2KGOA

Solution nmr structure of zn finger protein ybil from escherichia coli. nesg target et107, ocsp target ec0402
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
MASGWANDDAVNEQINSTIEDAIARARGEIPRGESLDECEECGAPIPQARREAIPGVRLCIHCQQEKDLQKPAYTGYNRRGSKDSQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ybiI
publication title Zn-finger protein YBIL from E. coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01258 zf-dskA_traR Prokaryotic dksA/traR C4-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kgoA01
2KGOA 4IJJA 2KQ9A
chains in the Genus database with same CATH superfamily
5CI8A 4JJGA 2TMVP 2YHSA 3EHNA 3NKEA 4KI2A 2HJMA 2GFHA 3HNIA 5JSLA 1XZQA 4P6IC 3HNKA 3LEVA 2PBEA 1O87A 2PP4A 2A6EF 4U5EE 3C18A 4ULVA 4CS8C 1JOGA 3L0IA 5F5HA 4F4BA 3NDBB 1NU7D 1BZ4A 1ORJA 3ZDLA 2AWCA 5A6BD 5EK0A 2NUPA 3ZSUA 2CCYA 3HTKC 2NG1A 2HFIA 4OD4A 4YN0B 4CJOA 1LI5A 3TULA 5A6KA 2X0CA 2E87A 2XLMA 2R7UA 1IW7F 3OEOA 5JUAA 3AG1C 1W2WA 3TQOA 4EUKB 1T6QA 1I4ZA 3GWLA 4BJ6C 4YT2A 1E83A 3ZTMA 1OQCA 1YVIA 2IXOA 3EGDB 4MVUA 2CNWD 2XS8A 1L7CA 3C63A 3UNGC 4YT8A 4AX2A 4G7OF 1CGNA 4LDQA 1CGOA 5T1DB 1JMWA 1J8YF 3RH3A 2EIMC 2GAQA 4HEAJ 2R9RB 3CSKA 2ASRA 1MMAA 1Z6AA 4QI2A 4E18A 3T6BA 1DOWA 1PD0A 2Q3TA 1OCZC 3F47A 1LIHA 1Z7Qc 3ZIBA 4AL1A 3I5PA 4G0HA 4IJJA 3M15A 1MNEA 4YL1A 2YQYA 4CS8A 4C7OB 3CZ6A 3U8VA 4JRZA 4EKWA 2C03A 3VYWA 4AE4B 4BG0A 5JP7A 2WZLA 1HE9A 3GORA 2IYLD 4CDVA 1ZHYA 4DRIB 2FGYA 3LJBA 1M56C 3RF3A 3W8HA 3CEXA 4JTDB 1N1CA 3X2QC 3V5ZA 4G78A 3K1IC 2XM4A 3AG3C 2VC9A 4A4AA 3L8JA 4MVMA 4DJ9A 1T5OA 3DZAA 4XPWA 1YYXA 5E2QA 2EIKC 4MW8A 4M63A 3PCVA 4GQHA 3S84A 3U0CA 1RJ9A 4O6YA 4N6HA 2XM0A 4EBBA 2JD3A 1A7VA 4LERA 1M2VA 1Q0GA 2A0UA 2OCCC 3EJNA 4PJLA 1RCPA 2KJGA 2YL7A 4XQ1A 5JRAA 2KSFA 3L34A 2OEXA 3T6JA 2DGJA 2VCAA 4CDAA 3C8GD 1E84A 2OKUA 5CIVA 4MTGA 1D1CA 1G4US 3EHMA 2B0JA 2YRFA 2UUHA 3EFOA 3M79A 3SYNA 4QI0A 3M4CA 1LE2A 4J7TA 4NTAA 3U5SA 1YAUO 1ZHZA 4H54A 2ZD9A 3U9MA 3RQFA 3O10A 5KYUB 1YDIA 2O9XA 3BRJA 4K0DA 3QW1A 4CSAC 3O6XA 3RVZA 2ZXPA 3LAYA 2R7WA 2J9UA 3DAFA 1NZEA 4CBEA 4PFOA 3K1IA 1J8MF 4HE8D 3GEIA 1M57C 3QVZA 4D4NA 