2KGOA

Solution nmr structure of zn finger protein ybil from escherichia coli. nesg target et107, ocsp target ec0402
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
b'MASGWANDDAVNEQINSTIEDAIARARGEIPRGESLDECEECGAPIPQARREAIPGVRLCIHCQQEKDLQKPAYTGYNRRGSKDSQLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ybiI
publication title Zn-finger protein YBIL from E. coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01258 zf-dskA_traR Prokaryotic dksA/traR C4-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kgoA01
2KGOA 2KQ9A 4IJJA
chains in the Genus database with same CATH superfamily
3PMRA 1KTMA 3ZQYA 2HV7A 4CS8A 4YN0B 1YAUO 2JPUA 2YQYA 4JTCB 4WGZA 3S27A 3KH2A 4O7GA 3DM5A 4DRJB 3KL4A 3ZTZA 5KYWA 2NPUA 1A41A 4ER9A 1YDIA 4MTOA 3EFOB 1M2OA 3SNHA 2WB7A 3JCUQ 4IAQA 1D0XA 1A0BA 4IJJA 2YLIA 1TFOB 1VYIA 4YWQA 2EIMC 2C03A 4KNVA 4YJWA 3UMHA 3DJNB 4JCHA 4MVMA 4LLEA 3E70C 4YL0A 3UNGC 1GM5A 4BJ6A 2YL7A 4YT2A 1I4YA 2UUHA 5AC4A 1QQ3A 4L6RA 4WGYA 4XPXA 1U6HA 4JE9A 1CPQA 3EGXB 2R7SA 2HJMA 2FFHA 4JW1A 1MQVA 1K04A 3TJ5A 1EI7A 2DYSC 3NYJA 5EGYA 4EIYA 2XSEA 1B68A 3BEHA 3DE9A 4MTGA 3B0VC 1Z63A 2PP4A 4LLCA 3M15A 2EIJC 2R05A 3B71A 3KMIA 3LJBA 4DRIB 2L6GA 4C7OB 2I8BA 2ZPAA 1UFBA 1K40A 2CGEA 2MYSA 2Q4FA 1TKNA 2QY9A 2ZD9A 3JSZA 3KKBA 4K7BA 2WZGA 1JR8A 3H2VA 2X0CA 4HEAJ 1BR1A 2LP4A 1A7EA 1ZW3A 2Q7RA 3N24A 2LFDA 2NUPB 1TWCA 4OIOF 4E7ZA 2QTVA 4XQ1A 3W8HA 3JT1A 2R7WA 2OU6A 4IB4A 5A6BA 5JRAA 1OCOC 3E9VA 1A7DA 2KQ9A 3DE8A 1XZPA 4U5BE 4DVYP 1ORJA 4G78A 1OKKD 3R7CA 3FAPB 1UG7A 4D4NA 4NC3A 3TULA 2QUPA 2F22A 4JZAA 3TQOA 4NTBA 1RJ9A 4U5EE 2YLGA 4GYTA 1MMAA 2EPOA 5HSWA 5E3CA 4EWCA 5L3QA 2XLEA 1PD0A 3QTHA 3CQZA 2DGJA 1U89A 2IXMA 4U9DA 3NRHA 3GEHA 3SXMA 2CYDA 2D5RB 4O79A 5COGA 4CS9C 1CGNA 3ZDLA 4JRZA 4MW3A 1GQAA 3SZRA 3RYLA 2O9XA 1R5ID 3O6XA 5AGFA 3MLGA 5E33A 3X1OA 1K05A 3RVZA 3GM3A 4YT8A 2IM8A 2WVNA 2A69F 2EPMX 3QVYA 2LQGA 3OWTA 1YA9A 2H7VC 3H2UA 2C04A 4LDQA 3IQ5A 1RKCA 1F1MA 1LVKA 1TWGA 5JUAA 3EH2A 2HUJA 3JYYA 3CEXA 3T6BA 5HV9A 3RQGA 1WASA 4JTAB 5L0HA 3UGPA 3IHUA 1U0BB 4I44A 1L3PA 2WZLA 2ZXPA 4OINF 3RF3A 2XLVA 2MWQA 1V74B 2OKUA 5KYUB 1E85A 2J8WA 1ST6A 5EHHA 2L9JA 2IXOA 5E3AA 4Z9HA 3HNKA 2KGOA 1H7IA 4MVRA 1VTMP 4J7TA 3DD7A 3G50A 1LI7A 3TD7A 4YL1A 3JYHA 1LIHA 1VLSA 2XS8A 4J7YA 4CIHA 1HE9A 2YZSA 4O6NA 3VF0A 2I15A 1CGOA 1TQGA 1YARO 2ETSA 3EFOA 3LNRA 2KJGA 4RD9A 3EHMA 5BQHA 2XRHA 3DJUB 1S7ZA 1WOLA 1T01A 1NLXA 2NSGA 1OKKA 3EGDB 4IRUA 4E17A 2LD6A 2OJED 2J0XA 3WODF 2XXAA 5JS5A 2Q9AA 3GANA 4EUKB 1ZU4A 2KK1A 2J9WA 2LFFA 2Q00A 2RD9A 5E2QA 2V26A 1OR3A 1VB5A 1YZAA 2Y3BA 3FMSA 3W4YA 4CS7A 4EKWA 1TR2A 2L7AA 4NTAA 4I3MA 3V7OA 3S90A 1MMNA 1Q0KA 1ORSC 1QSPA 2CDQA 3B0PA 4ULVA 1FMWA 2YHSA 4O6MA 2XLOA 3EHNA 2G3VA 2HMQA 4EBBA 3ABKC 1DOVA 1OW8A 2XLWA 3DAGA 2KSFA 2Y69C 4MW8A 4C7OA 4BEMJ 3W8IA 4N06A 4MVQA 1HY5A 3GM1A 3K6BA 1GS9A 3VAYA 3WHNA 3U0CA 1TFKB 3ITFA 3M4CA 3L0IA 2JD3A 3DAFA 3US6A 4CSAC 4KC9A 2NUPA 2YL1A 3NDBB 3QW0A 3SXKA 2MHRA 2R7TA 4MQ9F 4ZLDA 4JJFA 4G7ZF 1WGWA 2R9RB 1Z7Qc 3X2QC 3IPMO 1LPEA 3KYIA 2ZXRA 3MYIA 3V5YA 4AL1A 3C62A 4J30B 5F5FA 3T4RA 2ZXOA 3F46A 4XLPF 3ATPA 4CBEA 3K1IC 4IWBA 5BQIA 2DB4A 2YVKA 4GEHA 4NTFA 2R7XA 2VCCA 4KNWA 3O55A 3AG3C 2H8AA 4DBRA 1FR0A 2XXAB 1Z3IX 2WVOA 1Q0DA 2BE5F 4ULWA 3QZCA 5COMA 3A11A 5D91A 4C3BA 4DVZA 2KYHA 3GODA 1BBHA 1MNEA 3K66A 1YYJA 4FWVA 2DYRC 3GORA 4CX9A 4E18A 2WZFA 2IXNA 3LAYA 1C03A 3HNJA 2BC5A 3M1CB 1KU2A 4EBKA 3HLZA 2WVQA 4Q5SF 2HS5A 3HTKC 4OIPF 5K0IA 