2KGOA

Solution nmr structure of zn finger protein ybil from escherichia coli. nesg target et107, ocsp target ec0402
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
MASGWANDDAVNEQINSTIEDAIARARGEIPRGESLDECEECGAPIPQARREAIPGVRLCIHCQQEKDLQKPAYTGYNRRGSKDSQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ybiI
publication title Zn-finger protein YBIL from E. coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01258 zf-dskA_traR Prokaryotic dksA/traR C4-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kgoA01
4IJJA 2KQ9A 2KGOA
chains in the Genus database with same CATH superfamily
1LI5A 2EINC 3DAFA 4E7ZA 5A6JA 2HV6A 2J7PA 3RVZA 3W4YA 4BJ5A 2J8WA 3M15A 4DBRA 1T6UA 5EHHA 3ZSUA 3JTLO 3ZVRA 4DXWA 2IXPA 3F46A 3M4CA 4KBLA 5GPGB 3TULA 1FFTC 3GEIA 1YZCA 3C8GA 4OIOF 3JYHA 4EBJA 3ITFA 1CPRA 3IHUA 1PCXA 1K05A 3C7JA 2HKVA 5KYUA 4D4NA 2R7RA 1EA8A 3E70C 3EFOA 2R9RB 3I4UA 5DQZA 2NUPB 4DRIB 5EGYA 1ZHYA 4AE4A 1GM5A 1DOWA 5KYWB 1LS1A 1OR2A 2L7AA 2ETSA 2W9YA 4EIYA 3L8IA 1O87A 5A6AA 2HV7A 2WVNA 2J9VA 1QQ3A 3GODA 1TWCA 1MMGA 1HW2A 3EPVA 3U2MA 1M6TA 3AJMA 4X0RA 3B9QA 3JRMO 5AC4A 4C3EA 2QLAA 1H7IA 2DYSC 2EPMX 2ZPAA 4FX5A 2EPNA 3RQFA 3UMHA 1BZ4A 256BA 3B0VC 3T4RA 2Y3DA 3FDQA 1TQGA 2IXMA 1XZQA 2O9XA 3EQLF 3GEEA 3L8JA 3SP1A 3POVA 4D4XA 1RJ9B 2XS1A 5B1AC 2NSFA 2QTVA 1E2XA 3F47A 2WZGA 5COFA 2NPUA 1SYQA 2CYDA 3S27A 5L0HA 3IPMO 3B71A 3FVYA 2G62A 3HNJA 3HNLA 1D1CA 4O6YA 3AG1C 3LS1A 4EWCA 1E85A 2XSEA 4J7TA 1MNDA 5KYXA 4NTFA 1EI7A 2HFIA 3C8GB 4A2NB 3N2ZB 3TK0A 1Y4CA 4QI2A 3NRHA 4MNDA 3T6GB 2H7VC 1K40A 2HSQA 4JE9A 4PJLA 1YYXA 3RW0A 3U9MA 3EFOB 1LE2A 3B0PA 3NYLA 3S90A 4YJWA 1LVKA 3MX3A 3MFNA 3RKOF 1L3PA 2QUPA 5T3TA 4AE4B 1J8MF 1U6HA 2XXAB 1I5NA 4MVRA 2H7BA 2YQYA 4MW3A 4CIPA 1Q0FA 1R4TA 3N24A 2FGYA 4OIRF 1GQAA 3ZTZA 2EPLX 1G5ZA 4EBBA 2W45A 1HMOA 2IBFA 1NU7D 4W8KA 1Z6AA 3EZHA 4E7SA 4XQ1A 4E0HA 2OQMA 3QMKA 4NCQA 1VYIA 4C3DA 5K0IA 2R7SA 2MYSA 2YLDA 4K7BA 5BQGA 3MBGA 2KJGA 5TJ5E 3ASNC 1RMVA 1Z23A 2JX0A 3EG9B 4MVMA 1TWAA 4JJGA 4CSAA 2I8BA 3FMSA 1JAFA 4AK9A 4A4AA 4EKWA 4CS8A 2CNWD 4E0IA 5FCLA 2VCBA 3ECSA 2Y3HA 1LM3B 1NZEA 2WZFA 3QZCA 2AVKA 3QVYA 1T6IA 3KYIA 2KQ9A 1YARO 1D1AA 4O6MA 2M64A 1YA9A 2V3CC 3RYLA 2VH3A 4JKVA 4CS7A 1APCA 4WGYA 2L9JA 3ZC4A 3AOUA 4C7OA 4JCHA 1JOGA 3ZIBA 1RKEB 2Y3BA 4BJ6A 1BR4A 1ZW3A 2Q3TA 4ANJA 3M1CB 2L81A 2R25A 3NYMA 3TD7A 4HFFB 3NYJA 2P1AA 4OD4A 1V4AA 2NUPA 1VOMA 3LNMB 4XWJA 1CGNA 1KNYA 5KYWA 1OXKA 3ZTMA 1OXBA 2CNWA 2A68F 4YT4A 3U9JA 5L0FA 2R05A 2EILC 1E83A 3NMKA 4J32B 3GANA 2AWYA 4NQFA 3SXZA 3R2PA 1Z63A 1YZAA 3H2UA 2BC5A 4MW8A 4N6HA 2A6HF 1OQCA 1V55C 1WASA 1TWHA 2JPUA 3KH2A 4J7YA 1R5ID 3RVYA 5DS6A 2AP3A 3TOMA 4WABA 4M63A 1L7CA 2VCAA 3GWLA 4JTCB 2A6EF 3S9OA 3T6BA 3SXKA 4C3BA 3V5YA 1M57C 1SZIA 2LIGA 5D92A 3L34A 4JIOA 3DKAA 1S7ZA 4GEHA 4EBKA 1JR8A 3ZQYA 4CBEA 3IQ6A 1RJ9A 2C04A 2ZXPA 4I1OB 4KI2A 3K7DA 3Q7LA 1MNEA 2J9BA 1NFNA 4P9FA 3FAJA 2X0CA 5L0IA 2Y69C 2Q9BA 4U5DE 4XEFA 2QY9A 2Q9AA 3M79A 4O7GA 4U5EE 1OKKD 5E2QA 3DE8A 4XLNF 1YLMA 4G7OF 4CS9C 4CDAA 2D5RB 5JP7A 2LCHA 3S28A 2HZ8A 1VLSA 3LAYA 3U0CA 1JPJA 3W8HA 4C7OB 4WJ0A 4I1MA 3DWWA 2PX0A 2LFFA 3FXHA 2XLWA 4MVOA 1E86A 2LD6A 4U9EA 2KSFA 4PFPA 5F5FA 1OR3A 1ORYA 1H6GA 1EQ1A 2YKZA 4MVSA 4DRJB 2XLEA 2LSEA 1QSPA 2G3VA 3AQCA 4DVYP 3B0UX 4OIPF 3LJBA 3HTKC 4BPMA 5KYNA 2XXAA 2R7QA 3O6XA 2R7WA 2W4BA 3PMRA 3L1MA 4LDQA 3EGDB 3NG1A 3IQTA 3HKKA 3U8PA 3O55A 3TJ5A 2CCYA 4MVQA 1FR0A 2ZXRA 3RQEA 5DQTA 1AVOB 1ZVZA 2EIKC 5L0CA 