1OR2A 2L6GA 1Z5ZA 2OOCA 1ZHXA 3K6BA 4KC9A 4BEMJ 1MQVA 4JCHA 2HS5A 5DQTA 2DYRC 1GQAA 1G8XA 5COGA 3Q6NA 1ZW3A 2DYSC 3AG4C 2C04A 4JKVA 2YWAA 4PJJA 3WHNA 1H9GA 3EZIA 4EIYA 4E7ZA 2A1DD 2PF4E 3GM1A 4FX5A 1Q0FA 3B0VC 2A6HF 4BJ5C 2NSGA 1K04A 1PD1A 1WN0A 1XZPA 3QW0A 4MVSA 2J9VA 2EILC 3TJ5A 3H2UA 4U5GA 1QVXA 3H2VA 3JYHA 3DM9B 4YJWA 2IXNA 1TR2A 4N6CA 3KKBA 3VRCA 3RKOF 3RVYA 2KK1A 2EIJC 4ULWA 3G4XA 3IHUA 4WGZA 5COFA 4XLNF 4BPMA 5KYYA 1EA8A 1NBBA 4MS2A 1YA7O 1K40A 2J9BA 4CSAA 3AJMA 1QQ3A 1YZAA 3DJNB 1FMVA 1OW8A 4U9EA 1WASA 4DXWA 2R7TA 2Y3DA 2NSFA 2P0NA 3GODA 1E2XA 3OWTA 4IAOA 4WABA 4AK9A 3O55A 2J45A 1EI7A 5GPGB 2XL4A 4MW3A 5E3CA 1K05A 4JZAA 3C8GB 2YVKA 4U5DE 1T6UA 3NG1A 4RBNA 3UMIA 5E33A 5AC4A 2GA0A 2YLGA 3I5QA 1QKRA 1QLEC 4GEHA 2YKZA 4MVZA 3KYJA 1AVOB 4W8KA 2XXAB 4R32A 2AWYA 3RFYA 3EZHA 3N24A 3JRMO 2L6HA 3QZCA 2JX0A 2XL8A 4YT5A 3FOPA 3SEOA 3EGXA 4KNWA 4MTOA 1R5ID 4PFPA 2XLHA 3T9OA 2J0WA 1OW6A 3M4BA 2XLWA 4DBRA 1OCCC 3JRTA 4RD9A 3B0UX 4K7BA 2IOQA 1FAPB 5FZTA 2EPLX 1NFOA 2NPUA 2X51A 3I4UA 4CJGA 1TKNA 4LDKA 2ICWG 2M4EA 2VCCA 4I1MA 4J7YA 3U2MA 3U3BA 5DQZA 1VTMP 3AOUA 1MNDA 4MTFA 5K0IA 3TOMA 5KYWB 3Q7LA 1LS1A 3U9JA 1NSGB 2Q9CA 3J06A 3IQTA 1TQGA 4NQFA 4XLPF 1Z63A 2WZGA 4O6MA 2HJ3A 1FFTC 2VCBA 1D0ZA 2YL1A 1AUEA 5L0GA 2PX3A 4E17A 1BBHA 1OXBA 1PV3A 2EPOA 2MWQA 1V74B 2WB7A 2WL8A 3LS0A 1I5NA 5L0IA 5KYXA 1RXQA 1VMAA 4D4XA 3MLGA 2VH3A 1OKKD 3JTLO 4U5CE 1VB5A 2V26A 5L0FA 3IQ6A 2R03A 1OXKA 3N0TA 1ZHTA 4U5FE 2LD6A 4JE9A 2RSEB 4L6RA 1EKYA 2DB4A 1SZIA 3AGTA 2EPKX 4BJTA 2QUPA 5L0JA 4FESA 2XLEA 2J8WA 1RKEB 4OINF 3GM3A 2JPUA 2I15A 2R7OA 2XS1A 3IEEA 3ASNC 1VLTA 2QE9A 3UMHA 3ZG1A 4BJ6A 3V7OA 2GWWA 3SXKA 2ZPAA 1LS4A 3UR3C 1E85A 3VM6A 4XEVA 3FDQA 2LFDA 1M2OA 2KYHA 2NUTA 1S7ZA 3ZQVA 4DBQA 5DS6A 4IAQA 4DVZA 2ETSA 4RDAA 1R4TA 1QZXA 2KGOA 4E0IA 4FAPB 1HW1A 1GGQA 1LI7A 3HLZA 3NYMA 3SZRA 3HJCA 4X0RA 1KNYA 3R2PA 2PX0A 3EG9B 2YLIA 1AEPA 1YARO 3T4RA 4B6IA 3N2ZB 2XLVA 3RQGA 2R7QA 4YL3A 3EQLF 4ANJA 3DE8A 1GS9A 3DD7A 3HNLA 3ZTZA 5EGYA 4CIPA 3UGOA 5JT4A 2QLAA 2ZXWC 4XPYA 2HV6A 4LACB 1ZW2A 3TK0A 3UMKA 3DI5A 3PHF2 1H9TA 3IPMO 4JTAB 4QDLA 