3AQCA 3L34A 1RKEB 1QKRA 3UMIA 4PJJA 4MVSA 3AG1C 4E7SA 4Q7CA 2Z15A 5KYUA 4JEBA 1M56C 3JZ0A 4YL3A 5A69A 3SP1A 4B6IA 1OXKA 4HFKB 1ZHXA 4JTDB 4PACA 1ZHWA 2EINC 4PR9A 4FESA 3IQ6A 4XEFA 5D92A 2R25A 5JVEA 2AWYA 1NSGB 5JLIA 1FNTc 3GM2A 1H9TA 4GQHA 3RKOF 4LDRA 3V5ZA 4F4BA 1FFHA 2W4BA 4JCZA 4CJOA 3LESA 2CCYA 3AGTA 2W45A 1HMOA 2XL8A 2BL2A 3ASNC 1JAFA 3DI5A 3S0XA 3KYJA 1T6IA 3Q6MA 4N6HA 4EHPA 3RFYA 5L0DA 3UMKA 2PFDA 3AOUA 3EGDA 4CSAA 3O10A 1MMDA 3WAQA 1NG1A 1OXBA 3EJNA 2H7OA 1XWJA 2QE9A 2JX0A 2HZ8A 1ZHZA 2YRFA 4K0DA 4MVUA 1NBBA 4FAPB 5L3VA 1BDJB 3U3BA 1BZ4A 4G7OF 1ORYA 4E0IA 3AG2C 2Q3TA 3AQBA 5DQZA 2EILC 1E2XA 2FAPB 2LK4A 2HV6A 1NZEA 2A0UA 3JRTA 3K1IA 3LEVA 4YT4A 1T5OA 4U5GA 2EPLX 3FXHA 5BQGA 3IQCA 3GWNA 1OCZC 4CJGA 2PBEA 4LERA 1HW1A 1I5NA 3NYMA 4U5DE 1Z6AA 2UUIA 2KC3A 4XLNF 4NCQA 4Z9IA 2Y3DA 3MFNA 3NKDA 1ZZPA 2M64A 3L8IA 3NMKA 5JP7A 5L0FA 1J8YF 2EPNA 4HE8D 2L81A 2OEVA 3UGOA 3LLIA 3ZIBA 1OR2A 2YL3A 3T9OA 1OW6A 3AJMA 4JURI 4P9TA 1EKYA 2OCCC 3OA1A 3VRCA 1ZW2A 4JKVA 1G8XA 1O87A 5B1AC 1MMGA 3J06A 4E0HA 4PJMA 5EK0A 2OJQA 3S9OA 3G4XA 3Q7GA 4A2NB 1MNDA 1O5HA 3Q6NA 4MVZA 4ZLCA 4JVSA 4XPWA 1PD1A 4CDVA 2P6VA 1J8MF 3EG9B 1OQCA 3ABLC 1SZIA 3T6JA 3WG7C 2A1DD 3NKEA 2GFHA 3EZHA 1JPJA 4DRHB 4R32A 3K1HA 3N2ZB 4LDKA 2EPKX 5KYXB 5CI9A 3FAJA 4IGGA 3RQEA 3T6GB 2Y3HA 2HMZA 4BJ6C 1RMVA 1BR4A 4XEVA 5FZTA 4NY3A 2LIGA 1Q0GA 1APCA 1QPUA 1ZHTA 2HFIA 4OD5A 1AUEA 1Z5ZA 1LE2A 3ABMC 3ZSUA 4WABA 4PFPA 1QZXA 2J9VA 4XPYA 1ZU5A 1S05A 1XZQA 1C02A 3TJ6A 1YA7O 2NSFA 1TWHA 4AX2A 1NU7D 2QLAA 1Q0FA 3H65A 4CS9A 3FVYA 4ONSA 2G3KA 1C17M 4XEKA 4EBJA 2R02A 4H4KC 3EQLF 1RKEA 1WN0A 1R4TA 2P0NA 3NMIA 3B0UX 1LS1A 3U2LA 1G4WR 2AVKA 2CNWD 3CZ6A 5KYNA 1M6TA 1RCPA 2YKZA 3QVZA 2TMVP 3N0TA 3EH1A 1TWAA 2XLMA 256BA 3LS1A 4PFOA 3C8GB 3DWWA 2E87A 2P61A 3MYFA 4XTKA 1NU9C 2IOQA 1O3UA 5DVWA 2P1AA 3W2VA 2A6EF 3JRMO 4JEAA 2XL6A 1ZHYA 3M4BA 2LSEA 1YVIA 3JSEO 5IY5C 5DLJA 1LE4A 1JMWA 3NG1A 2OEXA 1NFNA 1IZMA 2D4UA 1Z23A 1T9KA 3BRJA 1JOGA 4U9EA 4BJTA 3M79A 1JRAA 4A4AA 3QW1A 2YWAA 1QVXA 3ZVRA 1SF8A 2PNOA 1RXQA 5A6JA 1EA8A 1WWPA 5L0IA 1T6QA 3ZQVA 5CI8A 1YYXA 2YL0A 5F28E 1ZYRF 3U3FA 3AG4C 3B29A 4OD4A 1D1CA 2NUTB 2XLDA 1W2WA 4DOZA 2KW3C 2HSBA 3O39A 3ZTMA 5KYYB 4QI0A 1M57C 4D4XA 1PV3A 4DJ9A 3DM9B 3ZG1A 1VK5A 2V3CC 3HNLA 2J7PD 3NYLA 4C3EA 1OCCC 1VOMA 1JPNA 2VB6A 4BPMA 3FDQA 1HW2A 4QI2A 3C63A 3L8JA 1FFTC 1E83A 1N1CA 4O6YA 3C8GD 2VASA 1H6GA 3RVYA 4X0RA 3SYNA 3K33A 2ASRA 5BUOA 2R7RA 2IYLD 2R7UA 2EIKC 5GPGB 1Y4CA 1DOWA 4HFFB 4H54A 2IBFA 1M2VB 2QNLA 3LUTB 2XM4A 3PHF2 3F47A 1PCXA 3AGUA 4DBQA 2P7VA 2CNWA 2XL4A 3LS0A 4PK4A 5DS5A 1FTSA 3VYWA 2J9BA 3FHDA 4KBLA 1HE1A 5JSLA 3SXYA 3PDMP 1A7VA 3HNIA 3GEEA 4JIOA 1YLMA 3TOMA 3A9CA 3S29A 3ZC4A 5CIVA 2J46A 1LM3B 1WATA 1LI5A 5T3TA 3CSKA 4JJGA 4U5HA 3VM6A 2J0WA 1FMVA 4J32B 2Y3GA 1Q0MA 3EG9A 4U5FE 3DXJF 4Q4ZF 3TOLA 5F5HA 3TK0A 4BG0A 2PX3A 2RSEB 4OIQF 3DMDA 1QLEC 4KI2A 5JT4A 3S84A 2X51A 1G5ZA 3U5SA 5KYXA 4ANJA 2L6FA 2GA0A 3C8ZA 4LACB 4RBNA 2G62A 5KYWB 1AVOB 2WL8A 2XM0A 1CPRA 2YEVA 3C18A 4IAOA 4MS2A 4PJLA 4W8PA 4AE4A 4CDYA 1AEPA 1D0ZA 4BJ5C 1L7CA 1SYQA 2VCAA 3U8PA 4G7HF 2XLHA 4OIRF 3I5QA 5DQTA 4N4WA 3OEOA 2YLDA 4MNDA 4BEJA 3EZIA 5L0GA 2J7PA 4QDLA 4CDAA 3LEOA 3V5XA 1V55C 1KNYA 3I5PA 3RQFA 3U2MA 3C8GA 2KNHA 2R7VA 1SMYF 1D1BA 1H9GA 1ZVZA 1SR2A 2AU5A 2OQMA 3NMJA 4I1MA 1T6UA 4CS8C 3LLKA 5L0CA 2NG1A 1VYKA 1YZCA 3FOPA 5B3IA 4P9FA 3K7DA 4JC7A 4DXWA 4AK9A 1G4US 4N6CA 4NQFA 2PX0A 2AP3A 3ASOC 4I1OB 2R7OA 2Q9CA 3CAXA 