3DM9B 4IARA 1RXQA 4YL3A 3W2VA 2GFHA 1ZHZA 2J9UA 2Y39A 2BE5F 3PDMP 3WG7C 1AUEA 1EKYA 1JPNA 1ZHTA 1VLTA 2GWWA 2KNHA 3EZIA 3IQCA 4OD5A 5F28E 3UGOA 2LQGA 1Q0MA 3HNIA 3KL4A 3OWTA 4IWBA 3I5PA 2Q7RA 2PBEA 1O3UA 1SR2A 5CI8A 3EG9A 1D0XA 4JJFA 4NY3A 4R32A 3U3BA 4AL1A 1WGWA 3M4BA 2L6HA 1YAUO 1WWPA 3K1IC 4BJ5C 2XM0A 3DM5A 3E9VA 4U5BE 4U5FE 4HE8D 2CW0F 2Q9CA 3CEXA 2BL2A 4KNWA 2PP4A 1V74B 4DJ9A 3TJ6A 1A7VA 3B29A 1V54C 1OW8A 1VMAA 3UNGC 3AG3C 1OCRC 4BJ1A 2XLMA 1GS9A 3VYWA 5BQIA 2YL3A 4XEKA 1ST6A 4WGZA 4Z9IA 3O39A 2GAQA 1RCPA 4YL0A 4LERA 3V5XA 5CIVA 1RKEA 4DRHB 3IQ5A 2P7VA 3Q6MA 4IB4A 1ORJA 2LK4A 1A0BA 1CGOA 3MYFA 5FZTA 1JRAA 2GA0A 3QW1A 4IJJA 4PACA 3AG4C 1I4ZA 3SNHA 4LDRA 2OU6A 3UMIA 4CJGA 2YZSA 1N1CA 1AEPA 2XL6A 3JCUQ 1BR1A 3HLZA 4AX2A 3UGPA 5L0GA 1ORSC 1JMWA 3SYNA 4ULVA 3LLIA 1QVXA 2P61A 3Q6NA 4LACB 4NTAA 3K66A 1LS4A 1LIHA 2YL7A 3Q7GA 4LDKA 4LLEA 2ASRA 4JZAA 4JTDB 1H9GA 3BEHA 3NMJA 2FAPB 1ZW2A 2AU5A 2MWQA 2VB6A 3HNKA 4DVZA 2A0UA 1Q0KA 4YT5A 4XPWA 1QKRA 3DAGA 3K1HA 1OCCC 2HJ3A 3KMIA 1TWGA 2XM4A 3CAXA 4RBNA 1WTYA 3VRCA 1Y6DA 2R7UA 4G0HA 5L3QA 4KC9A 4CDVA 1MMDA 1GGQA 1T9KA 1TR2A 2J0WA 5KYYB 2R02A 1QLEC 2A1DD 3C63A 3EHMA 2XL4A 3ZDLA 1Z5ZA 2EPKX 3ABLC 5COMA 5DVWA 3EGXA 3AGTA 3G50A 4UDVA 4JEBA 1YA7O 5T1DB 4JTAB 4QDLA 3EH1A 2MHRA 3GEHA 1C02A 4CX9A 5BUOA 2IYLD 4MTOA 4U9DA 1E84A 1A7EA 1OW7A 4MQ9F 4ZLDA 4NC3A 1HE1A 3T6JA 2NUTB 3VF0A 4MS2A 1ZHWA 3S0XA 3S84A 4B6IA 1VK5A 1QZXA 4FWVA 2ZXOA 3EGDA 3GM3A 2B0HA 4XTKA 4XLPF 4HFKB 5COGA 2KC3A 4RD9A 1Q0GA 1D0ZA 1SF8A 4Z9JA 1T01A 2HS5A 4PJMA 1G8XA 4MTFA 2VCCA 2P6VA 4H54A 4OINF 5HSWA 2WZLA 5L0JA 3GORA 1FMVA 1ZZPA 2OJED 2Q00A 3C8ZA 3DZAA 1UG7A 2F22A 3JRTA 1FNTc 4OIQF 4I44A 4YK5A 5JUAA 2Y3GA 4NTBA 4JVSA 5A6BD 1G4US 1U89A 2J46A 2VC9A 4P6IC 4IRUA 1WATA 2IOQA 3LESA 3R7CA 1I4YA 5EK0A 4MVZA 5E3CA 2J7PD 2YHSA 3FOOA 1UFBA 2VASA 3NKDA 3AQBA 2XRHA 2XLOA 3AG2C 3RF3A 4MVUA 3C18A 1FFHA 2PF4E 5A69A 4W8PA 1MMNA 3DMDA 3EGXB 1HY5A 1MQVA 1M2OA 4O6NA 2Z15A 3RH3A 4KNVA 3NMIA 3LS0A 2GDCA 4I3MA 5E33A 1K04A 4P9TA 5DLJA 1PD1A 2XLDA 1M56C 5A6BA 2R7TA 2NG1A 1NU9C 3EH2A 2ZXWC 1M2VB 1YJGA 2E87A 2I15A 4Q7CA 2TMVP 3GWNA 2R7OA 3L0IA 4YWQA 3RIPA 1HW1A 2WVQA 2YRFA 2PNOA 4CS9A 1T6QA 4IAOA 4CDYA 4XPYA 5AGFA 2JD3A 2LP4A 2PFDA 3JT1A 2YLGA 3JSEO 4FESA 4XEVA 1OKKA 3US6A 2J0XA 4AL0A 4U5GA 1IZMA 2R7XA 4K1OA 3VM6A 3FAPB 1XWJA 4LLCA 3ABMC 4Z9HA 4BEJA 1KU2A 3FHDA 5JS5A 3V7OA 3QVZA 3SXMA 4ER9A 3WODF 2CDQA 2R03A 3G4XA 3IEEA 2DYRC 1RKCA 1YYJA 5BQHA 4RDAA 4EUKB 5AC5A 4BEMJ 1LKXA 1ZYRF 3W8IA 4G7HF 4O79A 5F5HA 3UR3C 2YWAA 2X51A 2OCCC 4BG0A 1QPUA 1ZU4A 3GM1A 3JSZA 4YN0B 1LE4A 3W2WA 2H8AA 1NFOA 4PFOA 3RFYA 3H2VA 4Q5SF 5DS4A 4PJJA 1O5HA 4U5HA 4L6RA 5D91A 5JLIA 3LUTB 2PX3A 2YL1A 2HUJA 2NSGA 4JRZA 3JZ0A 4EHPA 2R7VA 1XZPA 5JSLA 5KYYA 1VTMP 3LEOA 4DOZA 4E17A 4FAPB 4JW1A 4YL1A 3T9OA 4U5CE 2J9WA 3ABKC 3K1IA 1NG1A 1HE9A 5L3VA 4Q4ZF 1C03A 4ULWA 5JVEA 2YEVA 1W2WA 1FAPB 5JT4A 2NUTA 1NSGB 2RSEB 2YL0A 5L0DA 5T3WA 3CQZA 4GYTA 5CI9A 4K0DA 2KGOA 2KYHA 2YVKA 3KYJA 1T5OA 2EPOA 3NKEA 3U5SA 4H4KC 4XPXA 2UUIA 1OCZC 3ZQVA 4J30B 2B0JA 2L6GA 5DS5A 3LLKA 5E3AA 3U2LA 1B68A 3MLGA 5A6KA 2EIJC 4F4BA 5KYUB 2H7OA 5HV9A 3U8VA 4YT2A 1PD0A 5B3SC 4GQHA 2FFHA 3A9CA 2WL8A 3J06A 2J45A 5B1BC 3DJUB 2W4MA 3H65A 4N6CA 1BR2A 1FTSA 3NDBB 2IM8A 4N4WA 1NLXA 3EHNA 1YVIA 2L6FA 3DXJF 3GM2A 1NBBA 4JCZA 4PJNA 3SZRA 3ZG1A 1PV3A 1Z3IX 2Q4FA 1FMWA 2OKUA 4PK4A 2V26A 4CSAC 1U0BB 2HMQA 4ZLCA 3V5ZA 1TKNA 4JC7A 3CZ6A 4CS8C 2WVOA 3WHNA 2QE9A 