA 1PNMA 3Q4HB 1FS0G 4GUNA 4YXWG 3ZJZA 4P9OA 2Q7HA 1M93A 5LOVA 3RYIA 4LF5B 1FFXA 1H2LA 1OCCB 4UCVA 3LDDA 4DR5B 2XNDG 1BCCH 1XQ8A 4O4HA 1Q6HA 1SQPH 3JATB 2QM7A 4G2KA 1N4CA 4U3FH 4JI0B 2QJ1A 3UO3A 2JEUA 4TV8B 2QKCA 4JI8B 3QTCA 4X20B 1VQKV 4DV4O 5CB4A 3M8AA 4CC6A 5LMNB 2LP7A 5JJNB 2VQFO 4O4LA 1IBKB 4ICGA 4JI7B 3CHXA 1ORQC 3D8CA 5CA0A 4LF8B 3CJHA 1YF2A 1NVPB 4DV5O 3AG2B 4B3SB 1W2BU 2IU3A 3OTOB 1G4YB 2C2AA 5LGNA 2UXCB 1V55C 4UCTA 5EC1C 2EINC 3QNEA 4J7JA 5KX5A 2YDEA 4X1KB 2W6IG 3OGCC 4YHHB 4EFEA 4LWSA 1XOUA 1WP8A 5KHIA 3STZC 4A5UB 4P2ZA 2KB1A 3KKYA 1VQ9V 5CB4B 4JV5O 3SYOA 3RYCA 3HB3B 5JJEB 1MA1A 2E74B 2DE0X 5CMUA 1VQMV 4TQDA 4JI0O 4QE7A 4P30A 5BMVB 1K73W 1Q82W 2ZQMA 3QVNA 2A06H 1QCEA 2E3CA 2ZM6B 5C8YB 5DECA 4MVOA 2Z3YA 2A7WA 3LSUA 1NI8A 2IU0A 2PY5A 2ZIOA 1X59A 3PN1A 2EIMB 1Q8IA 5TISZ 1K3EA 4RO2A 4JAVA 4MVSA 1H8HG 4JI3B 3A2FA 3OMIB 2ATKC 2V7QG 1KBHA 1DK1A 1SF9A 3E22B 1NJIW 1KU9A 1GM7A 1GAXA 3JYCA 1GN4A 3BFRA 4X9QA 4JYAB 1Y4MA 3ZHTA 2PI4A 2X6BA 2HKOA 2Q73A 3CRMA 4I55A 5GTIZ 2OCCC 1MZEA 1I0HA 2YXYA 5H6RA 3KCYA 2WAMA 4L8JA 1Q6IA 3JALA 3VBBA 2F4VB 3TJTA 1R3LC 3B2EE 4QNHB 4DV1O 3CJHB 3AG3C 3W7UA 3BPZA 2GTSA 4LF9B 3CCVV 4TOIA 4X65O 3RYHB 3N2KA 3RYHA 2DWDC 5L3GA 5JWPA 4LF6B 3B8NA 3T2MA 3A0BZ 1XUQA 3ZCCA 1P7GA 5EZYA 2H8PC 2YS8A 1DLBA 4GCZA 2XUMA 3HKEA 1S0VA 4ZKIA 2GUZB 2Y48A 2P7TC 4GLXA 1J5EO 2P5OA 3RBZA 2Q7EA 2OTLV 2DOSA 4OPAA 1VQ5V 4PA7A 3R66A 4JGSA 3KCXA 1N8RW 4J9ZB 4X1IA 1BSMA 4Z2WA 3GB7C 2F23A 1V55B 1T5EA 3HKDB 4TV8A 3ABLB 4DV1B 1MMMA 4B3SO 2W0XA 1GH6A 3UKMA 4XBFA 1WPXA 4DV2B 1KQSU 4LF8O 2YI8A 1I08A 3IFXA 3JALB 1HP8A 3HPLC 1W59A 1EZJA 3ZRWB 3CCSV 3F5WC 1NR7A 1XEQA 2HP8A 3OEEG 4OPHA 4X8AA 3T1YO 4RQFA 4X1YA 4O2BB 5J2TA 1HNZO 2ZR3A 2JDIG 3CWBH 4FPPA 1AP5A 4K0KO 1PP9H 3H1HH 1XMOO 2LW1A 5KMGB 4I50A 1XDCA 4X64O 3DTUB 1SQQH 1EN5A 4RWUA 4X62O 5A2QN 4GX5A 2QM4A 2GSMB 2ZT9B 3ABMC 4IYHA 5B1AB 4DV0B 4PELA 3ZMVA 2QWOB 1AR5A 3D36C 1K4CC 4XDLA 1AILA 3W7SA 2YEVB 3RVYA 4BR6A 4HBNA 1M56C 1XREA 3D3QA 3CCQV 5IT9N 1BHBA 1TAEA 1JCHA 1FXKA 3B09A 4PI0A 2UU9B 1EN6A 3CCLV 5EBWC 4B3TO 5CN0A 4D7SA 1VQ7V 1FFTB 4JI2O 5IYZA 4GKKB 1SC5B 1Y76B 3B4SA 2AZ0A 4PJ0Z 2CAZC 3SPHA 1V9PA 5HFMA 1YVWA 3ZMZA 4UUJC 1IBMO 1X4TA 3ASNC 1V54C 3F7VC 4DV5B 2JEXA 2YICA 1FPOA 5KAFZ 4DR2O 4F6RB 3T1HO 1GN3A 2JIZG 1VMGA 1I94B 3IC9A 5CA3A 2ZE6A 4EB6A 1ROPA 5B1BB 4R7CA 5BR8B 3C3TA 1KB9F 1WN7A 2QEXV 1AI5A 4CZZA 5EYPA 5L3BA 3ZMSA 5IYZB 3J7AU 1MSWD 2OT5A 2KKWA 4JI6B 3J81N 1N0NA 4DR2B 2IJHA 3JAWA 1IZ3A 1WP7A 2A79B 2EX3A 3SGIA 1M9NA 4H13B 3E35A 4FLVA 4HNAB 1Q90D 1R3IC 1E1QG 3CXHF 3ZRVA 5KAIZ 4LF4O 4L87A 3SPCA 3K59A 1QHTA 4KXRA 2IM9A 1GN6A 3FAVA 4FMTA 3DC5A 2WLLB 2EIKC 3FD9A 2WLLA 3ZHVA 5BXZA 4LP8A 4UCRA 2PGGA 2JGUA 1GTOA 4LFCO 2ZNIA 4DR6O 2W0FC 2YSUB 1K7DA 2DQ3A 4DV6O 1H8EG 2B9ZA 4I5SA 4WCEV 3NXSA 2HVKC 2KQXA 4NB5A 2PI5A 1OV9A 3ABTA 3RFRA 3IAYA 4J41A 1Z5VA 4CS2A 3KZIZ 1N33O 5B1AC 3AG1C 1I5YA 2IJJA 3ZN0A 4CH6A 1NR1A 3MAQA 3O65A 4ZOLA 1Q7YW 1K4DC 3JD4A 1SETA 4GYCB 3K5MA 4E2LA 2QTOA 2XAJA 1SA0A 4UV9A 1B6QA 4LFAO 1OJHA 1HR0O 1H2GA 4J9YB 4ZIBA 4YJ2A 1ZUQA 2ODMA 4LFCB 4DR6B 4HNAA 1S72V 1GRJA 3H01A 4JI4O 