2GWWA 4C3DA 3UR3C 4WJ0A 2A6HF 3GWLA 3SXZA 4MTFA 2A68F 2W4MA 2ICWG 5B1BC 3ZWIA 2DI3A 3S28A 1HMDA 2OG2A 5T3WA 2Y39A 2VCBA 3HKKA 3KPHA 4K1OA 2PF4E 2R03A 5B3SC 4PJNA 4Z9JA 2NUTA 3I4UA 1V4AA 1LKXA 5L0JA 2W9YA 3JTLO 2L6HA 4AE4B 4YT5A 1CGME 5KYYA 1VLTA 2Q9BA 3RH3A 1RJ9B 3B9QA 3R2PA 4AL0A 4BJ1A 1E86A 5FCLA 1WTYA 5COFA 4P6IC 5A6KA 2HKVA 3DKAA 2VH3A 5A6AA 2J9UA 1OCRC 2A0BA 2ZXWC 1D1AA 2HSQA 3ECSA 3U9JA 4G0HA 1V54C 5TJ5E 4CIPA 3MX3A 5DS6A 1NFOA 4FX5A 2J45A 3C7JA 3FOOA 3IQTA 2R7QA 1IW7F 3L1MA 5T1DB 3RW0A 1GGQA 3W2WA 4W8KA 2GDCA 1M2VA 4MVOA 5DS4A 4UDVA 3EGXA 2B0HA 2VC9A 2H7BA 4XWJA 1I4ZA 4M63A 4RDAA 3EPVA 2M4EA 4U5CE 4BJ5A 3POVA 2IXPA 3HJCA 1YJGA 2GAQA 3Q7LA 4IARA 3SEOA 2XS1A 3DZAA 1FAPB 3RIPA 1Y6DA 2B0JA 2FGYA 2OOCA 3U8VA 1E84A 3QMKA 1VMAA 1EQ1A 1BR2A 3GEIA 2AWCA 3IEEA 1D0YA 4YK5A 2LCHA 3PCVA 5A6BD 3LNMB 3U9MA 3MBGA 1LS4A 2HJ3A 3G4ZA 5AC5A 1OW7A 2CW0F
chains in the Genus database with same CATH topology
3PMRA 2HV7A 4CS8A 4YN0B 3S27A 3KH2A 4O7GA 3DM5A 3KL4A 5KYWA 3EFOB 1M2OA 3SNHA 2WB7A 3JCUQ 1D0XA 4IJJA 1VYIA 4YWQA 2EIMC 2C03A 4KNVA 4YJWA 3UMHA 3DJNB 4JCHA 4OIOF 4LLEA 3E70C 3UNGC 4BJ6A 4YT2A 3EGXB 2FFHA 4JW1A 2DYSC 3NYJA 5EGYA 2XSEA 3B0VC 1Z63A 2PP4A 4LLCA 2EIJC 3KMIA 3LJBA 4C7OB 2I8BA 2ZPAA 2CGEA 2MYSA 1TKNA 2QY9A 3JSZA 3KKBA 4K7BA 2WZGA 4HEAJ 1BR1A 3N24A 2NUPB 1TWCA 4E7ZA 2QTVA 3W8HA 3JT1A 2R7WA 1OCOC 3E9VA 2KQ9A 4U5BE 4DVYP 1OKKD 4JZAA 1RJ9A 4U5EE 4GYTA 1MMAA 5HSWA 5E3CA 4EWCA 5L3QA 1PD0A 3CQZA 2DGJA 2IXMA 3NRHA 4CS9C 2D5RB 4O79A 3SZRA 3RYLA 2O9XA 3O6XA 5E33A 3MLGA 3X1OA 4YT8A 2WVNA 2A69F 3OWTA 2H7VC 2C04A 1LVKA 1TWGA 3EH2A 3T6BA 3UGPA 4I44A 2WZLA 2ZXPA 4OINF 2MWQA 5KYUB 5EHHA 1ST6A 2L9JA 2IXOA 5E3AA 2KGOA 3DD7A 3TD7A 3JYHA 4CIHA 2YZSA 4O6NA 3EFOA 3LNRA 2KJGA 4RD9A 3EHMA 3DJUB 2XRHA 1S7ZA 3EGDB 1OKKA 4IRUA 2J0XA 3WODF 2XXAA 2Q9AA 3GANA 1ZU4A 2J9WA 4CS7A 5E2QA 2V26A 2Y3BA 1TR2A 3V7OA 4I3MA 1MMNA 2CDQA 3B0PA 1FMWA 2YHSA 4O6MA 3EHNA 2G3VA 4EBBA 3ABKC 3DAGA 2Y69C 4C7OA 3W8IA 4N06A 3VAYA 3K6BA 3ITFA 3L0IA 2JD3A 3DAFA 4CSAC 4KC9A 2NUPA 3NDBB 2R7TA 4MQ9F 4ZLDA 4JJFA 4G7ZF 1WGWA 3X2QC 2ZXRA 4J30B 5F5FA 3T4RA 2ZXOA 3F46A 4XLPF 4CBEA 3K1IC 4IWBA 4GEHA 2R7XA 4KNWA 4DBRA 3AG3C 2XXAB 1Z3IX 2WVOA 2BE5F 4ULWA 5D91A 3QZCA 4C3BA 4DVZA 3GODA 1MNEA 3K66A 4FWVA 2DYRC 2WZFA 2IXNA 3LAYA 3M1CB 1KU2A 3HLZA 2WVQA 4Q5SF 3HTKC 4OIPF 3AQCA 3L34A 3UMIA 4PJJA 3AG1C 4E7SA 4Q7CA 2Z15A 5KYUA 1M56C 3SP1A 4B6IA 4HFKB 1ZHXA 1ZHWA 2EINC 3S0XA 4FESA 5D92A 3RKOF 4F4BA 1FFHA 2W4BA 3LESA 2W45A 3ASNC 3Q6MA 3RFYA 4CSAA 3UMKA 2PFDA 3EGDA 1MMDA 1NG1A 3EJNA 2H7OA 1ZHZA 4K0DA 5L3VA 4G7OF 3AG2C 2Q3TA 3AQBA 5DQZA 2EILC 3LEVA 4YT4A 3JRTA 2HV6A 1NZEA 4U5GA 1OCZC 4LERA 4U5DE 3NYMA 1Z6AA 4XLNF 2Y3DA 3NKDA 1J8YF 4HE8D 2L81A 3UGOA 3LLIA 3ZIBA 4JURI 2OCCC 3OA1A 1G8XA 1O87A 5B1AC 1MMGA 4PJMA 3Q7GA 4A2NB 1MNDA 1O5HA 3Q6NA 4ZLCA 4JVSA 1PD1A 2P6VA 1J8MF 3EG9B 3ABLC 1SZIA 3T6JA 3WG7C 2A1DD 3NKEA 2GFHA 3EZHA 1JPJA 3K1HA 3N2ZB 5KYXB 5CI9A 3FAJA 4BJ6C 2Y3HA 1BR4A 4NY3A 1ZHTA 3ZSUA 4OD5A 1Z5ZA 3ABMC 4PFPA 1QZXA 2J9VA 1ZU5A 4AX2A 1TWHA 1NU7D 3H65A 4CS9A 3FVYA 2G3KA 4H4KC 3EQLF 3B0UX 1LS1A 2CNWD 3CZ6A 5KYNA 3N0TA 3EH1A 1TWAA 3LS1A 4PFOA 2E87A 4XTKA 1NU9C 2IOQA 3W2VA 5DVWA 2A6EF 1ZHYA 2LSEA 5IY5C 5DLJA 3NG1A 1IZMA 1Z23A 4BJTA 3ZVRA 1SF8A 5CI8A 1ZYRF 3AG4C 4OD4A 1D1CA 2NUTB 1W2WA 4DOZA 2KW3C 3O39A 5KYYB 4QI0A 1M57C 3DM9B 3ZG1A 1VK5A 2V3CC 3NYLA 2J7PD 4C3EA 3FDQA 1OCCC 1VOMA 1JPNA 2VB6A 4QI2A 1FFTC 1N1CA 4O6YA 2VASA 