4CS7A 3DMDA 2W9YA 2Q9BA 3MX3A 2R02A 3EGDA 2LP4A 1ZU4A 3B0PA 1FFHA 4Z9HA 1EQ1A 1Z3IX 1NG1A 4KBLA 3RW0A 3Q6MA 3LESA 2Y69C 1CPRA 3POVA 4JTCB 1PCXA 3R7CA 3U8PA 3HNJA 3FVYA 2QY9A 4NY3A 3ZWIA 1JR8A 2CGEA 4EHPA 1H7IA 2KW3C 4FWVA 1T6IA 3PDMP 3DKAA 2HKVA 1Q0KA 3NYLA 5A6JA 3DM5A 1GM5A 2NUPB 4AL0A 2ZXRA 4EBJA 3V5YA 1ZVZA 2G3KA 2ZXOA 2OJED 3GANA 4O6NA 3U3FA 4E0HA 2HSBA 4EBKA 4OIQF 2Q4FA 5B1BC 2L81A 3A11A 3ITFA 4N06A 4AE4A 1MMDA 1MMNA 2IXMA 1F1MA 4NTBA 3NMIA 3GEHA 2Z15A 1S05A 4YL0A 3S90A 2J46A 2LCHA 4YK5A 3W8IA 2KNHA 1O5HA 2Y3GA 2PNOA 2WVOA 1A7DA 4WGYA 1APCA 1FTSA 1ZHWA 2Y3HA 1A7EA 4NTFA 3EPVA 1LVKA 2M64A 5D92A 3V5XA 1CPQA 3K33A 5L3VA 1E86A 4JEAA 1TFKB 4MNDA 4XTKA 1BR4A 2R7RA 2CDQA 2P1AA 4IARA 1HY5A 1NFNA 1YLMA 2W45A 5JVEA 2EPNA 2QNLA 2P61A 2CW0F 1WOLA 3L8IA 3Q7GA 3W2VA 5A6BA 1U89A 4BJ5A 5HV9A 3NMJA 1IZMA 3RYLA 5L0HA 3UGPA 5BUOA 1WWPA 2XL6A 2G3VA 1Y4CA 3ASOC 3F46A 4JURI 4K1OA 4Z9JA 2YEVA 4PACA 3LUTB 2H7OA 1HMOA 3MYFA 3JZ0A 2WVNA 3W2WA 2BL2A 3GWNA 1LM3B 4GYTA 1U6HA 5KYUA 3DWWA 2EPMX 2YL0A 4XPXA 4JEBA 5EHHA 1RMVA 5DS5A 2LSEA 1L3PA 5T3WA 1RJ9B 2P6VA 1XWJA 2L9JA 4HFKB 3C62A 4MVQA 4LLCA 3B29A 1TWCA 1ZZPA 1M2VB 1HE1A 256BA 4H4KC 3T6GB 1C03A 1HW2A 1A41A 4ZLDA 2LFFA 2H7VC 3BEHA 3DJUB 3G4ZA 3IQCA 3NKDA 5AGFA 1CGME 1LPEA 1Q0MA 3VF0A 1Z23A 2OJQA 2XSEA 3C8ZA 3E9VA 1JPJA 1VYKA 2L6FA 2VB6A 3EFOB 3NMKA 5BQGA 1JPNA 3FAPB 3S28A 2HMZA 2VASA 4ER9A 1I4YA 5DLJA 1JRAA 1YJGA 4PR9A 5COMA 3DXJF 3ECSA 1H6GA 4ONSA 3S0XA 2V3CC 1A0BA 1B68A 2HSQA 4JW1A 4XEKA 4C3EA 2Q9AA 3QMKA 1DOVA 3RIPA 1LKXA 4CS9C 1VYIA 3WAQA 2A68F 5A69A 3K1HA 4IGGA 4BJ1A 4DRJB 5L0DA 4W8PA 2G62A 2KC3A 4O7GA 3LNRA 2AP3A 1YZCA 4Z9IA 4J32B 1M6TA 5D91A 3S29A 2OG2A 2L7AA 3PMRA 5E3AA 4N4WA 3ZVRA 5FCLA 1O3UA 4WJ0A 2R7VA 5F28E 2H7BA 1QPUA 1WGWA 3C8GA 1OCRC 2Q00A 2D4UA 4P9FA 3SXMA 2MYSA 2I8BA 4DVYP 2D5RB 4JJFA 3G50A 1BR2A 4PK4A 4P9TA 3FXHA 3S27A 1FNTc 3JT1A 4ZLCA 2YLDA 4LLEA 3FHDA 5TJ5E 4E7SA 1OR3A 4Q5SF 4BEJA 4Q4ZF 2XXAA 4JVSA 2W4MA 3DE9A 1G4WR 4PJNA 5KYYB 2XLOA 4DOZA 5KYNA 4KNVA 3ZQYA 3WODF 4OIPF 1BDJB 1VOMA 3KMIA 1LE4A 2LK4A 4YT4A 3DAGA 4XWJA 3US6A 3ABLC 3L1MA 4CS9A 