1BQZA 3M99B 1H2MA 3DXRB 3OE7G 4LBEC 1R6KA 1TUEB 4O4JB 4K8ZA 3F7YC 3CC4V 1G1XB 1JQ0A 1S5LZ 1JJ2U 1JJOA 1DGSA 3ZBHA 4ZI7A 5LXTA 3KG2A 4CH3A 2L35A 5IDJA 4DR1O 4B3MO 3RVZA 3N2GB 2N05A 2P22C 3JSNA 2OCHA 2YIBD 3JCUZ 1N34B 4JF3A 3D3IA 3TXSA 1QLEC 1M57B 1OCZC 3N27A 2XAGA 2QR4A 3OT7A 3BEHA 5B3SC 4MW3A 1D2DA 1GM8A 1F4MA 5IYCO 2ADQB 3CC7V 3SPJA 1N36O 2EJRA 1KYOF 4JI8O 4QE9A 1D5AA 4LFAB 2WLHA 2IJKA 3QO7A 4PA6A 3CYOA 2P4VA 5B1NA 4FLTA 1LNQA 1E79G 3QF7A 5H2FZ 4DV7B 2UUBB 5JCOA 1M90W 3RYIB 5FPOA 4UCUA 1KECA 1XILA 4JASA 1R3JC 3G6BA 3HKBB 3OTOO 3WG7C 4H33A 3ZEDA 4B3MB 2AGAA 4J11A 2HJDA 1N32O 4LF9O 2Q0AA 3H1KH 3ABKB 1OHHG 3K0DA 2WLMA 3CX5F 5JJJB 4MVMA 4MW8A 2JRIA 3ML0A 2YEVA 2QSAA 5LXTB 4B3RB 4TQFA 2P6JA 4DV6B 2EIKB 2OTJV 2K9PA 4B3TB 4B7EA 1FXHA 1OCRC 1NBMG 3FAVB 1R73A 3JARB 5B66Z 4JI2B 1H2SB 2RJZA 1D5NA 3GVMA 3IC7A 3X2QC 4FM2A 2Q6AA 3SYAA 2YIAA 2OIEA 2BOCC 1ZL8A 3H1JH 4MTXA 4HYOA 4QPKA 4DV2O 4JI3O 1P49A 4I7ZB 4ZHQA 5IJ0B 3QG5A 4CH4A 2LQTA 4YIOA 2ZXWB 1CXZB 3FB5C 3C3SA 1SERA 3JD0A 3C90A 4UVBA 1YHQV 3RT3C 3T1HB 2JVDA 1K97A 4WF9V 3I55V 3BVOA 3O9OA 4DRXA 1K5SA 3LUTB 3E22A 4YY3O 2P67A 2HJFC 1YJ9V 4DUZO 1FJGO 1VQLV 4WFFA 4O4IB 1NTKH 3CCMV 5L3DA 1Y74B 4IYIA 1U97A 3SJBC 1I94O 3E8BA 4F6RA 3OR6C 2UUCB 1VF6A 5GONB 1AR1B 3BY6A 4Q20A 2WPDG 5GONA 5A9GA 3THOA 4P9PA 2H3OA 4DR3B 4PD4F 3VQVA 1AROP 2YIDA 4CBCA 2B1GA 2BCCH 4DR1B 4PA3A 1YCIA 2XHBA 1BQ0A 4J10A 4EKWA 3JAKB 2JJ2G 1QLNA 3AG4C 5IY5C 3K79A 3JAWB 1QVGU 4HAMA 3K5OA 2RMKB 1RFYA 1ENVA 3L74H 5AG2A 4PDLA 5IE9A 1ZX3A 1QQCA 3LDCA 2WLJA 3QO8A 2R72A 5IJ9A 4FM1A 3FB7C 3H1IH 2IH1C 3RGBA 1UFIA 2IW5A 3R65A 5FNVA 1M1KW 1SA0B 3J80N 1P7BA 2JS3A 1N36B 4PA4A 2UUCO 2D2CB 3MHHC 5EIBC 1YI2V 1M5IA 1KP3A 4R50A 2Q9LA 1TUBA 4LNUB 2EINB 2X6AA 2WA4A 4BW5A 3D36A 4W4LA 2ZIMA 2BSKA 3BABA 4LR3A 4J42A 1VARA 3T4ZA 4JI6O 3LSSA 1KD1W 1YTFB 4DV3O 2BTQB 4RAIA 2K1EA 2CTPA 3WB0A 2HG5C 4IL6Z 2HFEC 1ZTEA 1O9GA 2QGNA 3L72H 4NTXA 1J95A 5LP6C 3A0HZ 4CS3A 2RQ6A 1XBLA 4NVPA 1Y67A 1QVFU 1S5HC 1IXMA 2CH7B 2CTWA 1HNXO 1BE3H 4WFEA 4ASUG 1OCOC 3RWRD 3N2KB 2LFRA 4IIJB 2ZR2A 5KLVH 3W7TA 2Z5UA 2KSDA 4LWSB 3OTFA 2QM8A 2R9IA 3AEIA 1XHXA 3FYIB 1BS3A 4RUFA 4OGQB 2BSKB 4I9WA 1RSOA 2EZPA 3WFVA 4WFBV 3CS5A 3RN4A 2EZOA 1MOFA 2UXDB 5LBQA 2EIJB 5LYJB 4XDKA 1VEWA 4JV5B 1IURA 5H9CA 2EBOA 3P3PA 4O4HB 2VS0A 4KL1A 4KHPB 2UU9O 3HKCB 3CCRV 3P32A 4DV3B 3SR2C 1Q86W 3QO5A 1GKFA 1ZAUA 1K5QA 2LO1A 3CRAA 1NQTA 5KX5B 3CRCA 1AI7A 1IBMB 2E76B 3STLC 2UXDO 1SZTA 5HFLA 2CTQA 1IDSA 1G6UA 2PYLA 1YEWA 1XI1A 4FLZA 3AK1A 2XT9A 3K58A 4GX2A 2LGQA 5GTHZ 4NTYA 3CRRA 2YIBA 5KHKA 5L3EA 1EN4A 2OIGA 1MZFA 3CSXA 1S76D 1AVMA 3ETEA 4MS2A 3UT5B 4JYYA 1BT8A 2EULA 1K33A 2QKSA 1QR9A 5K1PA 3RW0A 4TT3G 1PNLA 2DN9A 2ILMA 3T1CA 1FAFA 2AHYA 4YHHO 2RDCA 1AI6A 3CEIA 4X64B 5CBGA 4WFHA 1IXBA 3VQXA 1XNRB 2DW4A 5FNVB 1L0NH 1Z5WA 2UXCO 4LH7A 1VIBA 5CA1A 1BMFG 4OXSA 1GM9A 4JI5B 4QIWF 1AI4A 4UB6Z 4DR3O 4DV7O 1NTZH 4NTWA 1MG1A 1F51A 1AJQA 4XDJA 3WB1A 1RM1B 1BL8A 3JAKA 4MT8A 3SJQC 1LR1A 2EILB 4X89A 5EBMC 4JTAB 5IJ0A 3CC2V 1ZLZA 4JZ2A 1OCOB 5J2UA 3FYEB 4FFBA 4LNUA 1DF4A 3TK1A 2Q0OC 4I4TA 2FYUH 5C8YA 4K35A 5LMNO 2ZD9A 4I0XB 1TVKB 1MNGA 1PKXA 5LP6A 4DV4B 4IHJA 1QU7A 3E8HA 2EIJC 3W7WA 1THZA 3H9VA 1XMOB 4TV9A 5J2UB 3U0ZA 2M7WA 2Q7GA 3EFFK 1S77D 3OFNG 3UQ8A 4LH6A 1YZBA 2GDSA 3P30A 2Y4UA 4MTFA 1HNWO 4UCSA 1KKCA 4WFGA 1JX9A 1AJPA 2DMXA 5LHIA 3BCCH 5KUKA 3K9AA 3ASOB 3JARA 2QKAA 3ZHQA 3OUFA 2GUZA 4FIPC 2Q68A 1IBLB 1MSDA 2FTKA 4PDVA 1FJGB 4YJ3B 1RSOB