1LI7A 1TFOB 2OG2A 2EIMC 3N0TA 3O10A 4HEAJ 3I5QA 1OW6A 4G78A 1Q0DA 2KK1A 2AWCA 3G4ZA 2IXNA 1C17M 3QW0A 2C03A 1M2VA 2OOCA 2M4EA 2P0NA 3A11A 5JRAA 1SMYF 3U3FA 2DI3A 2ICWG 2G3KA 1WN0A 3PCVA 4BJ6C 4ONSA 3TQOA 1D1BA 1TFKB 2A0BA 2OJQA 2QNLA 4N06A 2XS8A 3DD7A 4DBQA 3ZWIA 3DI5A 4BJTA 4CIHA 4G7ZF 4MTGA 1ZHXA 3LEVA 3ATPA 5KYXB 1S05A 2IXOA 1ZU5A 3HJCA 1OCOC 1G4WR 3AGUA 3VAYA 3X1OA 3C62A 3S29A 3ASOC 2DB4A 1A7DA 2HSBA 3SEOA 4JEAA 3MYIA 1CGME 1BBHA 4QI0A 2HJMA 1F1MA 1BDJB 3OEOA 3FOPA 3X2QC 4JURI 1VB5A 2RD9A 1LPEA 3K33A 1Z7Qc 2OEXA 2XL8A 3BRJA 3RQGA 1IW7F 4E18A 2WB7A 3EJNA 1H9TA 1D0YA 2YLIA 2ZD9A 3PHF2 3KKBA 3CSKA 4YT8A 2DGJA 4IGGA 1CPQA 4CJOA 2UUHA 3WAQA 4PR9A 3LNRA 1A41A 5IY5C 3K6BA 3TOLA 2A69F 1HMDA 3C8GD 3QTHA 2CGEA 3UMKA 2KW3C 5B3IA 1KTMA 3DJNB 3KPHA 2XLVA 3SXYA 1J8YF 1MMAA 1WOLA 2LFDA 1DOVA 2XLHA 4IAQA 2HMZA 2OEVA 3JYYA 1YDIA 2D4UA 3DE9A 1VYKA 3OA1A
chains in the Genus database with same CATH topology
2EINC 3DAFA 4E7ZA 2HV6A 2J7PA 4BJ5A 4DBRA 5EHHA 3ZSUA 3ZVRA 2IXPA 3F46A 4KBLA 1FFTC 4OIOF 3JYHA 3ITFA 1PCXA 5KYUA 2R7RA 3E70C 3EFOA 3I4UA 5DQZA 2NUPB 5EGYA 1ZHYA 4AE4A 5KYWB 1LS1A 2W9YA 1O87A 2HV7A 2WVNA 2J9VA 3GODA 1TWCA 1MMGA 4X0RA 3B9QA 4C3EA 4FX5A 2DYSC 2ZPAA 3UMHA 3B0VC 3T4RA 2Y3DA 3FDQA 2IXMA 2O9XA 3EQLF 3SP1A 3POVA 1RJ9B 5B1AC 2QTVA 3F47A 2WZGA 3S27A 3FVYA 2G62A 1D1CA 4O6YA 3AG1C 3LS1A 4EWCA 2XSEA 1MNDA 5KYXA 4A2NB 3N2ZB 4QI2A 3NRHA 4MNDA 2H7VC 4PJLA 3EFOB 3B0PA 3NYLA 4YJWA 1LVKA 3MX3A 3RKOF 5T3TA 4AE4B 1J8MF 2XXAB 2H7BA 3N24A 2FGYA 4OIRF 4EBBA 2W45A 1NU7D 4W8KA 1Z6AA 3EZHA 4E7SA 3QMKA 1VYIA 4C3DA 2R7SA 2MYSA 4K7BA 2KJGA 3ASNC 1Z23A 3EG9B 1TWAA 4JJGA 4CSAA 2I8BA 4AK9A 4CS8A 2CNWD 5FCLA 3ECSA 2Y3HA 1NZEA 2WZFA 3QZCA 4O6MA 2KQ9A 1D1AA 2V3CC 3RYLA 2VH3A 4CS7A 2L9JA 3ZC4A 4C7OA 4JCHA 3ZIBA 2Y3BA 4BJ6A 1BR4A 2Q3TA 4ANJA 3M1CB 2L81A 3NYMA 3TD7A 4HFFB 3NYJA 4OD4A 2NUPA 1VOMA 4XWJA 5KYWA 2CNWA 2A68F 4YT4A 2EILC 4J32B 3GANA 1Z63A 2A6HF 1V55C 3KH2A 1TWHA 5DS6A 4M63A 2A6EF 3T6BA 4C3BA 1M57C 1SZIA 5D92A 3L34A 1S7ZA 4GEHA 4CBEA 4KI2A 1RJ9A 2C04A 2ZXPA 4I1OB 3K7DA 3Q7LA 1MNEA 3FAJA 2Y69C 2Q9BA 4U5DE 5E2QA 2QY9A 2Q9AA 4O7GA 4U5EE 4G7OF 1OKKD 4XLNF 4CS9C 2D5RB 3S28A 3LAYA 1JPJA 3W8HA 4C7OB 4WJ0A 4I1MA 2PX0A 4PFPA 5F5FA 2LSEA 2G3VA 3AQCA 4DVYP 3B0UX 4OIPF 3LJBA 3HTKC 2XXAA 5KYNA 2R7QA 3O6XA 2R7WA 2W4BA 3PMRA 3EGDB 3NG1A 2ZXRA 5DQTA 2EIKC 3DM9B 3W2VA 2GFHA 1ZHZA 2J9UA 2Y39A 2BE5F 3WG7C 1JPNA 1ZHTA 3EZIA 2KNHA 4OD5A 3UGOA 3KL4A 3OWTA 4IWBA 3I5PA 5CI8A 3EG9A 1D0XA 4JJFA 4NY3A 1WGWA 3K1IC 3E9VA 3DM5A 4U5FE 4U5BE 4HE8D 2CW0F 2Q9CA 4KNWA 2PP4A 1V54C 1VMAA 3UNGC 3AG3C 1OCRC 4BJ1A 3VYWA 1ST6A 3O39A 4LERA 2P7VA 3Q6MA 4IJJA 3UMIA 3SNHA 3AG4C 2YZSA 1N1CA 3JCUQ 1BR1A 3HLZA 4AX2A 3UGPA 3SYNA 3LLIA 4LACB 3Q6NA 3K66A 3Q7GA 4LLEA 4JZAA 2MWQA 2VB6A 4DVZA 4YT5A 3K1HA 3DAGA 1OCCC 3KMIA 1TWGA 4RBNA 2R7UA 4G0HA 5L3QA 4KC9A 1MMDA 1TR2A 2J0WA 5KYYB 1QLEC 2A1DD 3EHMA 2XL4A 1Z5ZA 3ABLC 5DVWA 3EGXA 5T1DB 4QDLA 3EH1A 5BUOA 2IYLD 4MQ9F 4ZLDA 3S0XA 3T6JA 2NUTB 1ZHWA 4B6IA 1VK5A 1QZXA 4FWVA 2ZXOA 3EGDA 4XLPF 4XTKA 4HFKB 4RD9A 1D0ZA 1SF8A 4PJMA 1G8XA 2P6VA 4OINF 5HSWA 2WZLA 1FMVA 4OIQF 3DZAA 3JRTA 4I44A 2Y3GA 4JVSA 2J46A 4P6IC 4IRUA 2IOQA 3LESA 5E3CA 2J7PD 2YHSA 2VASA 3NKDA 3AQBA 2XRHA 3AG2C 1FFHA 2PF4E 1MMNA 3DMDA 3EGXB 4O6NA 4BJ5C 1M2OA 3RH3A 2Z15A 4KNVA 3LS0A 4I3MA 5E33A 5DLJA 2R7TA 1PD1A 1M56C 2NG1A 1NU9C 3EH2A 2ZXWC 1M2VB 2E87A 4Q7CA 3L0IA 2R7OA 4YWQA 3RIPA 2WVQA 4CS9A 4IAOA 2JD3A 2PFDA 3JT1A 