4U9DA 3ABKC 3LNMB 2R7SA 4IRUA 2R25A 1SR2A 2P7VA 3JSZA 3X1OA 2OEVA 3K66A 4MVRA 2J7PA 4IWBA 5T3TA 3TD7A 2R7XA 2AU5A 3TJ6A 5JS5A 4OD5A 5B3IA 3GEEA 3EH2A 1HMDA 4U5HA 4DRHB 3CQZA 2AVKA 2A0BA 3KYIA 3AQBA 5KYWA 4JC7A 4NC3A 4UDVA 3B9QA 1Y6DA 3HKKA 3WG7C 1D1BA 4MQ9F 2BC5A 1BR1A 2BE5F 2YZSA 3LLKA 4I3MA 1ORSC 1TWGA 4JIOA 3SNHA 3W4YA 2Y3BA 2RD9A 3EGXB 4O79A 1D0YA 2B0HA 1V54C 5DVWA 2XRHA 3SXZA 2UUIA 3MYIA 3NRHA 4JCZA 3JCUQ 3K7DA 4YWQA 1D1AA 2KQ9A 5B3SC 2EINC 1C17M 1V55C 3CAXA 2Y39A 5JLIA 1YA9A 3O39A 3U2LA 3VAYA 1VLSA 1TFOB 4C7OA 3AG2C 3MBGA 4U5BE 2WVQA 3AGUA 4OIRF 3M1CB 4CDYA 4MVOA 2PFDA 5A6AA 3E70C 4NCQA 1FR0A 3GM2A 1RKEA 1OW7A 3RQEA 4HFFB 1MMGA 5CI9A 2IXPA 2LIGA 2WZFA 5L3QA 2MHRA 1ST6A 2J7PD 4CIHA 2OU6A 2R05A 3EH1A 2HZ8A 5AC5A 3FMSA 4I44A 1FMWA 3AQCA 3S9OA 2IBFA 5IY5C 2HMQA 2J9WA 1WATA 1D0XA 4J30B 5KYXB 2A69F 1ZU5A 3QVYA 3FOOA 1TWHA 1QSPA 1V4AA 2QTVA 1NU9C 3FAJA 2IM8A 2Q7RA 4I1OB 1RKCA 2YL3A 1ZYRF 1T9KA 3IQ5A 2DI3A 2W4BA 3JYYA 2GDCA 4EWCA 4A2NB 1Q0DA 3OA1A 1JAFA 2XLDA 5B1AC 5BQIA 1U0BB 2J0XA 1ORYA 2HV7A 5DS4A 4OIOF 3B71A 4G7HF 1G5ZA 1C02A 5HSWA 1KU2A 2CYDA 2OQMA 1SF8A 3EG9A 1TWAA 3QTHA 1SYQA 3KPHA 3SP1A 4G7ZF 2H8AA 3JSEO 4PJMA 1KTMA 1VK5A 1UFBA 3ZC4A 1OCOC 1NLXA 1T01A 2CNWA 4C3DA 4Q7CA 2F22A 4C3BA 5L0CA 3MFNA 1WTYA 2FFHA 1UG7A 3ABMC 3KH2A 3SXYA 5BQHA 4LDRA 2LQGA 3NYJA 4XEFA 3LEOA 1YYJA 2HUJA 3A9CA 3C7JA 3TOLA 5F5FA 2NUTB 3LS1A 2FAPB 3ATPA 3LLIA 3H65A 1SMYF 4CX9A 4IB4A 1OKKA 3KL4A
chains in the Genus database with same CATH topology
5CI8A 4JJGA 2YHSA 3EHNA 3NKEA 4KI2A 2GFHA 4P6IC 3LEVA 2PP4A 1O87A 2A6EF 4U5EE 4CS8C 5F5HA 3L0IA 4F4BA 3NDBB 1NU7D 3ZSUA 2NUPA 4YN0B 3HTKC 2NG1A 4OD4A 2R7UA 2E87A 1IW7F 3OEOA 3AG1C 1W2WA 4BJ6C 4YT2A 3EGDB 2IXOA 2CNWD 3UNGC 4YT8A 4G7OF 4AX2A 5T1DB 1J8YF 3RH3A 2EIMC 4HEAJ 3CSKA 1MMAA 1Z6AA 4QI2A 3T6BA 1PD0A 2Q3TA 1OCZC 3F47A 3ZIBA 3I5PA 4G0HA 4IJJA 1MNEA 4C7OB 4CS8A 3CZ6A 2C03A 3VYWA 4AE4B 4BG0A 2WZLA 2IYLD 1ZHYA 2FGYA 3LJBA 1M56C 3W8HA 1N1CA 3X2QC 3K1IC 3AG3C 3DZAA 5E2QA 2EIKC 4M63A 1RJ9A 4O6YA 4EBBA 2JD3A 4LERA 1M2VA 3EJNA 2OCCC 4PJLA 2KJGA 3L34A 3T6JA 2DGJA 1D1CA 3EHMA 2B0JA 