chains in the Genus database with same CATH topology
4I0XB 4LWSA 3Q4HB 3ZBHA 3Q4HA 3FAVA 2KG7B 3OGIB 3FD9A 2KG7A 3FAVB 2VRZA 3GWKC 4GZRB 1WA8B 3GVMA 2DE0X 3TXQA 1WA8A 4ABMA 3G80A 3O9OA 3TXSA 2B9ZA 2AZ2A 2AZ0A 4I0XA 4LWSB 2VS0A 3HR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I0X B;  4LWS A;  3Q4H B;  3ZBH A;  3Q4H A;  3FAV A;  2KG7 B;  3OGI B;  3FD9 A;  2KG7 A;  3FAV B;  2VRZ A;  3GWK C;  4GZR B;  1WA8 B;  3GVM A;  2DE0 X;  3TXQ A;  1WA8 A;  4ABM A;  3G80 A;  3O9O A;  3TXS A;  2B9Z A;  2AZ2 A;  2AZ0 A;  4I0X A;  4LWS B;  2VS0 A;  3HR0 A; 
#chains in the Genus database with same CATH topology
 1LUV A;  1YTF D;  4R6Z A;  3PJS K;  5J2T B;  3ZS8 C;  4NXN O;  4EB6 B;  3X2Q B;  5LA6 A;  2WLI B;  1FFX B;  4OX9 B;  3CCE V;  2N04 A;  3FX7 A;  4RUE A;  3MDS A;  5H6Q A;  4JAA A;  3ETG A;  3VQY A;  4AI8 A;  4FZ0 A;  4X1K A;  2A3Q A;  4X66 O;  5JH7 A;  1WLE A;  2ZKO A;  5JH7 B;  4NR1 A;  3G6E V;  3RYF A;  4FLY A;  3ABL C;  4DW0 A;  5DED A;  2WLK A;  2WLN A;  4X88 A;  3K08 A;  4GKJ B;  3F5T A;  4DR7 O;  1LUW A;  2ZIN A;  2EIM C;  1Q6U A;  3ZHU A;  5BY1 A;  1I5X A;  1G8M A;  1WAZ A;  4JYA O;  3T4D A;  1XNQ B;  4JI5 O;  3L71 H;  3CRQ A;  4RQE A;  4KUM A;  2XAF A;  3JD1 A;  3DC6 A;  1KMI Z;  3RYF B;  2HR3 A;  1IBL O;  3VOU A;  4BAY A;  1Q43 A;  5FL7 G;  1XNR O;  1CEZ A;  2F95 B;  4H37 A;  2JJ1 G;  5LMU B;  4NYK A;  4PDM A;  4DYL A;  2XAQ A;  3SJA C;  5LA6 B;  4DR7 B;  1FXV A;  2ARH A;  5CA1 B;  4K0K B;  5J9P C;  1KC8 W;  4TV9 B;  2D3O W;  3AG3 B;  5LL6 Y;  2IBZ H;  2RCV A;  3NR7 A;  1FYJ A;  1SQF A;  4FM0 A;  3JD3 A;  1WPB A;  4CC5 A;  3BAA A;  1NTM H;  3AG1 B;  4D6T H;  1U96 A;  1Z2G A;  2CDY A;  1H2N A;  5ITZ A;  1US6 A;  1JFF A;  2F93 B;  3ETD A;  5EYP B;  5LOV B;  2Q8V A;  5FLX N;  2FML A;  5KHG A;  1XMQ B;  1FD9 A;  3K9S A;  3E8G A;  4JYB A;  3CD6 V;  3ICX A;  3SPI A;  1VQP V;  4EEQ A;  2YXH A;  2CTR A;  4IHJ B;  5CBF A;  1V54 B;  1HW7 A;  1DTO A;  2UXN A;  4MVR A;  3CP1 A;  4B7K A;  1S3J A;  2PTM A;  2OWO A;  4TUY B;  3OUS A;  3CCU V;  3OW2 U;  4LF5 O;  4KP4 A;  4I9Q A;  3CB2 A;  3WU2 Z;  2IH3 C;  4JAU A;  1JVM A;  2WWW A;  1NS1 A;  2V1D A;  4CS4 A;  3A0R A;  1VF5 B;  4TWK A;  1ZL8 B;  4DK0 A;  1K9M W;  1H38 A;  4FVM A;  1VP7 A;  3EXA A;  3AK2 A;  5CA0 B;  1QLE B;  1A32 A;  5D5Q A;  4PDR A;  1B06 A;  3DGE A;  4DR5 O;  2GBO A;  3CE2 A;  5EK0 A;  3UCS C;  5B3S B;  4DK1 A;  3ZHR A;  4FLW A;  1XL4 A;  4PV1 B;  1QR8 A;  2XTA A;  4O4J A;  4IT5 A;  4R8C A;  1SES A;  4WBN A;  3G80 A;  3BHP A;  2MW2 B;  1EBO A;  1TA8 A;  3B8M A;  3ZRX A;  2ZE7 A;  4YIP A;  4YJ2 B;  5E79 Z;  1R6N A;  3ZN1 A;  3AG7 A;  1JR9 A;  2VQE O;  1AR4 A;  2VWJ A;  2RNB A;  5CBH A;  4UVA A;  4LF7 O;  4W4K A;  3OMN B;  1YSC A;  5BZB A;  4X65 