4FESA 1OKKA 2J0XA 2R7XA 4U5GA 1IZMA 4LLCA 3ABMC 4BEJA 1KU2A 3FHDA 3V7OA 3WODF 2CDQA 3IEEA 2DYRC 4RDAA 1LKXA 1ZYRF 3W8IA 4G7HF 4O79A 5F5HA 3UR3C 2X51A 2OCCC 4BG0A 1ZU4A 4YN0B 3JSZA 3W2WA 4PFOA 4Q5SF 3RFYA 5DS4A 4PJJA 1O5HA 4U5HA 5D91A 2PX3A 2R7VA 5KYYA 4DOZA 4JW1A 4U5CE 2J9WA 3ABKC 1NG1A 5L3VA 4Q4ZF 4ULWA 2YEVA 1W2WA 2NUTA 5T3WA 3CQZA 4GYTA 5CI9A 4K0DA 2KGOA 3NKEA 4H4KC 1OCZC 4J30B 2B0JA 5DS5A 3LLKA 5E3AA 3MLGA 2EIJC 4F4BA 5KYUB 2H7OA 4YT2A 5B3SC 1PD0A 2FFHA 2WL8A 2J45A 5B1BC 3DJUB 2W4MA 3H65A 3NDBB 1BR2A 1FTSA 3EHNA 3DXJF 3SZRA 4PJNA 3ZG1A 1Z3IX 1FMWA 4PK4A 2V26A 4CSAC 4ZLCA 1TKNA 3CZ6A 4CS8C 2WVOA 3N0TA 2OG2A 2EIMC 4HEAJ 3I5QA 2IXNA 2C03A 1M2VA 2M4EA 1SMYF 2G3KA 4BJ6C 1D1BA 4DBQA 4N06A 3DD7A 4BJTA 4CIHA 4G7ZF 1ZHXA 3LEVA 5KYXB 2IXOA 1ZU5A 3HJCA 1OCOC 3VAYA 3X1OA 3S29A 3ASOC 3SEOA 4QI0A 3OEOA 3X2QC 4JURI 3K33A 1IW7F 2WB7A 3EJNA 1D0YA 3PHF2 3KKBA 3CSKA 4YT8A 2DGJA 5IY5C 3LNRA 3K6BA 2A69F 3UMKA 2CGEA 2KW3C 3DJNB 1J8YF 1MMAA 3EPVA 1VYKA 3OA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJJ A;  2KQ9 A;  2KGO A; 
#chains in the Genus database with same CATH topology
 1LI5 A;  2EIN C;  3DAF A;  4E7Z A;  5A6J A;  2HV6 A;  2J7P A;  3RVZ A;  3W4Y A;  4BJ5 A;  2J8W A;  3M15 A;  4DBR A;  1T6U A;  5EHH A;  3ZSU A;  3JTL O;  3ZVR A;  4DXW A;  2IXP A;  3F46 A;  3M4C A;  4KBL A;  5GPG B;  3TUL A;  1FFT C;  3GEI A;  1YZC A;  3C8G A;  4OIO F;  3JYH A;  4EBJ A;  3ITF A;  1CPR A;  3IHU A;  1PCX A;  1K05 A;  3C7J A;  2HKV A;  5KYU A;  4D4N A;  2R7R A;  1EA8 A;  3E70 C;  3EFO A;  2R9R B;  3I4U A;  5DQZ A;  2NUP B;  4DRI B;  5EGY A;  1ZHY A;  4AE4 A;  1GM5 A;  1DOW A;  5KYW B;  1LS1 A;  1OR2 A;  2L7A A;  2ETS A;  2W9Y A;  4EIY A;  3L8I A;  1O87 A;  5A6A A;  2HV7 A;  2WVN A;  2J9V A;  1QQ3 A;  3GOD A;  1TWC A;  1MMG A;  1HW2 A;  3EPV A;  3U2M A;  1M6T A;  3AJM A;  4X0R A;  3B9Q A;  3JRM O;  5AC4 A;  4C3E A;  2QLA A;  1H7I A;  2DYS C;  2EPM X;  2ZPA A;  4FX5 A;  2EPN A;  3RQF A;  3UMH A;  1BZ4 A;  256B A;  3B0V C;  3T4R A;  2Y3D A;  3FDQ A;  1TQG A;  2IXM A;  1XZQ A;  2O9X A;  3EQL F;  3GEE A;  3L8J A;  3SP1 A;  3POV A;  4D4X A;  1RJ9 B;  2XS1 A;  5B1A C;  2NSF A;  2QTV A;  1E2X A;  3F47 A;  2WZG A;  5COF A;  2NPU A;  1SYQ A;  2CYD A;  3S27 A;  5L0H A;  3IPM O;  3B71 A;  3FVY A;  2G62 A;  3HNJ A;  3HNL A;  1D1C A;  4O6Y A;  3AG1 C;  3LS1 A;  4EWC A;  1E85 A;  2XSE A;  4J7T A;  1MND A;  5KYX A;  4NTF A;  1EI7 A;  2HFI A;  3C8G B;  4A2N B;  3N2Z B;  3TK0 A;  1Y4C A;  4QI2 A;  3NRH A;  4MND A;  3T6G B;  2H7V C;  1K40 A;  2HSQ A;  4JE9 A;  4PJL A;  1YYX A;  3RW0 A;  3U9M A;  3EFO B;  1LE2 A;  3B0P A;  3NYL A;  3S90 A;  4YJW A;  1LVK A;  3MX3 A;  3MFN A;  3RKO F;  1L3P A;  2QUP A;  5T3T A;  4AE4 B;  1J8M F;  1U6H A;  2XXA B;  1I5N A;  4MVR A;  2H7B A;  2YQY A;  4MW3 A;  4CIP A;  1Q0F A;  1R4T A;  3N24 A;  2FGY A;  4OIR F;  1GQA A;  3ZTZ A;  2EPL X;  1G5Z A;  4EBB A;  2W45 A;  1HMO A;  2IBF A;  1NU7 D;  4W8K A;  1Z6A A;  3EZH A;  4E7S A;  4XQ1 A;  4E0H A;  2OQM A;  3QMK A;  4NCQ A;  1VYI A;  4C3D A;  5K0I A;  2R7S A;  2MYS A;  2YLD A;  4K7B A;  5BQG A;  3MBG A;  2KJG A;  5TJ5 E;  3ASN C;  1RMV A;  1Z23 A;  2JX0 A;  3EG9 B;  4MVM A;  1TWA A;  4JJG A;  4CSA A;  2I8B A;  3FMS A;  1JAF A;  4AK9 A;  4A4A A;  4EKW A;  4CS8 A;  2CNW D;  4E0I A;  5FCL A;  2VCB A;  3ECS A;  2Y3H A;  1LM3 B;  1NZE A;  2WZF A;  3QZC A;  2AVK A;  3QVY A;  1T6I A;  3KYI A;  2KQ9 A;  1YAR O;  1D1A