3EFOA 3SYNA 4QI0A 1ZHZA 5KYUB 2O9XA 4K0DA 4CSAC 3O6XA 2ZXPA 3LAYA 2R7WA 2J9UA 3DAFA 1NZEA 4CBEA 4PFOA 1J8MF 4HE8D 1M57C 3K6BA 1Z5ZA 4KC9A 1ZHXA 4JCHA 5DQTA 2DYRC 1G8XA 3Q6NA 3AG4C 2DYSC 3B0UX 2C04A 4PJJA 3EZIA 4E7ZA 2A1DD 2PF4E 4FX5A 3B0VC 2A6HF 4BJ5C 1PD1A 2J9VA 2EILC 4U5GA 3JYHA 3DM9B 4YJWA 2IXNA 1TR2A 3KKBA 3RKOF 2EIJC 4ULWA 4XLNF 5KYYA 4CSAA 3DJNB 1FMVA 2R7TA 2Y3DA 3GODA 3OWTA 4IAOA 4AK9A 2J45A 2XL4A 5E3CA 4JZAA 4U5DE 4RBNA 3NG1A 3UMIA 5E33A 3I5QA 1QLEC 4GEHA 4W8KA 2XXAB 3RFYA 3EZHA 3N24A 3QZCA 4YT5A 3SEOA 3EGXA 4KNWA 4PFPA 2J0WA 4DBRA 1OCCC 3JRTA 4RD9A 4K7BA 2IOQA 2X51A 3I4UA 1TKNA 2M4EA 4I1MA 5DQZA 1MNDA 5KYWB 3Q7LA 1LS1A 2Q9CA 4XLPF 1Z63A 2WZGA 4O6MA 1FFTC 1D0ZA 2PX3A 2WB7A 2WL8A 2MWQA 5KYXA 3LS0A 1VMAA 3MLGA 2VH3A 1OKKD 4U5CE 2V26A 3N0TA 1ZHTA 4U5FE 1SZIA 4BJTA 4FESA 4OINF 2R7OA 3IEEA 3ASNC 3UMHA 3ZG1A 4BJ6A 3V7OA 2ZPAA 3UR3C 3FDQA 1M2OA 2NUTA 1S7ZA 4DBQA 5DS6A 4DVZA 4RDAA 1QZXA 2KGOA 3SZRA 3HLZA 3NYMA 3HJCA 4X0RA 2PX0A 3EG9B 3T4RA 4B6IA 3N2ZB 2R7QA 3EQLF 4ANJA 3UGOA 3DD7A 5EGYA 2ZXWC 2HV6A 4LACB 3UMKA 3PHF2 4QDLA 4CS7A 3DMDA 2W9YA 2Q9BA 3MX3A 3EGDA 3B0PA 1ZU4A 1FFHA 1Z3IX 1NG1A 4KBLA 3Q6MA 3LESA 2Y69C 3POVA 1PCXA 3FVYA 2QY9A 4NY3A 2CGEA 2KW3C 4FWVA 3NYLA 3DM5A 2NUPB 2ZXRA 2G3KA 2ZXOA 3GANA 4O6NA 4OIQF 5B1BC 2L81A 3ITFA 4N06A 4AE4A 1MMDA 1MMNA 2IXMA 2Z15A 2J46A 3W8IA 2KNHA 1O5HA 2Y3GA 2WVOA 1FTSA 1ZHWA 2Y3HA 3EPVA 1LVKA 5D92A 3K33A 5L3VA 4MNDA 4XTKA 1BR4A 2R7RA 2CDQA 2W45A 3Q7GA 2CW0F 3W2VA 4BJ5A 1IZMA 3RYLA 3UGPA 5BUOA 2G3VA 3ASOC 3F46A 4JURI 2YEVA 2H7OA 2WVNA 3W2WA 4GYTA 5KYUA 5EHHA 5DS5A 2LSEA 5T3WA 1RJ9B 2P6VA 2L9JA 4HFKB 4LLCA 1TWCA 1M2VB 4H4KC 4ZLDA 2H7VC 3DJUB 3NKDA 1Z23A 2XSEA 3E9VA 1JPJA 1VYKA 2VB6A 3EFOB 1JPNA 3S28A 2VASA 5DLJA 2V3CC 3DXJF 3ECSA 3S0XA 4C3EA 4JW1A 2Q9AA 3QMKA 3RIPA 1LKXA 4CS9C 1VYIA 2A68F 3K1HA 4BJ1A 2G62A 4O7GA 3LNRA 4J32B 5D91A 3S29A 2OG2A 3PMRA 5E3AA 3ZVRA 5FCLA 4WJ0A 2R7VA 2H7BA 1WGWA 4DVYP 1OCRC 2MYSA 2I8BA 2D5RB 4JJFA 1BR2A 4PK4A 3S27A 3JT1A 4ZLCA 4LLEA 3FHDA 4E7SA 4Q5SF 4BEJA 4Q4ZF 2XXAA 4JVSA 2W4MA 5KYYB 4PJNA 4DOZA 5KYNA 4KNVA 3WODF 4OIPF 1VOMA 