B;  2ZDI C;  2A0L A;  1JMK C;  5KMG A;  2AHZ A;  3SJC C;  5JQG A;  3ABK C;  2FB5 A;  4J7Z A;  4LF4 B;  2OYQ A;  1M56 B;  3OR7 C;  1FXK C;  4U3J A;  1Q5O A;  1Y74 A;  3GWK C;  3K03 A;  4GKK O;  1BHA A;  1Q3E A;  3RYC B;  1OCR B;  3I56 V;  2LFS A;  3MHS C;  5JCO C;  1EZV H;  3HR0 A;  1VQN V;  5GW7 A;  1JFF B;  1QBZ A;  4F4L A;  1J5E B;  1SQV H;  2KG7 A;  4BW9 A;  2VWK A;  2GTA A;  2MK3 A;  3UO2 A;  2EJ7 A;  3G71 V;  2Y69 C;  3ASN B;  2LJ2 A;  4KFM A;  5BMV A;  4UXN A;  4ABM A;  2PUS A;  4IGG A;  4AQY B;  1NZ6 A;  1R3K C;  2F1M A;  2CUG A;  2DYR C;  2QWR B;  2YI9 A;  3TGU H;  2XAS A;  5B1O A;  2HEP A;  2ZCE A;  4B08 A;  2X0L A;  3EVK A;  5F2V O;  3P3N A;  4H44 B;  1GO3 F;  5K1X A;  3A8T A;  4X62 B;  3IJ4 A;  1W0J G;  2GHY A;  1BZK A;  4BIO A;  1YIJ V;  3LNN A;  4U7N A;  1RPO A;  3BA9 A;  3E89 A;  1SRY A;  1WB7 A;  1F23 A;  1NH2 B;  3JAT A;  2LGW A;  4LC1 A;  1XNQ O;  4ZI7 B;  1PV0 A;  1K92 A;  2H94 A;  3B40 A;  4FJC C;  3TET A;  3OMA B;  4IIJ A;  2AXT Z;  4GKJ O;  1IX9 A;  2YC0 A;  1OCC C;  1VF6 C;  2Q69 A;  4AIL C;  4DXW A;  2UXB O;  1K8A W;  1PD3 A;  2JS5 A;  5JQG B;  3OGI B;  4G27 B;  5KHH A;  1F7Y A;  1I7F A;  2A9H A;  2QE7 G;  3HKB A;  1EFR G;  4JTC B;  4DUZ B;  1RM1 C;  1KP2 A;  2NN4 A;  4ZOL B;  3AK3 A;  4WBN B;  3JAM N;  1NKD A;  1VF7 A;  2QDO A;  1URF A;  4N23 A;  4PA9 A;  4F6E A;  4GT1 A;  2F43 G;  2F66 C;  4Z1V A;  3ABM B;  2E5L B;  2ZE8 A;  1M4U A;  2CGN A;  3FB6 C;  2CK3 G;  3WG7 B;  2HHH B;  1N0J A;  3AG2 C;  2QWN B;  2PF4 E;  4K3A A;  5IJ9 B;  1HWY A;  1UPG A;  2YXL A;  1HNZ B;  2LW7 A;  5BR8 O;  5LMU O;  3MD0 A;  2QA4 V;  2Y0I A;  4GX0 A;  1ZWI C;  4Z1M G;  4X1I B;  1FKA O;  2BOB C;  1R6T A;  2NR5 A;  5L3C A;  4HZ3 A;  1JA8 A;  5EC2 C;  1FXK B;  2P4K A;  1W0K G;  1YIT V;  4FFK A;  2ITC C;  3IGA C;  4O2A A;  4JZG A;  1YJW V;  4O2A B;  2ZDI A;  3E8F A;  2F4V O;  4TUY A;  2N74 A;  3ETQ A;  2R9A A;  2HLD G;  2R9R B;  2AZ2 A;  3E83 A;  4O4L B;  3ZRS A;  2JK5 C;  3ASO C;  3M7M X;  4FK5 C;  1VQ6 V;  2ITD C;  3L9D A;  3JCZ A;  4BIU A;  5FPR A;  3DXR A;  2VQF B;  5KUM A;  4J80 A;  1WA8 B;  3OEH G;  4AQY O;  3SYQ A;  3ABU A;  3SDL A;  5DM6 V;  1RPR A;  4FFB B;  1SQB H;  2IJI A;  4YY3 B;  3ZMU A;  1NVP D;  3LDE A;  4MTG A;  3OAA G;  1Y76 A;  3FKS G;  1OCZ B;  5EZY B;  4UV8 A;  2CE4 A;  3FB8 C;  2QTS A;  4DV0 O;  3E86 A;  1NT2 B;  2QWP B;  4FZ1 A;  4X1Y B;  5LHH A;  2AW9 A;  2VRZ A;  2PYJ A;  1HDJ A;  1EM1 A;  4U7O A;  1N33 B;  2ZM6 O;  5LGU A;  2R70 A;  4YJ3 A;  2OCC B;  4BIZ A;  3BRC A;  5IYD O;  5EIB D;  1SKV A;  1N32 B;  1AB3 A;  1HNX B;  3HKD A;  4ZHQ B;  3K0G A;  2KG7 B;  1VQO V;  5JVD A;  4UFZ A;  2Q67 A;  5H5N A;  2WSS G;  4MTO A;  1R1B A;  2PZS A;  1XL6 A;  1WB8 A;  5L3F A;  1HNW B;  3T1Y B;  3ZRW A;  4LCU C;  2Z0A A;  4JI4 B;  4B3R O;  5E1A C;  3SPG A;  5IY5 B;  3JAS B;  2DWE C;  2VQE B;  1P4R A;  5ITZ B;  2UUA O;  4DO2 A;  4UCO A;  1TGO A;  4MVU A;  5LGT A;  2JGD A;  2V4D A;  3L75 H;  2M6Y A;  2JGD B;  2RN9 A;  3ZIA G;  1B3Q A;  5LYJ A;  1XMQ O;  2WA3 A;  2DJV A;  4JI7 O;  1HR0 B;  1PL0 A;  2Y0P A;  3JSL A;  