A;  4O6M A;  2M64 A;  1YA9 A;  2V3C C;  3RYL A;  2VH3 A;  4JKV A;  4CS7 A;  1APC A;  4WGY A;  2L9J A;  3ZC4 A;  3AOU A;  4C7O A;  4JCH A;  1JOG A;  3ZIB A;  1RKE B;  2Y3B A;  4BJ6 A;  1BR4 A;  1ZW3 A;  2Q3T A;  4ANJ A;  3M1C B;  2L81 A;  2R25 A;  3NYM A;  3TD7 A;  4HFF B;  3NYJ A;  2P1A A;  4OD4 A;  1V4A A;  2NUP A;  1VOM A;  3LNM B;  4XWJ A;  1CGN A;  1KNY A;  5KYW A;  1OXK A;  3ZTM A;  1OXB A;  2CNW A;  2A68 F;  4YT4 A;  3U9J A;  5L0F A;  2R05 A;  2EIL C;  1E83 A;  3NMK A;  4J32 B;  3GAN A;  2AWY A;  4NQF A;  3SXZ A;  3R2P A;  1Z63 A;  1YZA A;  3H2U A;  2BC5 A;  4MW8 A;  4N6H A;  2A6H F;  1OQC A;  1V55 C;  1WAS A;  1TWH A;  2JPU A;  3KH2 A;  4J7Y A;  1R5I D;  3RVY A;  5DS6 A;  2AP3 A;  3TOM A;  4WAB A;  4M63 A;  1L7C A;  2VCA A;  3GWL A;  4JTC B;  2A6E F;  3S9O A;  3T6B A;  3SXK A;  4C3B A;  3V5Y A;  1M57 C;  1SZI A;  2LIG A;  5D92 A;  3L34 A;  4JIO A;  3DKA A;  1S7Z A;  4GEH A;  4EBK A;  1JR8 A;  3ZQY A;  4CBE A;  3IQ6 A;  1RJ9 A;  2C04 A;  2ZXP A;  4I1O B;  4KI2 A;  3K7D A;  3Q7L A;  1MNE A;  2J9B A;  1NFN A;  4P9F A;  3FAJ A;  2X0C A;  5L0I A;  2Y69 C;  2Q9B A;  4U5D E;  4XEF A;  2QY9 A;  2Q9A A;  3M79 A;  4O7G A;  4U5E E;  1OKK D;  5E2Q A;  3DE8 A;  4XLN F;  1YLM A;  4G7O F;  4CS9 C;  4CDA A;  2D5R B;  5JP7 A;  2LCH A;  3S28 A;  2HZ8 A;  1VLS A;  3LAY A;  3U0C A;  1JPJ A;  3W8H A;  4C7O B;  4WJ0 A;  4I1M A;  3DWW A;  2PX0 A;  2LFF A;  3FXH A;  2XLW A;  4MVO A;  1E86 A;  2LD6 A;  4U9E A;  2KSF A;  4PFP A;  5F5F A;  1OR3 A;  1ORY A;  1H6G A;  1EQ1 A;  2YKZ A;  4MVS A;  4DRJ B;  2XLE A;  2LSE A;  1QSP A;  2G3V A;  3AQC A;  4DVY P;  3B0U X;  4OIP F;  3LJB A;  3HTK C;  4BPM A;  5KYN A;  2XXA A;  2R7Q A;  3O6X A;  2R7W A;  2W4B A;  3PMR A;  3L1M A;  4LDQ A;  3EGD B;  3NG1 A;  3IQT A;  3HKK A;  3U8P A;  3O55 A;  3TJ5 A;  2CCY A;  4MVQ A;  1FR0 A;  2ZXR A;  3RQE A;  5DQT A;  1AVO B;  1ZVZ A;  2EIK C;  5L0C A;  3DM9 B;  4IAR A;  1RXQ A;  4YL3 A;  3W2V A;  2GFH A;  1ZHZ A;  2J9U A;  2Y39 A;  2BE5 F;  3PDM P;  3WG7 C;  1AUE A;  1EKY A;  1JPN A;  1ZHT A;  1VLT A;  2GWW A;  2KNH A;  3EZI A;  3IQC A;  4OD5 A;  5F28 E;  3UGO A;  2LQG A;  1Q0M A;  3HNI A;  3KL4 A;  3OWT A;  4IWB A;  3I5P A;  2Q7R A;  2PBE A;  1O3U A;  1SR2 A;  5CI8 A;  3EG9 A;  1D0X A;  4JJF A;  4NY3 A;  4R32 A;  3U3B A;  4AL1 A;  1WGW A;  3M4B A;  2L6H A;  1YAU O;  1WWP A;  3K1I C;  4BJ5 C;  2XM0 A;  3DM5 A;  3E9V A;  4U5B E;  4U5F E;  4HE8 D;  2CW0 F;  2Q9C A;  3CEX A;  2BL2 A;  4KNW A;  2PP4 A;  1V74 B;  4DJ9 A;  3TJ6 A;  1A7V A;  3B29 A;  1V54 C;  1OW8 A;  1VMA A;  3UNG C;  3AG3 C;  1OCR C;  4BJ1 A;  2XLM A;  1GS9 A;  3VYW A;  5BQI A;  2YL3 A;  4XEK A;  1ST6 A;  4WGZ A;  4Z9I A;  3O39 A;  2GAQ A;  1RCP A;  4YL0 A;  4LER A;  3V5X A;  5CIV A;  1RKE A;  4DRH B;  3IQ5 A;  2P7V A;  3Q6M A;  4IB4 A;  1ORJ A;  2LK4 A;  1A0B A;  1CGO A;  3MYF A;  5FZT A;  1JRA A;  2GA0 A;  3QW1 A;  4IJJ A;  4PAC A;  3AG4 C;  1I4Z A;  3SNH A;  4LDR A;  2OU6 A;  3UMI A;  4CJG A;  2YZS A;  1N1C A;  1AEP A;  2XL6 A;  3JCU Q;  1BR1 A;  3HLZ A;  4AX2 A;  3UGP A;  5L0G A;  1ORS C;  1JMW A;  3SYN A;  4ULV A;  3LLI A;  1QVX A;  2P61 A;  3Q6N A;  4LAC B;  4NTA A;  3K66 A;  1LS4 A;  1LIH A;  2YL7 A;  3Q7G A;  4LDK A;  4LLE A;  2ASR A;  4JZA A;  4JTD B;  1H9G A;  3BEH A;  3NMJ A;  2FAP B;  1ZW2 A;  2AU5 A;  2MWQ A;  2VB6 A;  3HNK A;  4DVZ A;  2A0U A;  1Q0K A;  4YT5 A;  4XPW A;  1QKR A;  3DAG A;  3K1H A;  1OCC C;  2HJ3 