3KMIA 4YT4A 3DAGA 4XWJA 3ABLC 4CS9A 3ABKC 2R7SA 4IRUA 3JSZA 2P7VA 3X1OA 3K66A 5T3TA 2R7XA 2J7PA 4IWBA 3TD7A 4OD5A 3EH2A 4U5HA 3CQZA 3AQBA 5KYWA 3B9QA 3WG7C 1D1BA 4MQ9F 1BR1A 2BE5F 2YZSA 3LLKA 4I3MA 1TWGA 3SNHA 2Y3BA 3EGXB 4O79A 1D0YA 1V54C 5DVWA 2XRHA 3NRHA 3JCUQ 3K7DA 4YWQA 1D1AA 2KQ9A 5B3SC 2EINC 1V55C 2Y39A 3O39A 3VAYA 4C7OA 3AG2C 4U5BE 2WVQA 4OIRF 3M1CB 2PFDA 3E70C 4HFFB 1MMGA 5CI9A 2IXPA 2WZFA 5L3QA 1ST6A 2J7PD 4CIHA 3EH1A 4I44A 1FMWA 3AQCA 5IY5C 2J9WA 4J30B 1D0XA 5KYXB 2A69F 1ZU5A 1TWHA 2QTVA 1NU9C 3FAJA 4I1OB 1ZYRF 2W4BA 4EWCA 4A2NB 3OA1A 5B1AC 2J0XA 2HV7A 5DS4A 4OIOF 4G7HF 5HSWA 1KU2A 3EG9A 1SF8A 4G7ZF 1TWAA 3SP1A 4PJMA 1VK5A 3ZC4A 1OCOC 2CNWA 4C3DA 4Q7CA 4C3BA 2FFHA 3ABMC 3KH2A 3NYJA 5F5FA 2NUTB 3LS1A 3LLIA 3H65A 1SMYF 1OKKA 3KL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGO A;  4IJJ A;  2KQ9 A; 
#chains in the Genus database with same CATH topology
 5CI8 A;  4JJG A;  2TMV P;  2YHS A;  3EHN A;  3NKE A;  4KI2 A;  2HJM A;  2GFH A;  3HNI A;  5JSL A;  1XZQ A;  4P6I C;  3HNK A;  3LEV A;  2PBE A;  1O87 A;  2PP4 A;  2A6E F;  4U5E E;  3C18 A;  4ULV A;  4CS8 C;  1JOG A;  3L0I A;  5F5H A;  4F4B A;  3NDB B;  1NU7 D;  1BZ4 A;  1ORJ A;  3ZDL A;  2AWC A;  5A6B D;  5EK0 A;  2NUP A;  3ZSU A;  2CCY A;  3HTK C;  2NG1 A;  2HFI A;  4OD4 A;  4YN0 B;  4CJO A;  1LI5 A;  3TUL A;  5A6K A;  2X0C A;  2E87 A;  2XLM A;  2R7U A;  1IW7 F;  3OEO A;  5JUA A;  3AG1 C;  1W2W A;  3TQO A;  4EUK B;  1T6Q A;  1I4Z A;  3GWL A;  4BJ6 C;  4YT2 A;  1E83 A;  3ZTM A;  1OQC A;  1YVI A;  2IXO A;  3EGD B;  4MVU A;  2CNW D;  2XS8 A;  1L7C A;  3C63 A;  3UNG C;  4YT8 A;  4AX2 A;  4G7O F;  1CGN A;  4LDQ A;  1CGO A;  5T1D B;  1JMW A;  1J8Y F;  3RH3 A;  2EIM C;  2GAQ A;  4HEA J;  2R9R B;  3CSK A;  2ASR A;  1MMA A;  1Z6A A;  4QI2 A;  4E18 A;  3T6B A;  1DOW A;  1PD0 A;  2Q3T A;  1OCZ C;  3F47 A;  1LIH A;  1Z7Q c;  3ZIB A;  4AL1 A;  3I5P A;  4G0H A;  4IJJ A;  3M15 A;  1MNE A;  4YL1 A;  2YQY A;  4CS8 A;  4C7O B;  3CZ6 A;  3U8V A;  4JRZ A;  4EKW A;  2C03 A;  3VYW A;  4AE4 B;  4BG0 A;  5JP7 A;  2WZL A;  1HE9 A;  3GOR A;  2IYL D;  4CDV