4FLX A;  4DW1 A;  4E4E A;  3LNM B;  4I50 B;  1B04 A;  2B1I A;  4OX9 O;  2YUA A;  5JVD B;  2L6L A;  3Q4H A;  3HKE B;  1L8D A;  2ZXW C;  1MAB G;  3E2E A;  4DUY O;  4JI1 B;  1PL4 A;  4N21 A;  4O4I A;  3CCJ V;  2BE3 A;  1WA8 A;  4G28 B;  2UUA B;  3FFQ A;  1Y66 A;  3JAS A;  2NLJ C;  2GV9 A;  3G4S V;  2E5L O;  1WJZ A;  3S3W A;  4JTD B;  3K5L A;  5IYB O;  4I55 B;  3APO A;  1K34 A;  3HKC A;  2DYS B;  1S5J A;  1YDX A;  1GK9 A;  1VQ8 V;  2HVJ C;  1SS3 A;  4MSW C;  1F4N A;  2Q5Z A;  4X20 A;  4NXM O;  3H1L H;  4FLU A;  3B77 A;  2CGO A;  1L1F A;  3K5N A;  3K57 A;  1H2K A;  1L0L H;  4DR4 O;  4DRX B;  5LP6 B;  1VQ4 V;  4PHZ A;  1COW G;  2O57 A;  2DQ0 A;  4C7U A;  1CPY A;  1Y6X A;  3BA8 A;  4CH5 A;  2ETN A;  3ZMT A;  1YXB A;  1WNS A;  2EIL C;  2BTQ A;  1ZSP A;  5IWA B;  1M57 C;  3TXQ A;  4BWA A;  3JD2 A;  4JPR A;  5B5E Z;  4ZBM A;  1PM9 A;  3SYC A;  3WB2 A;  3GWO A;  1E1R G;  1CP9 A;  3L70 H;  4LFB O;  3AG4 B;  4JI1 O;  4X66 B;  1TVK A;  4EFB A;  2QWQ B;  4GZR B;  2XAH A;  1IBK O;  3APQ A;  3W7X A;  4K8X A;  2FL4 A;  3K3W A;  4I4T B;  5KA6 A;  1Q81 W;  4QPJ A;  4WFA V;  2X6C A;  1DF5 A;  1N34 O;  2XOK G;  5EBL C;  3ZX6 A;  4DR4 B;  2X7R B;  5KA5 A;  4LFB B;  2FKX A;  4U3J B;  1NH2 D;  1AJN A;  3LSQ A;  4KHP O;  3CME V;  1NU1 H;  5IWA O;  4I0X A;  3I5D A;  1SQX H;  4MVQ A;  1RP3 B;  4J7K A;  3UT5 A;  2HHH O;  3OM3 B;  2UXX A;  1P84 F;  3K06 A;  1QNM A;  3CXC U;  2ZNJ A;  4H0L B;  4QJF B;  3K04 A;  1UJW B;  4LF6 O;  3SYP A;  5B1B C;  5C93 A;  1OZ0 A;  1KKD A;  1PPJ H;  1TUB B;  2B5U A;  3G67 A;  4UB8 Z;  3UM7 A;  4JYC A;  1SQG A;  3U10 A;  3U11 A;  2Y69 B;  2P06 A;  3EHB B;  1SZX A;  2UUB O;  2UXB B;  2Q4P A;  3N2G A;  1AP6 A;  2G38 A;  2DYR B;  5LHG A;  1O9H A;  3CPW U;  3VQW A;  2ZE5 A;  2P90 A;  3OD4 A;  1XHZ A;  3DSQ A;  2E75 B;  5KHJ A;  1IVS A;  3ZHS A;  2Y4T A;  5DN6 G;  1KUQ A;  3CMA V;  1GMG A;  4PI2 A;  3S3X A;  4TSF G;  4DUY B;  4NKG B;  4O2B A;  2DYS C;  4MVZ A;  4LF7 B;  4UVC A;  2WLI A;  5D5P A;  4AHC A;  1BGY H;  1JPX A;  3TCU A;  4NXN B;  2CH7 A;  2ADP A;  1GN2 A;  1PNK A;  2BTO A;  2NNU A;  2W6J G;  3L73 H;  4D7T A;  1YJN V;  4GX1 A;  4NXM B;  4QGP A;  4Q6G A;  1JOY A;  1PNM A;  3Q4H B;  1FS0 G;  4GUN A;  4YXW G;  3ZJZ A;  4P9O A;  2Q7H A;  1M93 A;  5LOV A;  3RYI A;  4LF5 B;  1FFX A;  1H2L A;  1OCC B;  4UCV A;  3LDD A;  4DR5 B;  2XND G;  1BCC H;  1XQ8 A;  4O4H A;  1Q6H A;  1SQP H;  3JAT B;  2QM7 A;  4G2K A;  1N4C A;  4U3F H;  4JI0 B;  2QJ1 A;  3UO3 A;  2JEU A;  4TV8 B;  2QKC A;  4JI8 B;  3QTC A;  4X20 B;  1VQK V;  4DV4 O;  5CB4 A;  3M8A A;  4CC6 A;  5LMN B;  2LP7 A;  5JJN B;  2VQF O;  4O4L A;  1IBK B;  4ICG A;  4JI7 B;  3CHX A;  1ORQ C;  3D8C A;  5CA0 A;  4LF8 B;  3CJH A;  1YF2 A;  1NVP B;  4DV5 O;  3AG2 B;  4B3S B;  1W2B U;  2IU3 A;  3OTO B;  1G4Y B;  2C2A A;  5LGN A;  2UXC B;  1V55 C;  4UCT A;  5EC1 C;  2EIN C;  3QNE A;  4J7J A;  5KX5 A;  2YDE A;  4X1K B;  2W6I G;  3OGC C;  4YHH B;  4EFE A;  4LWS A;  1XOU A;  1WP8 A;  5KHI A;  3STZ C;  4A5U B;  4P2Z A;  2KB1 A;  3KKY A;  1VQ9 V;  5CB4 B;  4JV5 O;  3SYO A;  3RYC A;  3HB3 