4X0RA 3SYNA 3K33A 5BUOA 2R7RA 2IYLD 2R7UA 2EIKC 4HFFB 1M2VB 3PHF2 3F47A 1PCXA 4DBQA 2P7VA 2CNWA 2XL4A 3LS0A 4PK4A 5DS5A 1FTSA 3VYWA 3FHDA 4KBLA 3S29A 3ZC4A 2J46A 5T3TA 3CSKA 4JJGA 4U5HA 2J0WA 1FMVA 4J32B 2Y3GA 3EG9A 4U5FE 3DXJF 4Q4ZF 5F5HA 4BG0A 2PX3A 4OIQF 3DMDA 1QLEC 4KI2A 2X51A 5KYXA 4ANJA 4LACB 4RBNA 2G62A 5KYWB 2WL8A 2YEVA 4IAOA 4PJLA 4AE4A 1D0ZA 4BJ5C 4G7HF 4OIRF 3I5QA 5DQTA 3OEOA 4MNDA 4BEJA 3EZIA 2J7PA 4QDLA 1V55C 3I5PA 2KNHA 2R7VA 1SMYF 1D1BA 4I1MA 4CS8C 3LLKA 2NG1A 1VYKA 3K7DA 4AK9A 2PX0A 3ASOC 4I1OB 2R7OA 2Q9CA 4C3DA 3UR3C 4WJ0A 2A6HF 2A68F 2W4MA 5B1BC 3S28A 2OG2A 5T3WA 2Y39A 2PF4E 5B3SC 4PJNA 2NUTA 3I4UA 1LKXA 2W9YA 4AE4B 4YT5A 5KYYA 2Q9BA 3RH3A 1RJ9B 3B9QA 4BJ1A 5FCLA 4P6IC 2VH3A 2J9UA 1OCRC 2ZXWC 2R7SA 1D1AA 3ECSA 4G0HA 1V54C 3MX3A 5DS6A 4FX5A 2J45A 5T1DB 2R7QA 1IW7F 3W2WA 4W8KA 5DS4A 1M2VA 3EGXA 2H7BA 4XWJA 4M63A 4RDAA 3EPVA 2M4EA 4U5CE 4BJ5A 3POVA 2IXPA 3HJCA 3Q7LA 3SEOA 3DZAA 3RIPA 2B0JA 2FGYA 3QMKA 1VMAA 1BR2A 3IEEA 1D0YA 2CW0F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGO A;  2KQ9 A;  4IJJ A; 
#chains in the Genus database with same CATH topology
 3PMR A;  1KTM A;  3ZQY A;  2HV7 A;  4CS8 A;  4YN0 B;  1YAU O;  2JPU A;  2YQY A;  4JTC B;  4WGZ A;  3S27 A;  3KH2 A;  4O7G A;  3DM5 A;  4DRJ B;  3KL4 A;  3ZTZ A;  5KYW A;  2NPU A;  1A41 A;  4ER9 A;  1YDI A;  4MTO A;  3EFO B;  1M2O A;  3SNH A;  2WB7 A;  3JCU Q;  4IAQ A;  1D0X A;  1A0B A;  4IJJ A;  2YLI A;  1TFO B;  1VYI A;  4YWQ A;  2EIM C;  2C03 A;  4KNV A;  4YJW A;  3UMH A;  3DJN B;  4JCH A;  4MVM A;  4LLE A;  3E70 C;  4YL0 A;  3UNG C;  1GM5 A;  4BJ6 A;  2YL7 A;  4YT2 A;  1I4Y A;  2UUH A;  5AC4 A;  1QQ3 A;  4L6R A;  4WGY A;  4XPX A;  1U6H A;  4JE9 A;  1CPQ A;  3EGX B;  2R7S A;  2HJM A;  2FFH A;  4JW1 A;  1MQV A;  1K04 A;  3TJ5 A;  1EI7 A;  2DYS C;  3NYJ A;  5EGY A;  4EIY A;  2XSE A;  1B68 A;  3BEH A;  3DE9 A;  4MTG A;  3B0V C;  1Z63 A;  2PP4 A;  4LLC A;  3M15 A;  2EIJ C;  2R05 A;  3B71 A;  3KMI A;  3LJB A;  4DRI B;  2L6G A;  4C7O B;  2I8B A;  2ZPA A;  1UFB A;  1K40 A;  2CGE A;  2MYS A;  2Q4F A;  1TKN A;  2QY9 A;  2ZD9 A;  3JSZ A;  3KKB A;  4K7B A;  2WZG A;  1JR8 A;  3H2V A;  2X0C A;  4HEA J;  1BR1 A;  2LP4 A;  1A7E A;  1ZW3 A;  2Q7R A;  3N24 A;  2LFD A;  2NUP B;  1TWC A;  4OIO F;  4E7Z A;  2QTV A;  4XQ1 A;  3W8H A;  3JT1 A;  2R7W A;  2OU6 A;  4IB4 A;  5A6B A;  5JRA A;  1OCO C;  3E9V A;  1A7D A;  2KQ9 A;  3DE8 A;  1XZP A;  4U5B E;  4DVY P;  1ORJ A;  4G78 A;  1OKK D;  3R7C A;  3FAP B;  1UG7 A;  4D4N A;  4NC3 A;  3TUL A;  2QUP A;  2F22 A;  4JZA A;  3TQO A;  4NTB A;  1RJ9 A;  4U5E E;  2YLG A;  4GYT A;  1MMA A;  2EPO A;  5HSW A;  5E3C A;  4EWC A;  5L3Q A;  2XLE A;  1PD0 A;  3QTH A;  3CQZ A;  2DGJ A;  1U89 A;  2IXM A;  4U9D A;  3NRH A;  3GEH A;  3SXM A;  2CYD A;  2D5R B;  4O79 A;  5COG A;  4CS9 C;  1CGN A;  3ZDL A;  4JRZ A;  4MW3 A;  1GQA A;  3SZR A;  3RYL A;  2O9X A;  1R5I D;  3O6X A;  5AGF A;  3MLG A;  5E33 A;  3X1O A;  1K05 A;  3RVZ A;  3GM3 A;  4YT8 A;  2IM8 A;  2WVN A;  2A69 F;  2EPM X;  3QVY A;  2LQG A;  3OWT A;  1YA9 A;  2H7V C;  3H2U A;  2C04 A;  4LDQ A;  3IQ5 A;  1RKC A;  1F1M A;  1LVK A;  1TWG A;  5JUA A;  3EH2 A;  2HUJ A;  3JYY A;  3CEX A;  3T6B A;  5HV9 A;  3RQG A;  1WAS A;  4JTA B;  5L0H A;  3UGP A;  3IHU A;  1U0B B;  4I44 A;  1L3P A;  2WZL A;  2ZXP A;  4OIN F;  3RF3 A;  2XLV A;  2MWQ A;  1V74 B;  2OKU A;  5KYU B;  1E85 A;  2J8W A;  1ST6 A;  5EHH A;  2L9J A;  2IXO A;  