A;  3KMI A;  1TWG A;  2XM4 A;  3CAX A;  4RBN A;  1WTY A;  3VRC A;  1Y6D A;  2R7U A;  4G0H A;  5L3Q A;  4KC9 A;  4CDV A;  1MMD A;  1GGQ A;  1T9K A;  1TR2 A;  2J0W A;  5KYY B;  2R02 A;  1QLE C;  2A1D D;  3C63 A;  3EHM A;  2XL4 A;  3ZDL A;  1Z5Z A;  2EPK X;  3ABL C;  5COM A;  5DVW A;  3EGX A;  3AGT A;  3G50 A;  4UDV A;  4JEB A;  1YA7 O;  5T1D B;  4JTA B;  4QDL A;  3EH1 A;  2MHR A;  3GEH A;  1C02 A;  4CX9 A;  5BUO A;  2IYL D;  4MTO A;  4U9D A;  1E84 A;  1A7E A;  1OW7 A;  4MQ9 F;  4ZLD A;  4NC3 A;  1HE1 A;  3T6J A;  2NUT B;  3VF0 A;  4MS2 A;  1ZHW A;  3S0X A;  3S84 A;  4B6I A;  1VK5 A;  1QZX A;  4FWV A;  2ZXO A;  3EGD A;  3GM3 A;  2B0H A;  4XTK A;  4XLP F;  4HFK B;  5COG A;  2KC3 A;  4RD9 A;  1Q0G A;  1D0Z A;  1SF8 A;  4Z9J A;  1T01 A;  2HS5 A;  4PJM A;  1G8X A;  4MTF A;  2VCC A;  2P6V A;  4H54 A;  4OIN F;  5HSW A;  2WZL A;  5L0J A;  3GOR A;  1FMV A;  1ZZP A;  2OJE D;  2Q00 A;  3C8Z A;  3DZA A;  1UG7 A;  2F22 A;  3JRT A;  1FNT c;  4OIQ F;  4I44 A;  4YK5 A;  5JUA A;  2Y3G A;  4NTB A;  4JVS A;  5A6B D;  1G4U S;  1U89 A;  2J46 A;  2VC9 A;  4P6I C;  4IRU A;  1WAT A;  2IOQ A;  3LES A;  3R7C A;  1I4Y A;  5EK0 A;  4MVZ A;  5E3C A;  2J7P D;  2YHS A;  3FOO A;  1UFB A;  2VAS A;  3NKD A;  3AQB A;  2XRH A;  2XLO A;  3AG2 C;  3RF3 A;  4MVU A;  3C18 A;  1FFH A;  2PF4 E;  5A69 A;  4W8P A;  1MMN A;  3DMD A;  3EGX B;  1HY5 A;  1MQV A;  1M2O A;  4O6N A;  2Z15 A;  3RH3 A;  4KNV A;  3NMI A;  3LS0 A;  2GDC A;  4I3M A;  5E33 A;  1K04 A;  4P9T A;  5DLJ A;  1PD1 A;  2XLD A;  1M56 C;  5A6B A;  2R7T A;  2NG1 A;  1NU9 C;  3EH2 A;  2ZXW C;  1M2V B;  1YJG A;  2E87 A;  2I15 A;  4Q7C A;  2TMV P;  3GWN A;  2R7O A;  3L0I A;  4YWQ A;  3RIP A;  1HW1 A;  2WVQ A;  2YRF A;  2PNO A;  4CS9 A;  1T6Q A;  4IAO A;  4CDY A;  4XPY A;  5AGF A;  2JD3 A;  2LP4 A;  2PFD A;  3JT1 A;  2YLG A;  3JSE O;  4FES A;  4XEV A;  1OKK A;  3US6 A;  2J0X A;  4AL0 A;  4U5G A;  1IZM A;  2R7X A;  4K1O A;  3VM6 A;  3FAP B;  1XWJ A;  4LLC A;  3ABM C;  4Z9H A;  4BEJ A;  1KU2 A;  3FHD A;  5JS5 A;  3V7O A;  3QVZ A;  3SXM A;  4ER9 A;  3WOD F;  2CDQ A;  2R03 A;  3G4X A;  3IEE A;  2DYR C;  1RKC A;  1YYJ A;  5BQH A;  4RDA A;  4EUK B;  5AC5 A;  4BEM J;  1LKX A;  1ZYR F;  3W8I A;  4G7H F;  4O79 A;  5F5H A;  3UR3 C;  2YWA A;  2X51 A;  2OCC C;  4BG0 A;  1QPU A;  1ZU4 A;  3GM1 A;  3JSZ A;  4YN0 B;  1LE4 A;  3W2W A;  2H8A A;  1NFO A;  4PFO A;  3RFY A;  3H2V A;  4Q5S F;  5DS4 A;  4PJJ A;  1O5H A;  4U5H A;  4L6R A;  5D91 A;  5JLI A;  3LUT B;  2PX3 A;  2YL1 A;  2HUJ A;  2NSG A;  4JRZ A;  3JZ0 A;  4EHP A;  2R7V A;  1XZP A;  5JSL A;  5KYY A;  1VTM P;  3LEO A;  4DOZ A;  4E17 A;  4FAP B;  4JW1 A;  4YL1 A;  3T9O A;  4U5C E;  2J9W A;  3ABK C;  3K1I A;  1NG1 A;  1HE9 A;  5L3V A;  4Q4Z F;  1C03 A;  4ULW A;  5JVE A;  2YEV A;  1W2W A;  1FAP B;  5JT4 A;  2NUT A;  1NSG B;  2RSE B;  2YL0 A;  5L0D A;  5T3W A;  3CQZ A;  4GYT A;  5CI9 A;  4K0D A;  2KGO A;  2KYH A;  2YVK A;  3KYJ A;  1T5O A;  2EPO A;  3NKE A;  3U5S A;  4H4K C;  4XPX A;  2UUI A;  1OCZ C;  3ZQV A;  4J30 B;  2B0J A;  2L6G A;  5DS5 A;  3LLK A;  5E3A A;  3U2L A;  1B68 A;  3MLG A;  5A6K A;  2EIJ C;  4F4B A;  5KYU B;  2H7O A;  5HV9 A;  3U8V A;  4YT2 A;  1PD0 A;  5B3S C;  4GQH A;  2FFH A;  3A9C A;  2WL8 A;  3J06 A;  2J45 A;  5B1B C;  3DJU B;  2W4M A;  3H65 A;  4N6C A;  1BR2 A;  1FTS A;  3NDB B;  2IM8 A;  4N4W A;  1NLX A;  3EHN A;  1YVI A;  2L6F A;  3DXJ F;  3GM2 A;  1NBB A;  4JCZ A;  4PJN