B;  5JJE B;  1MA1 A;  2E74 B;  2DE0 X;  5CMU A;  1VQM V;  4TQD A;  4JI0 O;  4QE7 A;  4P30 A;  5BMV B;  1K73 W;  1Q82 W;  2ZQM A;  3QVN A;  2A06 H;  1QCE A;  2E3C A;  2ZM6 B;  5C8Y B;  5DEC A;  4MVO A;  2Z3Y A;  2A7W A;  3LSU A;  1NI8 A;  2IU0 A;  2PY5 A;  2ZIO A;  1X59 A;  3PN1 A;  2EIM B;  1Q8I A;  5TIS Z;  1K3E A;  4RO2 A;  4JAV A;  4MVS A;  1H8H G;  4JI3 B;  3A2F A;  3OMI B;  2ATK C;  2V7Q G;  1KBH A;  1DK1 A;  1SF9 A;  3E22 B;  1NJI W;  1KU9 A;  1GM7 A;  1GAX A;  3JYC A;  1GN4 A;  3BFR A;  4X9Q A;  4JYA B;  1Y4M A;  3ZHT A;  2PI4 A;  2X6B A;  2HKO A;  2Q73 A;  3CRM A;  4I55 A;  5GTI Z;  2OCC C;  1MZE A;  1I0H A;  2YXY A;  5H6R A;  3KCY A;  2WAM A;  4L8J A;  1Q6I A;  3JAL A;  3VBB A;  2F4V B;  3TJT A;  1R3L C;  3B2E E;  4QNH B;  4DV1 O;  3CJH B;  3AG3 C;  3W7U A;  3BPZ A;  2GTS A;  4LF9 B;  3CCV V;  4TOI A;  4X65 O;  3RYH B;  3N2K A;  3RYH A;  2DWD C;  5L3G A;  5JWP A;  4LF6 B;  3B8N A;  3T2M A;  3A0B Z;  1XUQ A;  3ZCC A;  1P7G A;  5EZY A;  2H8P C;  2YS8 A;  1DLB A;  4GCZ A;  2XUM A;  3HKE A;  1S0V A;  4ZKI A;  2GUZ B;  2Y48 A;  2P7T C;  4GLX A;  1J5E O;  2P5O A;  3RBZ A;  2Q7E A;  2OTL V;  2DOS A;  4OPA A;  1VQ5 V;  4PA7 A;  3R66 A;  4JGS A;  3KCX A;  1N8R W;  4J9Z B;  4X1I A;  1BSM A;  4Z2W A;  3GB7 C;  2F23 A;  1V55 B;  1T5E A;  3HKD B;  4TV8 A;  3ABL B;  4DV1 B;  1MMM A;  4B3S O;  2W0X A;  1GH6 A;  3UKM A;  4XBF A;  1WPX A;  4DV2 B;  1KQS U;  4LF8 O;  2YI8 A;  1I08 A;  3IFX A;  3JAL B;  1HP8 A;  3HPL C;  1W59 A;  1EZJ A;  3ZRW B;  3CCS V;  3F5W C;  1NR7 A;  1XEQ A;  2HP8 A;  3OEE G;  4OPH A;  4X8A A;  3T1Y O;  4RQF A;  4X1Y A;  4O2B B;  5J2T A;  1HNZ O;  2ZR3 A;  2JDI G;  3CWB H;  4FPP A;  1AP5 A;  4K0K O;  1PP9 H;  3H1H H;  1XMO O;  2LW1 A;  5KMG B;  4I50 A;  1XDC A;  4X64 O;  3DTU B;  1SQQ H;  1EN5 A;  4RWU A;  4X62 O;  5A2Q N;  4GX5 A;  2QM4 A;  2GSM B;  2ZT9 B;  3ABM C;  4IYH A;  5B1A B;  4DV0 B;  4PEL A;  3ZMV A;  2QWO B;  1AR5 A;  3D36 C;  1K4C C;  4XDL A;  1AIL A;  3W7S A;  2YEV B;  3RVY A;  4BR6 A;  4HBN A;  1M56 C;  1XRE A;  3D3Q A;  3CCQ V;  5IT9 N;  1BHB A;  1TAE A;  1JCH A;  1FXK A;  3B09 A;  4PI0 A;  2UU9 B;  1EN6 A;  3CCL V;  5EBW C;  4B3T O;  5CN0 A;  4D7S A;  1VQ7 V;  1FFT B;  4JI2 O;  5IYZ A;  4GKK B;  1SC5 B;  1Y76 B;  3B4S A;  2AZ0 A;  4PJ0 Z;  2CAZ C;  3SPH A;  1V9P A;  5HFM A;  1YVW A;  3ZMZ A;  4UUJ C;  1IBM O;  1X4T A;  3ASN C;  1V54 C;  3F7V C;  4DV5 B;  2JEX A;  2YIC A;  1FPO A;  5KAF Z;  4DR2 O;  4F6R B;  3T1H O;  1GN3 A;  2JIZ G;  1VMG A;  1I94 B;  3IC9 A;  5CA3 A;  2ZE6 A;  4EB6 A;  1ROP A;  5B1B B;  4R7C A;  5BR8 B;  3C3T A;  1KB9 F;  1WN7 A;  2QEX V;  1AI5 A;  4CZZ A;  5EYP A;  5L3B A;  3ZMS A;  5IYZ B;  3J7A U;  1MSW D;  2OT5 A;  2KKW A;  4JI6 B;  3J81 N;  1N0N A;  4DR2 B;  2IJH A;  3JAW A;  1IZ3 A;  1WP7 A;  2A79 B;  2EX3 A;  3SGI A;  1M9N A;  4H13 B;  3E35 A;  4FLV A;  4HNA B;  1Q90 D;  1R3I C;  1E1Q G;  3CXH F;  3ZRV A;  5KAI Z;  4LF4 O;  4L87 A;  3SPC A;  3K59 A;  1QHT A;  4KXR A;  2IM9 A;  1GN6 A;  3FAV A;  4FMT A;  3DC5 A;  2WLL B;  2EIK C;  3FD9 A;  2WLL A;  3ZHV A;  5BXZ A;  4LP8 