5E3A A;  4Z9H A;  3HNK A;  2KGO A;  1H7I A;  4MVR A;  1VTM P;  4J7T A;  3DD7 A;  3G50 A;  1LI7 A;  3TD7 A;  4YL1 A;  3JYH A;  1LIH A;  1VLS A;  2XS8 A;  4J7Y A;  4CIH A;  1HE9 A;  2YZS A;  4O6N A;  3VF0 A;  2I15 A;  1CGO A;  1TQG A;  1YAR O;  2ETS A;  3EFO A;  3LNR A;  2KJG A;  4RD9 A;  3EHM A;  5BQH A;  2XRH A;  3DJU B;  1S7Z A;  1WOL A;  1T01 A;  1NLX A;  2NSG A;  1OKK A;  3EGD B;  4IRU A;  4E17 A;  2LD6 A;  2OJE D;  2J0X A;  3WOD F;  2XXA A;  5JS5 A;  2Q9A A;  3GAN A;  4EUK B;  1ZU4 A;  2KK1 A;  2J9W A;  2LFF A;  2Q00 A;  2RD9 A;  5E2Q A;  2V26 A;  1OR3 A;  1VB5 A;  1YZA A;  2Y3B A;  3FMS A;  3W4Y A;  4CS7 A;  4EKW A;  1TR2 A;  2L7A A;  4NTA A;  4I3M A;  3V7O A;  3S90 A;  1MMN A;  1Q0K A;  1ORS C;  1QSP A;  2CDQ A;  3B0P A;  4ULV A;  1FMW A;  2YHS A;  4O6M A;  2XLO A;  3EHN A;  2G3V A;  2HMQ A;  4EBB A;  3ABK C;  1DOV A;  1OW8 A;  2XLW A;  3DAG A;  2KSF A;  2Y69 C;  4MW8 A;  4C7O A;  4BEM J;  3W8I A;  4N06 A;  4MVQ A;  1HY5 A;  3GM1 A;  3K6B A;  1GS9 A;  3VAY A;  3WHN A;  3U0C A;  1TFK B;  3ITF A;  3M4C A;  3L0I A;  2JD3 A;  3DAF A;  3US6 A;  4CSA C;  4KC9 A;  2NUP A;  2YL1 A;  3NDB B;  3QW0 A;  3SXK A;  2MHR A;  2R7T A;  4MQ9 F;  4ZLD A;  4JJF A;  4G7Z F;  1WGW A;  2R9R B;  1Z7Q c;  3X2Q C;  3IPM O;  1LPE A;  3KYI A;  2ZXR A;  3MYI A;  3V5Y A;  4AL1 A;  3C62 A;  4J30 B;  5F5F A;  3T4R A;  2ZXO A;  3F46 A;  4XLP F;  3ATP A;  4CBE A;  3K1I C;  4IWB A;  5BQI A;  2DB4 A;  2YVK A;  4GEH A;  4NTF A;  2R7X A;  2VCC A;  4KNW A;  3O55 A;  3AG3 C;  2H8A A;  4DBR A;  1FR0 A;  2XXA B;  1Z3I X;  2WVO A;  1Q0D A;  2BE5 F;  4ULW A;  3QZC A;  5COM A;  3A11 A;  5D91 A;  4C3B A;  4DVZ A;  2KYH A;  3GOD A;  1BBH A;  1MNE A;  3K66 A;  1YYJ A;  4FWV A;  2DYR C;  3GOR A;  4CX9 A;  4E18 A;  2WZF A;  2IXN A;  3LAY A;  1C03 A;  3HNJ A;  2BC5 A;  3M1C B;  1KU2 A;  4EBK A;  3HLZ A;  2WVQ A;  4Q5S F;  2HS5 A;  3HTK C;  4OIP F;  5K0I A;  3AQC A;  3L34 A;  1RKE B;  1QKR A;  3UMI A;  4PJJ A;  4MVS A;  3AG1 C;  4E7S A;  4Q7C A;  2Z15 A;  5KYU A;  4JEB A;  1M56 C;  3JZ0 A;  4YL3 A;  5A69 A;  3SP1 A;  4B6I A;  1OXK A;  4HFK B;  1ZHX A;  4JTD B;  4PAC A;  1ZHW A;  2EIN C;  4PR9 A;  4FES A;  3IQ6 A;  4XEF A;  5D92 A;  2R25 A;  5JVE A;  2AWY A;  1NSG B;  5JLI A;  1FNT c;  3GM2 A;  1H9T A;  4GQH A;  3RKO F;  4LDR A;  3V5Z A;  4F4B A;  1FFH A;  2W4B A;  4JCZ A;  4CJO A;  3LES A;  2CCY A;  3AGT A;  2W45 A;  1HMO A;  2XL8 A;  2BL2 A;  3ASN C;  1JAF A;  3DI5 A;  3S0X A;  3KYJ A;  1T6I A;  3Q6M A;  4N6H A;  4EHP A;  3RFY A;  5L0D A;  3UMK A;  2PFD A;  3AOU A;  3EGD A;  4CSA A;  3O10 A;  1MMD A;  3WAQ A;  1NG1 A;  1OXB A;  3EJN A;  2H7O A;  1XWJ A;  2QE9 A;  2JX0 A;  2HZ8 A;  1ZHZ A;  2YRF A;  4K0D A;  4MVU A;  1NBB A;  4FAP B;  5L3V A;  1BDJ B;  3U3B A;  1BZ4 A;  4G7O F;  1ORY A;  4E0I A;  3AG2 C;  2Q3T A;  3AQB A;  5DQZ A;  2EIL C;  1E2X A;  2FAP B;  2LK4 A;  2HV6 A;  1NZE A;  2A0U A;  3JRT A;  3K1I A;  3LEV A;  4YT4 A;  1T5O A;  4U5G A;  2EPL X;  3FXH A;  5BQG A;  3IQC A;  3GWN A;  1OCZ C;  4CJG A;  2PBE A;  4LER A;  1HW1 A;  1I5N A;  3NYM A;  4U5D E;  1Z6A A;  2UUI A;  2KC3 A;  4XLN F;  4NCQ A;  4Z9I A;  2Y3D A;  3MFN A;  3NKD A;  1ZZP A;  2M64 A;  3L8I A;  3NMK A;  5JP7 A;  5L0F A;  1J8Y F;  2EPN A;  4HE8 D;  2L81 A;  2OEV A;  3UGO A;  3LLI A;  3ZIB A;  1OR2 A;  2YL3 A;  3T9O A;  1OW6 A;  3AJM A;  4JUR I;  4P9T A;  1EKY A;  2OCC C;  3OA1 A;  3VRC A;  1ZW2 A;  4JKV A;  1G8X A;  1O87 