A;  3SZR A;  3ZG1 A;  1PV3 A;  1Z3I X;  2Q4F A;  1FMW A;  2OKU A;  4PK4 A;  2V26 A;  4CSA C;  1U0B B;  2HMQ A;  4ZLC A;  3V5Z A;  1TKN A;  4JC7 A;  3CZ6 A;  4CS8 C;  2WVO A;  3WHN A;  2QE9 A;  1LI7 A;  1TFO B;  2OG2 A;  2EIM C;  3N0T A;  3O10 A;  4HEA J;  3I5Q A;  1OW6 A;  4G78 A;  1Q0D A;  2KK1 A;  2AWC A;  3G4Z A;  2IXN A;  1C17 M;  3QW0 A;  2C03 A;  1M2V A;  2OOC A;  2M4E A;  2P0N A;  3A11 A;  5JRA A;  1SMY F;  3U3F A;  2DI3 A;  2ICW G;  2G3K A;  1WN0 A;  3PCV A;  4BJ6 C;  4ONS A;  3TQO A;  1D1B A;  1TFK B;  2A0B A;  2OJQ A;  2QNL A;  4N06 A;  2XS8 A;  3DD7 A;  4DBQ A;  3ZWI A;  3DI5 A;  4BJT A;  4CIH A;  4G7Z F;  4MTG A;  1ZHX A;  3LEV A;  3ATP A;  5KYX B;  1S05 A;  2IXO A;  1ZU5 A;  3HJC A;  1OCO C;  1G4W R;  3AGU A;  3VAY A;  3X1O A;  3C62 A;  3S29 A;  3ASO C;  2DB4 A;  1A7D A;  2HSB A;  3SEO A;  4JEA A;  3MYI A;  1CGM E;  1BBH A;  4QI0 A;  2HJM A;  1F1M A;  1BDJ B;  3OEO A;  3FOP A;  3X2Q C;  4JUR I;  1VB5 A;  2RD9 A;  1LPE A;  3K33 A;  1Z7Q c;  2OEX A;  2XL8 A;  3BRJ A;  3RQG A;  1IW7 F;  4E18 A;  2WB7 A;  3EJN A;  1H9T A;  1D0Y A;  2YLI A;  2ZD9 A;  3PHF 2;  3KKB A;  3CSK A;  4YT8 A;  2DGJ A;  4IGG A;  1CPQ A;  4CJO A;  2UUH A;  3WAQ A;  4PR9 A;  3LNR A;  1A41 A;  5IY5 C;  3K6B A;  3TOL A;  2A69 F;  1HMD A;  3C8G D;  3QTH A;  2CGE A;  3UMK A;  2KW3 C;  5B3I A;  1KTM A;  3DJN B;  3KPH A;  2XLV A;  3SXY A;  1J8Y F;  1MMA A;  1WOL A;  2LFD A;  1DOV A;  2XLH A;  4IAQ A;  2HMZ A;  2OEV A;  3JYY A;  1YDI A;  2D4U A;  3DE9 A;  1VYK A;  3OA1 A; 
#chains in the Genus database with same CATH homology
 2EIN C;  3DAF A;  4E7Z A;  2HV6 A;  2J7P A;  4BJ5 A;  4DBR A;  5EHH A;  3ZSU A;  3ZVR A;  2IXP A;  3F46 A;  4KBL A;  1FFT C;  4OIO F;  3JYH A;  3ITF A;  1PCX A;  5KYU A;  2R7R A;  3E70 C;  3EFO A;  3I4U A;  5DQZ A;  2NUP B;  5EGY A;  1ZHY A;  4AE4 A;  5KYW B;  1LS1 A;  2W9Y A;  1O87 A;  2HV7 A;  2WVN A;  2J9V A;  3GOD A;  1TWC A;  1MMG A;  4X0R A;  3B9Q A;  4C3E A;  4FX5 A;  2DYS C;  2ZPA A;  3UMH A;  3B0V C;  3T4R A;  2Y3D A;  3FDQ A;  2IXM A;  2O9X A;  3EQL F;  3SP1 A;  3POV A;  1RJ9 B;  5B1A C;  2QTV A;  3F47 A;  2WZG A;  3S27 A;  3FVY A;  2G62 A;  1D1C A;  4O6Y A;  3AG1 C;  3LS1 A;  4EWC A;  2XSE A;  1MND A;  5KYX A;  4A2N B;  3N2Z B;  4QI2 A;  3NRH A;  4MND A;  2H7V C;  4PJL A;  3EFO B;  3B0P A;  3NYL A;  4YJW A;  1LVK A;  3MX3 A;  3RKO F;  5T3T A;  4AE4 B;  1J8M F;  2XXA B;  2H7B A;  3N24 A;  2FGY A;  4OIR F;  4EBB A;  2W45 A;  1NU7 D;  4W8K A;  1Z6A A;  3EZH A;  4E7S A;  3QMK A;  1VYI A;  4C3D A;  2R7S A;  2MYS A;  4K7B A;  2KJG A;  3ASN C;  1Z23 A;  3EG9 B;  1TWA A;  4JJG A;  4CSA A;  2I8B A;  4AK9 A;  4CS8 A;  2CNW D;  5FCL A;  3ECS A;  2Y3H A;  1NZE A;  2WZF A;  3QZC A;  4O6M A;  2KQ9 A;  1D1A A;  2V3C C;  3RYL A;  2VH3 A;  4CS7 A;  2L9J A;  3ZC4 A;  4C7O A;  4JCH A;  3ZIB A;  2Y3B A;  4BJ6 A;  1BR4 A;  2Q3T A;  4ANJ A;  3M1C B;  2L81 A;  3NYM A;  3TD7 A;  4HFF B;  3NYJ A;  4OD4 A;  2NUP A;  1VOM A;  4XWJ A;  5KYW A;  2CNW A;  2A68 F;  4YT4 A;  2EIL C;  4J32 B;  3GAN A;  1Z63 A;  2A6H F;  1V55 C;  3KH2 A;  1TWH A;  5DS6 A;  4M63 A;  2A6E F;  3T6B A;  4C3B A;  1M57 C;  1SZI A;  5D92 A;  3L34 A;  1S7Z A;  4GEH A;  4CBE A;  4KI2 A;  1RJ9 A;  2C04 A;  2ZXP A;  4I1O B;  3K7D A;  3Q7L A;  1MNE A;  3FAJ A;  2Y69 C;  2Q9B A;  4U5D E;  5E2Q A;  2QY9 A;  2Q9A A;  4O7G A;  4U5E E;  4G7O F;  1OKK D;  4XLN F;  4CS9 C;  2D5R B;  3S28 A;  3LAY A;  1JPJ A;  3W8H A;  4C7O B;  4WJ0 A;  4I1M A;  2PX0 A;  4PFP A;  5F5F A;  2LSE A;  2G3V A;  3AQC A;  4DVY P;  3B0U X;  4OIP F;  3LJB A;  3HTK C;  2XXA A;  5KYN A;  2R7Q A;  3O6X A;  2R7W A;  2W4B A;  3PMR A;  3EGD B;  3NG1 A;  2ZXR A;  5DQT A;  2EIK C;  3DM9 B;  3W2V A;  2GFH A;  1ZHZ A;  2J9U A;  2Y39 A;  2BE5 F;  3WG7 C;  1JPN A;  1ZHT A;  3EZI A;  2KNH A;  4OD5 A;  3UGO A;  3KL4 A;  3OWT A;  4IWB A;  3I5P A;  5CI8 A;  3EG9 A;  1D0X A;  4JJF A;  4NY3 A;  1WGW A;  3K1I C;  3E9V A;  3DM5 A;  4U5F E;  4U5B E;  4HE8 D;  2CW0 F;  2Q9C A;  4KNW A;  2PP4 A;  1V54 C;  1VMA A;  3UNG C;  3AG3 C;  1OCR C;  4BJ1 A;  3VYW A;  1ST6 A;  3O39 A;  4LER A;  2P7V A;  3Q6M A;  4IJJ A;  3UMI A;  3SNH A;  3AG4 C;  2YZS A;  1N1C A;  3JCU Q;  1BR1 A;  3HLZ A;  4AX2 A;  3UGP A;  3SYN A;  3LLI A;  4LAC B;  3Q6N A;  3K66 A;  3Q7G A;  4LLE A;  4JZA A;  2MWQ A;  2VB6 A;  4DVZ A;  4YT5 A;  3K1H A;  3DAG A;  1OCC C;  3KMI A;  1TWG A;  4RBN A;  2R7U A;  4G0H A;  5L3Q A;  4KC9 A;  1MMD A;  1TR2 A;  2J0W A;  5KYY B;  1QLE C;  2A1D D;  3EHM A;  2XL4 A;  1Z5Z A;  3ABL C;  5DVW A;  3EGX A;  5T1D B;  4QDL A;  3EH1 A;  5BUO A;  2IYL D;  4MQ9 F;  4ZLD A;  3S0X A;  3T6J A;  2NUT B;  1ZHW A;  4B6I A;  1VK5 A;  1QZX A;  4FWV A;  2ZXO A;  3EGD A;  4XLP F;  4XTK A;  4HFK B;  4RD9 A;  1D0Z A;  1SF8 A;  4PJM A;  1G8X A;  2P6V A;  4OIN F;  5HSW A;  2WZL A;  1FMV A;  4OIQ F;  3DZA A;  3JRT A;  4I44 A;  2Y3G A;  4JVS A;  2J46 A;  4P6I C;  4IRU A;  2IOQ A;  3LES A;  5E3C A;  2J7P D;  2YHS A;  2VAS A;  3NKD A;  3AQB A;  2XRH A;  3AG2 C;  1FFH A;  2PF4 E;  1MMN A;  3DMD A;  3EGX B;  4O6N A;  4BJ5 C;  1M2O A;  3RH3 A;  2Z15 A;  4KNV A;  3LS0 A;  4I3M A;  5E33 A;  5DLJ A;  2R7T A;  1PD1 A;  1M56 C;  2NG1 A;  1NU9 C;  3EH2 A;  2ZXW C;  1M2V B;  2E87 A;  4Q7C A;  3L0I A;  2R7O A;  4YWQ A;  3RIP A;  2WVQ A;  4CS9 A;  4IAO A;  2JD3 A;  2PFD A;  3JT1 A;  4FES A;  1OKK A;  2J0X A;  2R7X A;  4U5G A;  1IZM A;  4LLC A;  3ABM C;  4BEJ A;  1KU2 A;  3FHD A;  3V7O A;  3WOD F;  2CDQ A;  3IEE A;  2DYR C;  4RDA A;  1LKX A;  1ZYR F;  3W8I A;  4G7H F;  4O79 A;  5F5H A;  3UR3 C;  2X51 A;  2OCC C;  4BG0 A;  1ZU4 A;  4YN0 B;  3JSZ A;  3W2W A;  4PFO A;  4Q5S F;  3RFY A;  5DS4 A;  4PJJ A;  1O5H A;  4U5H A;  5D91 A;  2PX3 A;  2R7V A;  5KYY A;  4DOZ A;  4JW1 A;  4U5C E;  2J9W A;  3ABK C;  1NG1 A;  5L3V A;  4Q4Z F;  4ULW A;  2YEV A;  1W2W A;  2NUT A;  5T3W A;  3CQZ A;  4GYT A;  5CI9 A;  4K0D A;  2KGO A;  3NKE A;  4H4K C;  1OCZ C;  4J30 B;  2B0J A;  5DS5 A;  3LLK A;  5E3A A;  3MLG A;  2EIJ C;  4F4B A;  5KYU B;  2H7O A;  4YT2 A;  5B3S C;  1PD0 A;  2FFH A;  2WL8 A;  2J45 A;  5B1B C;  3DJU B;  2W4M A;  3H65 A;  3NDB B;  1BR2 A;  1FTS A;  3EHN A;  3DXJ F;  3SZR A;  4PJN A;  3ZG1 A;  1Z3I X;  1FMW A;  4PK4 A;  2V26 A;  4CSA C;  4ZLC A;  1TKN A;  3CZ6 A;  4CS8 C;  2WVO A;  3N0T A;  2OG2 A;  2EIM C;  4HEA J;  3I5Q A;  2IXN A;  2C03 A;  1M2V A;  2M4E A;  1SMY F;  2G3K A;  4BJ6 C;  1D1B A;  4DBQ A;  4N06 A;  3DD7 A;  4BJT A;  4CIH A;  4G7Z F;  1ZHX A;  3LEV A;  5KYX B;  2IXO A;  1ZU5 A;  3HJC A;  1OCO C;  3VAY A;  3X1O A;  3S29 A;  3ASO C;  3SEO A;  4QI0 A;  3OEO A;  3X2Q C;  4JUR I;  3K33 A;  1IW7 F;  2WB7 A;  3EJN A;  1D0Y A;  3PHF 2;  3KKB A;  3CSK A;  4YT8 A;  2DGJ A;  5IY5 C;  3LNR A;  3K6B A;  2A69 F;  3UMK A;  2CGE A;  2KW3 C;  3DJN B;  1J8Y F;  1MMA A;  3EPV A;  1VYK A;  3OA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...