A;  1ZHY A;  4DRI B;  2FGY A;  3LJB A;  1M56 C;  3RF3 A;  3W8H A;  3CEX A;  4JTD B;  1N1C A;  3X2Q C;  3V5Z A;  4G78 A;  3K1I C;  2XM4 A;  3AG3 C;  2VC9 A;  4A4A A;  3L8J A;  4MVM A;  4DJ9 A;  1T5O A;  3DZA A;  4XPW A;  1YYX A;  5E2Q A;  2EIK C;  4MW8 A;  4M63 A;  3PCV A;  4GQH A;  3S84 A;  3U0C A;  1RJ9 A;  4O6Y A;  4N6H A;  2XM0 A;  4EBB A;  2JD3 A;  1A7V A;  4LER A;  1M2V A;  1Q0G A;  2A0U A;  2OCC C;  3EJN A;  4PJL A;  1RCP A;  2KJG A;  2YL7 A;  4XQ1 A;  5JRA A;  2KSF A;  3L34 A;  2OEX A;  3T6J A;  2DGJ A;  2VCA A;  4CDA A;  3C8G D;  1E84 A;  2OKU A;  5CIV A;  4MTG A;  1D1C A;  1G4U S;  3EHM A;  2B0J A;  2YRF A;  2UUH A;  3EFO A;  3M79 A;  3SYN A;  4QI0 A;  3M4C A;  1LE2 A;  4J7T A;  4NTA A;  3U5S A;  1YAU O;  1ZHZ A;  4H54 A;  2ZD9 A;  3U9M A;  3RQF A;  3O10 A;  5KYU B;  1YDI A;  2O9X A;  3BRJ A;  4K0D A;  3QW1 A;  4CSA C;  3O6X A;  3RVZ A;  2ZXP A;  3LAY A;  2R7W A;  2J9U A;  3DAF A;  1NZE A;  4CBE A;  4PFO A;  3K1I A;  1J8M F;  4HE8 D;  3GEI A;  1M57 C;  3QVZ A;  4D4N A;  1OR2 A;  2L6G A;  1Z5Z A;  2OOC A;  1ZHX A;  3K6B A;  4KC9 A;  4BEM J;  1MQV A;  4JCH A;  2HS5 A;  5DQT A;  2DYR C;  1GQA A;  1G8X A;  5COG A;  3Q6N A;  1ZW3 A;  2DYS C;  3AG4 C;  2C04 A;  4JKV A;  2YWA A;  4PJJ A;  3WHN A;  1H9G A;  3EZI A;  4EIY A;  4E7Z A;  2A1D D;  2PF4 E;  3GM1 A;  4FX5 A;  1Q0F A;  3B0V C;  2A6H F;  4BJ5 C;  2NSG A;  1K04 A;  1PD1 A;  1WN0 A;  1XZP A;  3QW0 A;  4MVS A;  2J9V A;  2EIL C;  3TJ5 A;  3H2U A;  4U5G A;  1QVX A;  3H2V A;  3JYH A;  3DM9 B;  4YJW A;  2IXN A;  1TR2 A;  4N6C A;  3KKB A;  3VRC A;  3RKO F;  3RVY A;  2KK1 A;  2EIJ C;  4ULW A;  3G4X A;  3IHU A;  4WGZ A;  5COF A;  4XLN F;  4BPM A;  5KYY A;  1EA8 A;  1NBB A;  4MS2 A;  1YA7 O;  1K40 A;  2J9B A;  4CSA A;  3AJM A;  1QQ3 A;  1YZA A;  3DJN B;  1FMV A;  1OW8 A;  4U9E A;  1WAS A;  4DXW A;  2R7T A;  2Y3D A;  2NSF A;  2P0N A;  3GOD A;  1E2X A;  3OWT A;  4IAO A;  4WAB A;  4AK9 A;  3O55 A;  2J45 A;  1EI7 A;  5GPG B;  2XL4 A;  4MW3 A;  5E3C A;  1K05 A;  4JZA A;  3C8G B;  2YVK A;  4U5D E;  1T6U A;  3NG1 A;  4RBN A;  3UMI A;  5E33 A;  