A;  5B1A C;  1MMG A;  3J06 A;  4E0H A;  4PJM A;  5EK0 A;  2OJQ A;  3S9O A;  3G4X A;  3Q7G A;  4A2N B;  1MND A;  1O5H A;  3Q6N A;  4MVZ A;  4ZLC A;  4JVS A;  4XPW A;  1PD1 A;  4CDV A;  2P6V A;  1J8M F;  3EG9 B;  1OQC A;  3ABL C;  1SZI A;  3T6J A;  3WG7 C;  2A1D D;  3NKE A;  2GFH A;  3EZH A;  1JPJ A;  4DRH B;  4R32 A;  3K1H A;  3N2Z B;  4LDK A;  2EPK X;  5KYX B;  5CI9 A;  3FAJ A;  4IGG A;  3RQE A;  3T6G B;  2Y3H A;  2HMZ A;  4BJ6 C;  1RMV A;  1BR4 A;  4XEV A;  5FZT A;  4NY3 A;  2LIG A;  1Q0G A;  1APC A;  1QPU A;  1ZHT A;  2HFI A;  4OD5 A;  1AUE A;  1Z5Z A;  1LE2 A;  3ABM C;  3ZSU A;  4WAB A;  4PFP A;  1QZX A;  2J9V A;  4XPY A;  1ZU5 A;  1S05 A;  1XZQ A;  1C02 A;  3TJ6 A;  1YA7 O;  2NSF A;  1TWH A;  4AX2 A;  1NU7 D;  2QLA A;  1Q0F A;  3H65 A;  4CS9 A;  3FVY A;  4ONS A;  2G3K A;  1C17 M;  4XEK A;  4EBJ A;  2R02 A;  4H4K C;  3EQL F;  1RKE A;  1WN0 A;  1R4T A;  2P0N A;  3NMI A;  3B0U X;  1LS1 A;  3U2L A;  1G4W R;  2AVK A;  2CNW D;  3CZ6 A;  5KYN A;  1M6T A;  1RCP A;  2YKZ A;  3QVZ A;  2TMV P;  3N0T A;  3EH1 A;  1TWA A;  2XLM A;  256B A;  3LS1 A;  4PFO A;  3C8G B;  3DWW A;  2E87 A;  2P61 A;  3MYF A;  4XTK A;  1NU9 C;  2IOQ A;  1O3U A;  5DVW A;  2P1A A;  3W2V A;  2A6E F;  3JRM O;  4JEA A;  2XL6 A;  1ZHY A;  3M4B A;  2LSE A;  1YVI A;  3JSE O;  5IY5 C;  5DLJ A;  1LE4 A;  1JMW A;  3NG1 A;  2OEX A;  1NFN A;  1IZM A;  2D4U A;  1Z23 A;  1T9K A;  3BRJ A;  1JOG A;  4U9E A;  4BJT A;  3M79 A;  1JRA A;  4A4A A;  3QW1 A;  2YWA A;  1QVX A;  3ZVR A;  1SF8 A;  2PNO A;  1RXQ A;  5A6J A;  1EA8 A;  1WWP A;  5L0I A;  1T6Q A;  3ZQV A;  5CI8 A;  1YYX A;  2YL0 A;  5F28 E;  1ZYR F;  3U3F A;  3AG4 C;  3B29 A;  4OD4 A;  1D1C A;  2NUT B;  2XLD A;  1W2W A;  4DOZ A;  2KW3 C;  2HSB A;  3O39 A;  3ZTM A;  5KYY B;  4QI0 A;  1M57 C;  4D4X A;  1PV3 A;  4DJ9 A;  3DM9 B;  3ZG1 A;  1VK5 A;  2V3C C;  3HNL A;  2J7P D;  3NYL A;  4C3E A;  1OCC C;  1VOM A;  1JPN A;  2VB6 A;  4BPM A;  3FDQ A;  1HW2 A;  4QI2 A;  3C63 A;  3L8J A;  1FFT C;  1E83 A;  1N1C A;  4O6Y A;  3C8G D;  2VAS A;  1H6G A;  3RVY A;  4X0R A;  3SYN A;  3K33 A;  2ASR A;  5BUO A;  2R7R A;  2IYL D;  2R7U A;  2EIK C;  5GPG B;  1Y4C A;  1DOW A;  4HFF B;  4H54 A;  2IBF A;  1M2V B;  2QNL A;  3LUT B;  2XM4 A;  3PHF 2;  3F47 A;  1PCX A;  3AGU A;  4DBQ A;  2P7V A;  2CNW A;  2XL4 A;  3LS0 A;  4PK4 A;  5DS5 A;  1FTS A;  3VYW A;  2J9B A;  3FHD A;  4KBL A;  1HE1 A;  5JSL A;  3SXY A;  3PDM P;  1A7V A;  3HNI A;  3GEE A;  4JIO A;  1YLM A;  3TOM A;  3A9C A;  3S29 A;  3ZC4 A;  5CIV A;  2J46 A;  1LM3 B;  1WAT A;  1LI5 A;  5T3T A;  3CSK A;  4JJG A;  4U5H A;  3VM6 A;  2J0W A;  1FMV A;  4J32 B;  2Y3G A;  1Q0M A;  3EG9 A;  4U5F E;  3DXJ F;  4Q4Z F;  3TOL A;  5F5H A;  3TK0 A;  4BG0 A;  2PX3 A;  2RSE B;  4OIQ F;  3DMD A;  1QLE C;  4KI2 A;  5JT4 A;  3S84 A;  2X51 A;  1G5Z A;  3U5S A;  5KYX A;  4ANJ A;  2L6F A;  2GA0 A;  3C8Z A;  4LAC B;  4RBN A;  2G62 A;  5KYW B;  1AVO B;  2WL8 A;  2XM0 A;  1CPR A;  2YEV A;  3C18 A;  4IAO A;  4MS2 A;  4PJL A;  4W8P A;  4AE4 A;  4CDY A;  1AEP A;  1D0Z A;  4BJ5 C;  1L7C A;  1SYQ A;  2VCA A;  3U8P A;  4G7H F;  2XLH A;  4OIR F;  3I5Q A;  5DQT A;  4N4W A;  3OEO A;  2YLD A;  4MND A;  4BEJ A;  3EZI A;  5L0G A;  2J7P A;  4QDL A;  4CDA A;  3LEO A;  3V5X A;  1V55 C;  1KNY A;  3I5P A;  3RQF A;  3U2M A;  3C8G A;  2KNH A;  2R7V A;  1SMY F;  1D1B A;  1H9G A;  1ZVZ A;  1SR2 A;  2AU5 A;  2OQM A;  3NMJ A;  4I1M A;  1T6U A;  4CS8 C;  3LLK