A;  4UCR A;  2PGG A;  2JGU A;  1GTO A;  4LFC O;  2ZNI A;  4DR6 O;  2W0F C;  2YSU B;  1K7D A;  2DQ3 A;  4DV6 O;  1H8E G;  2B9Z A;  4I5S A;  4WCE V;  3NXS A;  2HVK C;  2KQX A;  4NB5 A;  2PI5 A;  1OV9 A;  3ABT A;  3RFR A;  3IAY A;  4J41 A;  1Z5V A;  4CS2 A;  3KZI Z;  1N33 O;  5B1A C;  3AG1 C;  1I5Y A;  2IJJ A;  3ZN0 A;  4CH6 A;  1NR1 A;  3MAQ A;  3O65 A;  4ZOL A;  1Q7Y W;  1K4D C;  3JD4 A;  1SET A;  4GYC B;  3K5M A;  4E2L A;  2QTO A;  2XAJ A;  1SA0 A;  4UV9 A;  1B6Q A;  4LFA O;  1OJH A;  1HR0 O;  1H2G A;  4J9Y B;  4ZIB A;  4YJ2 A;  1ZUQ A;  2ODM A;  4LFC B;  4DR6 B;  4HNA A;  1S72 V;  1GRJ A;  3H01 A;  4JI4 O;  1BQZ A;  3M99 B;  1H2M A;  3DXR B;  3OE7 G;  4LBE C;  1R6K A;  1TUE B;  4O4J B;  4K8Z A;  3F7Y C;  3CC4 V;  1G1X B;  1JQ0 A;  1S5L Z;  1JJ2 U;  1JJO A;  1DGS A;  3ZBH A;  4ZI7 A;  5LXT A;  3KG2 A;  4CH3 A;  2L35 A;  5IDJ A;  4DR1 O;  4B3M O;  3RVZ A;  3N2G B;  2N05 A;  2P22 C;  3JSN A;  2OCH A;  2YIB D;  3JCU Z;  1N34 B;  4JF3 A;  3D3I A;  3TXS A;  1QLE C;  1M57 B;  1OCZ C;  3N27 A;  2XAG A;  2QR4 A;  3OT7 A;  3BEH A;  5B3S C;  4MW3 A;  1D2D A;  1GM8 A;  1F4M A;  5IYC O;  2ADQ B;  3CC7 V;  3SPJ A;  1N36 O;  2EJR A;  1KYO F;  4JI8 O;  4QE9 A;  1D5A A;  4LFA B;  2WLH A;  2IJK A;  3QO7 A;  4PA6 A;  3CYO A;  2P4V A;  5B1N A;  4FLT A;  1LNQ A;  1E79 G;  3QF7 A;  5H2F Z;  4DV7 B;  2UUB B;  5JCO A;  1M90 W;  3RYI B;  5FPO A;  4UCU A;  1KEC A;  1XIL A;  4JAS A;  1R3J C;  3G6B A;  3HKB B;  3OTO O;  3WG7 C;  4H33 A;  3ZED A;  4B3M B;  2AGA A;  4J11 A;  2HJD A;  1N32 O;  4LF9 O;  2Q0A A;  3H1K H;  3ABK B;  1OHH G;  3K0D A;  2WLM A;  3CX5 F;  5JJJ B;  4MVM A;  4MW8 A;  2JRI A;  3ML0 A;  2YEV A;  2QSA A;  5LXT B;  4B3R B;  4TQF A;  2P6J A;  4DV6 B;  2EIK B;  2OTJ V;  2K9P A;  4B3T B;  4B7E A;  1FXH A;  1OCR C;  1NBM G;  3FAV B;  1R73 A;  3JAR B;  5B66 Z;  4JI2 B;  1H2S B;  2RJZ A;  1D5N A;  3GVM A;  3IC7 A;  3X2Q C;  4FM2 A;  2Q6A A;  3SYA A;  2YIA A;  2OIE A;  2BOC C;  1ZL8 A;  3H1J H;  4MTX A;  4HYO A;  4QPK A;  4DV2 O;  4JI3 O;  1P49 A;  4I7Z B;  4ZHQ A;  5IJ0 B;  3QG5 A;  4CH4 A;  2LQT A;  4YIO A;  2ZXW B;  1CXZ B;  3FB5 C;  3C3S A;  1SER A;  3JD0 A;  3C90 A;  4UVB A;  1YHQ V;  3RT3 C;  3T1H B;  2JVD A;  1K97 A;  4WF9 V;  3I55 V;  3BVO A;  3O9O A;  4DRX A;  1K5S A;  3LUT B;  3E22 A;  4YY3 O;  2P67 A;  2HJF C;  1YJ9 V;  4DUZ O;  1FJG O;  1VQL V;  4WFF A;  4O4I B;  1NTK H;  3CCM V;  5L3D A;  1Y74 B;  4IYI A;  1U97 A;  3SJB C;  1I94 O;  3E8B A;  4F6R A;  3OR6 C;  2UUC B;  1VF6 A;  5GON B;  1AR1 B;  3BY6 A;  4Q20 A;  2WPD G;  5GON A;  5A9G A;  3THO A;  4P9P A;  2H3O A;  4DR3 B;  4PD4 F;  3VQV A;  1ARO P;  2YID A;  4CBC A;  2B1G A;  2BCC H;  4DR1 B;  4PA3 A;  1YCI A;  2XHB A;  1BQ0 A;  4J10 A;  4EKW A;  3JAK B;  2JJ2 G;  1QLN A;  3AG4 C;  5IY5 C;  3K79 A;  3JAW B;  1QVG U;  4HAM A;  3K5O A;  2RMK B;  1RFY A;  1ENV A;  3L74 H;  5AG2 A;  4PDL A;  5IE9 A;  1ZX3 A;  1QQC A;  3LDC A;  2WLJ A;  3QO8 A;  2R72 A;  5IJ9 A;  4FM1 A;  3FB7 C;  3H1I H;  2IH1 C;  3RGB A;  1UFI A;  2IW5 A;  3R65 A;  5FNV A;  1M1K W;  1SA0 B;  3J80 N;  1P7B A;  2JS3 A;  1N36 B;  4PA4 A;  2UUC O;  2D2C B;  3MHH C;  5EIB C;  1YI2 V;  1M5I A;  1KP3 A;  4R50 A;  2Q9L A;  1TUB A;  4LNU B;  2EIN B;  2X6A A;  2WA4 A;  4BW5 A;  3D36 A;  4W4L A;  2ZIM A;  2BSK A;  3BAB A;  4LR3 A;  4J42 A;  1VAR A;  3T4Z A;  4JI6 O;  3LSS A;  1KD1 W;  1YTF B;  4DV3 O;  2BTQ B;  4RAI A;  2K1E A;  2CTP A;  3WB0 A;  2HG5 C;  4IL6 Z;  2HFE C;  1ZTE A;  1O9G A;  2QGN A;  3L72 H;  4NTX A;  1J95 A;  5LP6 C;  3A0H Z;  4CS3 A;  2RQ6 A;  1XBL A;  4NVP A;  1Y67 A;  1QVF U;  1S5H C;  1IXM A;  2CH7 B;  2CTW A;  1HNX O;  1BE3 H;  4WFE A;  4ASU G;  1OCO C;  3RWR D;  3N2K B;  2LFR A;  4IIJ B;  2ZR2 A;  5KLV H;  3W7T A;  2Z5U A;  2KSD A;  4LWS B;  3OTF A;  2QM8 A;  2R9I A;  3AEI A;  1XHX A;  3FYI B;  1BS3 A;  4RUF A;  4OGQ B;  2BSK B;  4I9W A;  1RSO A;  2EZP A;  3WFV A;  4WFB V;  3CS5 A;  3RN4 A;  2EZO A;  1MOF A;  2UXD B;  5LBQ A;  2EIJ B;  5LYJ B;  4XDK A;  1VEW A;  4JV5 B;  1IUR A;  5H9C A;  2EBO A;  3P3P A;  4O4H B;  2VS0 A;  4KL1 A;  4KHP B;  2UU9 O;  3HKC B;  3CCR V;  3P32 A;  4DV3 B;  3SR2 C;  1Q86 W;  3QO5 A;  1GKF A;  1ZAU A;  1K5Q A;  2LO1 A;  3CRA A;  1NQT A;  5KX5 B;  3CRC A;  1AI7 A;  1IBM B;  2E76 B;  3STL C;  2UXD O;  1SZT A;  5HFL A;  2CTQ A;  1IDS A;  1G6U A;  2PYL A;  1YEW A;  1XI1 A;  4FLZ A;  3AK1 A;  2XT9 A;  3K58 A;  4GX2 A;  2LGQ A;  5GTH Z;  4NTY A;  3CRR A;  2YIB A;  5KHK A;  5L3E A;  1EN4 A;  2OIG A;  1MZF A;  3CSX A;  1S76 D;  1AVM A;  3ETE A;  4MS2 A;  3UT5 B;  4JYY A;  1BT8 A;  2EUL A;  1K33 A;  2QKS A;  1QR9 A;  5K1P A;  3RW0 A;  4TT3 G;  1PNL A;  2DN9 A;  2ILM A;  3T1C A;  1FAF A;  2AHY A;  4YHH O;  2RDC A;  1AI6 A;  3CEI A;  4X64 B;  5CBG A;  4WFH A;  1IXB A;  3VQX A;  1XNR B;  2DW4 A;  5FNV B;  1L0N H;  1Z5W A;  2UXC O;  4LH7 A;  1VIB A;  5CA1 A;  1BMF G;  4OXS A;  1GM9 A;  4JI5 B;  4QIW F;  1AI4 A;  4UB6 Z;  4DR3 O;  4DV7 O;  1NTZ H;  4NTW A;  1MG1 A;  1F51 A;  1AJQ A;  4XDJ A;  3WB1 A;  1RM1 B;  1BL8 A;  3JAK A;  4MT8 A;  3SJQ C;  1LR1 A;  2EIL B;  4X89 A;  5EBM C;  4JTA B;  5IJ0 A;  3CC2 V;  1ZLZ A;  4JZ2 A;  1OCO B;  5J2U A;  3FYE B;  4FFB A;  4LNU A;  1DF4 A;  3TK1 A;  2Q0O C;  4I4T A;  2FYU H;  5C8Y A;  4K35 A;  5LMN O;  2ZD9 A;  4I0X B;  1TVK B;  1MNG A;  1PKX A;  5LP6 A;  4DV4 B;  4IHJ A;  1QU7 A;  3E8H A;  2EIJ C;  3W7W A;  1THZ A;  3H9V A;  1XMO B;  4TV9 A;  5J2U B;  3U0Z A;  2M7W A;  2Q7G A;  3EFF K;  1S77 D;  3OFN G;  3UQ8 A;  4LH6 A;  1YZB A;  2GDS A;  3P30 A;  2Y4U A;  4MTF A;  1HNW O;  4UCS A;  1KKC A;  4WFG A;  1JX9 A;  1AJP A;  2DMX A;  5LHI A;  3BCC H;  5KUK A;  3K9A A;  3ASO B;  3JAR A;  2QKA A;  3ZHQ A;  3OUF A;  2GUZ A;  4FIP C;  2Q68 A;  1IBL B;  1MSD A;  2FTK A;  4PDV A;  1FJG B;  4YJ3 B;  1RSO B; 
#chains in the Genus database with same CATH homology
 4I0X B;  4LWS A;  3Q4H B;  3ZBH A;  3Q4H A;  3FAV A;  2KG7 B;  3OGI B;  3FD9 A;  2KG7 A;  3FAV B;  2VRZ A;  3GWK C;  4GZR B;  1WA8 B;  3GVM A;  2DE0 X;  3TXQ A;  1WA8 A;  4ABM A;  3G80 A;  3O9O A;  3TXS A;  2B9Z A;  2AZ2 A;  2AZ0 A;  4I0X A;  4LWS B;  2VS0 A;  3HR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...