A;  5L0C A;  2NG1 A;  1VYK A;  1YZC A;  3FOP A;  5B3I A;  4P9F A;  3K7D A;  4JC7 A;  4DXW A;  4AK9 A;  1G4U S;  4N6C A;  4NQF A;  2PX0 A;  2AP3 A;  3ASO C;  4I1O B;  2R7O A;  2Q9C A;  3CAX A;  2GWW A;  4C3D A;  3UR3 C;  4WJ0 A;  2A6H F;  3GWL A;  3SXZ A;  4MTF A;  2A68 F;  2W4M A;  2ICW G;  5B1B C;  3ZWI A;  2DI3 A;  3S28 A;  1HMD A;  2OG2 A;  5T3W A;  2Y39 A;  2VCB A;  3HKK A;  3KPH A;  4K1O A;  2PF4 E;  2R03 A;  5B3S C;  4PJN A;  4Z9J A;  2NUT A;  3I4U A;  1V4A A;  1LKX A;  5L0J A;  2W9Y A;  3JTL O;  2L6H A;  4AE4 B;  4YT5 A;  1CGM E;  5KYY A;  1VLT A;  2Q9B A;  3RH3 A;  1RJ9 B;  3B9Q A;  3R2P A;  4AL0 A;  4BJ1 A;  1E86 A;  5FCL A;  1WTY A;  5COF A;  4P6I C;  5A6K A;  2HKV A;  3DKA A;  2VH3 A;  5A6A A;  2J9U A;  1OCR C;  2A0B A;  2ZXW C;  1D1A A;  2HSQ A;  3ECS A;  3U9J A;  4G0H A;  1V54 C;  5TJ5 E;  4CIP A;  3MX3 A;  5DS6 A;  1NFO A;  4FX5 A;  2J45 A;  3C7J A;  3FOO A;  3IQT A;  2R7Q A;  1IW7 F;  3L1M A;  5T1D B;  3RW0 A;  1GGQ A;  3W2W A;  4W8K A;  2GDC A;  1M2V A;  4MVO A;  5DS4 A;  4UDV A;  3EGX A;  2B0H A;  2VC9 A;  2H7B A;  4XWJ A;  1I4Z A;  4M63 A;  4RDA A;  3EPV A;  2M4E A;  4U5C E;  4BJ5 A;  3POV A;  2IXP A;  3HJC A;  1YJG A;  2GAQ A;  3Q7L A;  4IAR A;  3SEO A;  2XS1 A;  3DZA A;  1FAP B;  3RIP A;  1Y6D A;  2B0J A;  2FGY A;  2OOC A;  3U8V A;  1E84 A;  3QMK A;  1VMA A;  1EQ1 A;  1BR2 A;  3GEI A;  2AWC A;  3IEE A;  1D0Y A;  4YK5 A;  2LCH A;  3PCV A;  5A6B D;  3LNM B;  3U9M A;  3MBG A;  1LS4 A;  2HJ3 A;  3G4Z A;  5AC5 A;  1OW7 A;  2CW0 F; 
#chains in the Genus database with same CATH homology
 3PMR A;  2HV7 A;  4CS8 A;  4YN0 B;  3S27 A;  3KH2 A;  4O7G A;  3DM5 A;  3KL4 A;  5KYW A;  3EFO B;  1M2O A;  3SNH A;  2WB7 A;  3JCU Q;  1D0X A;  4IJJ A;  1VYI A;  4YWQ A;  2EIM C;  2C03 A;  4KNV A;  4YJW A;  3UMH A;  3DJN B;  4JCH A;  4OIO F;  4LLE A;  3E70 C;  3UNG C;  4BJ6 A;  4YT2 A;  3EGX B;  2FFH A;  4JW1 A;  2DYS C;  3NYJ A;  5EGY A;  2XSE A;  3B0V C;  1Z63 A;  2PP4 A;  4LLC A;  2EIJ C;  3KMI A;  3LJB A;  4C7O B;  2I8B A;  2ZPA A;  2CGE A;  2MYS A;  1TKN A;  2QY9 A;  3JSZ A;  3KKB A;  4K7B A;  2WZG A;  4HEA J;  1BR1 A;  3N24 A;  2NUP B;  1TWC A;  4E7Z A;  2QTV A;  3W8H A;  3JT1 A;  2R7W A;  1OCO C;  3E9V A;  2KQ9 A;  4U5B E;  4DVY P;  1OKK D;  4JZA A;  1RJ9 A;  4U5E E;  4GYT A;  1MMA A;  5HSW A;  5E3C A;  4EWC A;  5L3Q A;  1PD0 A;  3CQZ A;  2DGJ A;  2IXM A;  3NRH A;  4CS9 C;  2D5R B;  4O79 A;  3SZR A;  3RYL A;  2O9X A;  3O6X A;  5E33 A;  3MLG A;  3X1O A;  4YT8 A;  2WVN A;  2A69 F;  3OWT A;  2H7V C;  2C04 A;  1LVK A;  1TWG A;  3EH2 A;  3T6B A;  3UGP A;  4I44 A;  2WZL A;  2ZXP A;  4OIN F;  2MWQ A;  5KYU B;  5EHH A;  1ST6 A;  2L9J A;  2IXO A;  5E3A A;  2KGO A;  3DD7 A;  3TD7 A;  3JYH A;  4CIH A;  2YZS A;  4O6N A;  3EFO A;  3LNR A;  2KJG A;  4RD9 A;  3EHM A;  3DJU B;  2XRH A;  1S7Z A;  3EGD B;  1OKK A;  4IRU A;  2J0X A;  3WOD F;  2XXA A;  2Q9A A;  3GAN A;  1ZU4 A;  2J9W A;  4CS7 A;  5E2Q A;  2V26 A;  2Y3B A;  1TR2 A;  3V7O A;  4I3M A;  1MMN A;  2CDQ A;  3B0P A;  1FMW A;  2YHS A;  4O6M A;  3EHN A;  2G3V A;  4EBB A;  3ABK C;  3DAG A;  2Y69 C;  4C7O A;  3W8I A;  4N06 A;  3VAY A;  3K6B A;  3ITF A;  3L0I A;  2JD3 A;  3DAF A;  4CSA C;  4KC9 A;  2NUP A;  3NDB B;  2R7T A;  4MQ9 F;  4ZLD A;  4JJF A;  4G7Z F;  1WGW A;  3X2Q C;  2ZXR A;  4J30 B;  5F5F A;  3T4R A;  2ZXO A;  3F46 A;  4XLP F;  4CBE A;  3K1I C;  4IWB A;  4GEH A;  2R7X A;  4KNW A;  4DBR A;  3AG3 C;  2XXA B;  1Z3I X;  2WVO A;  2BE5 F;  4ULW A;  5D91 A;  3QZC A;  4C3B A;  4DVZ A;  3GOD A;  1MNE A;  3K66 A;  4FWV A;  2DYR C;  2WZF A;  2IXN A;  3LAY A;  3M1C B;  1KU2 A;  3HLZ A;  2WVQ A;  4Q5S F;  3HTK C;  4OIP F;  3AQC A;  3L34 A;  3UMI A;  4PJJ A;  3AG1 C;  4E7S A;  4Q7C A;  2Z15 A;  5KYU A;  1M56 C;  3SP1 A;  4B6I A;  4HFK B;  1ZHX A;  1ZHW A;  2EIN C;  3S0X A;  4FES A;  5D92 A;  3RKO F;  4F4B A;  1FFH A;  2W4B A;  3LES A;  2W45 A;  3ASN C;  3Q6M A;  3RFY A;  4CSA A;  3UMK A;  2PFD A;  3EGD A;  1MMD A;  1NG1 A;  3EJN A;  2H7O A;  1ZHZ A;  4K0D A;  5L3V A;  4G7O F;  3AG2 C;  2Q3T A;  3AQB A;  5DQZ A;  2EIL C;  3LEV A;  4YT4 A;  3JRT A;  2HV6 A;  1NZE A;  4U5G A;  1OCZ C;  4LER A;  4U5D E;  3NYM A;  1Z6A A;  4XLN F;  2Y3D A;  3NKD A;  1J8Y F;  4HE8 D;  2L81 A;  3UGO A;  3LLI A;  3ZIB A;  4JUR I;  2OCC C;  3OA1 A;  1G8X A;  1O87 A;  5B1A C;  1MMG A;  4PJM A;  3Q7G A;  4A2N B;  1MND A;  1O5H A;  3Q6N A;  4ZLC A;  4JVS A;  1PD1 A;  2P6V A;  1J8M F;  3EG9 B;  3ABL C;  1SZI A;  3T6J A;  3WG7 C;  2A1D D;  3NKE A;  2GFH A;  3EZH A;  1JPJ A;  3K1H A;  3N2Z B;  5KYX B;  5CI9 A;  3FAJ A;  4BJ6 C;  2Y3H A;  1BR4 A;  4NY3 A;  1ZHT A;  3ZSU A;  4OD5 A;  1Z5Z A;  3ABM C;  4PFP A;  1QZX A;  2J9V A;  1ZU5 A;  4AX2 A;  1TWH A;  1NU7 D;  3H65 A;  4CS9 A;  3FVY A;  2G3K A;  4H4K C;  3EQL F;  3B0U X;  1LS1 A;  2CNW D;  3CZ6 A;  5KYN A;  3N0T A;  3EH1 A;  1TWA A;  3LS1 A;  4PFO A;  2E87 A;  4XTK A;  1NU9 C;  2IOQ A;  3W2V A;  5DVW A;  2A6E F;  1ZHY A;  2LSE A;  5IY5 C;  5DLJ A;  3NG1 A;  1IZM A;  1Z23 A;  4BJT A;  3ZVR A;  1SF8 A;  5CI8 A;  1ZYR F;  3AG4 C;  4OD4 A;  1D1C A;  2NUT B;  1W2W A;  4DOZ A;  2KW3 C;  3O39 A;  5KYY B;  4QI0 A;  1M57 C;  3DM9 B;  3ZG1 A;  1VK5 A;  2V3C C;  3NYL A;  2J7P D;  4C3E A;  3FDQ A;  1OCC C;  1VOM A;  1JPN A;  2VB6 A;  4QI2 A;  1FFT C;  1N1C A;  4O6Y A;  2VAS A;  4X0R A;  3SYN A;  3K33 A;  5BUO A;  2R7R A;  2IYL D;  2R7U A;  2EIK C;  4HFF B;  1M2V B;  3PHF 2;  3F47 A;  1PCX A;  4DBQ A;  2P7V A;  2CNW A;  2XL4 A;  3LS0 A;  4PK4 A;  5DS5 A;  1FTS A;  3VYW A;  3FHD A;  4KBL A;  3S29 A;  3ZC4 A;  2J46 A;  5T3T A;  3CSK A;  4JJG A;  4U5H A;  2J0W A;  1FMV A;  4J32 B;  2Y3G A;  3EG9 A;  4U5F E;  3DXJ F;  4Q4Z F;  5F5H A;  4BG0 A;  2PX3 A;  4OIQ F;  3DMD A;  1QLE C;  4KI2 A;  2X51 A;  5KYX A;  4ANJ A;  4LAC B;  4RBN A;  2G62 A;  5KYW B;  2WL8 A;  2YEV A;  4IAO A;  4PJL A;  4AE4 A;  1D0Z A;  4BJ5 C;  4G7H F;  4OIR F;  3I5Q A;  5DQT A;  3OEO A;  4MND A;  4BEJ A;  3EZI A;  2J7P A;  4QDL A;  1V55 C;  3I5P A;  2KNH A;  2R7V A;  1SMY F;  1D1B A;  4I1M A;  4CS8 C;  3LLK A;  2NG1 A;  1VYK A;  3K7D A;  4AK9 A;  2PX0 A;  3ASO C;  4I1O B;  2R7O A;  2Q9C A;  4C3D A;  3UR3 C;  4WJ0 A;  2A6H F;  2A68 F;  2W4M A;  5B1B C;  3S28 A;  2OG2 A;  5T3W A;  2Y39 A;  2PF4 E;  5B3S C;  4PJN A;  2NUT A;  3I4U A;  1LKX A;  2W9Y A;  4AE4 B;  4YT5 A;  5KYY A;  2Q9B A;  3RH3 A;  1RJ9 B;  3B9Q A;  4BJ1 A;  5FCL A;  4P6I C;  2VH3 A;  2J9U A;  1OCR C;  2ZXW C;  2R7S A;  1D1A A;  3ECS A;  4G0H A;  1V54 C;  3MX3 A;  5DS6 A;  4FX5 A;  2J45 A;  5T1D B;  2R7Q A;  1IW7 F;  3W2W A;  4W8K A;  5DS4 A;  1M2V A;  3EGX A;  2H7B A;  4XWJ A;  4M63 A;  4RDA A;  3EPV A;  2M4E A;  4U5C E;  4BJ5 A;  3POV A;  2IXP A;  3HJC A;  3Q7L A;  3SEO A;  3DZA A;  3RIP A;  2B0J A;  2FGY A;  3QMK A;  1VMA A;  1BR2 A;  3IEE A;  1D0Y A;  2CW0 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...