5AC4 A;  2GA0 A;  2YLG A;  3I5Q A;  1QKR A;  1QLE C;  4GEH A;  2YKZ A;  4MVZ A;  3KYJ A;  1AVO B;  4W8K A;  2XXA B;  4R32 A;  2AWY A;  3RFY A;  3EZH A;  3N24 A;  3JRM O;  2L6H A;  3QZC A;  2JX0 A;  2XL8 A;  4YT5 A;  3FOP A;  3SEO A;  3EGX A;  4KNW A;  4MTO A;  1R5I D;  4PFP A;  2XLH A;  3T9O A;  2J0W A;  1OW6 A;  3M4B A;  2XLW A;  4DBR A;  1OCC C;  3JRT A;  4RD9 A;  3B0U X;  4K7B A;  2IOQ A;  1FAP B;  5FZT A;  2EPL X;  1NFO A;  2NPU A;  2X51 A;  3I4U A;  4CJG A;  1TKN A;  4LDK A;  2ICW G;  2M4E A;  2VCC A;  4I1M A;  4J7Y A;  3U2M A;  3U3B A;  5DQZ A;  1VTM P;  3AOU A;  1MND A;  4MTF A;  5K0I A;  3TOM A;  5KYW B;  3Q7L A;  1LS1 A;  3U9J A;  1NSG B;  2Q9C A;  3J06 A;  3IQT A;  1TQG A;  4NQF A;  4XLP F;  1Z63 A;  2WZG A;  4O6M A;  2HJ3 A;  1FFT C;  2VCB A;  1D0Z A;  2YL1 A;  1AUE A;  5L0G A;  2PX3 A;  4E17 A;  1BBH A;  1OXB A;  1PV3 A;  2EPO A;  2MWQ A;  1V74 B;  2WB7 A;  2WL8 A;  3LS0 A;  1I5N A;  5L0I A;  5KYX A;  1RXQ A;  1VMA A;  4D4X A;  3MLG A;  2VH3 A;  1OKK D;  3JTL O;  4U5C E;  1VB5 A;  2V26 A;  5L0F A;  3IQ6 A;  2R03 A;  1OXK A;  3N0T A;  1ZHT A;  4U5F E;  2LD6 A;  4JE9 A;  2RSE B;  4L6R A;  1EKY A;  2DB4 A;  1SZI A;  3AGT A;  2EPK X;  4BJT A;  2QUP A;  5L0J A;  4FES A;  2XLE A;  2J8W A;  1RKE B;  4OIN F;  3GM3 A;  2JPU A;  2I15 A;  2R7O A;  2XS1 A;  3IEE A;  3ASN C;  1VLT A;  2QE9 A;  3UMH A;  3ZG1 A;  4BJ6 A;  3V7O A;  2GWW A;  3SXK A;  2ZPA A;  1LS4 A;  3UR3 C;  1E85 A;  3VM6 A;  4XEV A;  3FDQ A;  2LFD A;  1M2O A;  2KYH A;  2NUT A;  1S7Z A;  3ZQV A;  4DBQ A;  5DS6 A;  4IAQ A;  4DVZ A;  2ETS A;  4RDA A;  1R4T A;  1QZX A;  2KGO A;  4E0I A;  4FAP B;  1HW1 A;  1GGQ A;  1LI7 A;  3HLZ A;  3NYM A;  3SZR A;  3HJC A;  4X0R A;  1KNY A;  3R2P A;  2PX0 A;  3EG9 B;  2YLI A;  1AEP A;  1YAR O;  3T4R A;  4B6I A;  3N2Z B;  2XLV A;  3RQG A;  2R7Q A;  4YL3 A;  3EQL F;  4ANJ A;  3DE8 A;  1GS9 A;  3DD7 A;  3HNL A;  3ZTZ A;  5EGY A;  4CIP A;  3UGO A;  5JT4 A;  2QLA A;  2ZXW C;  4XPY A;  2HV6 A;  4LAC B;  1ZW2 A;  3TK0 A;  3UMK A;  3DI5 A;  3PHF 2;  1H9T A;  3IPM O;  4JTA B;  4QDL A;  4CS7 A;  3DMD A;  2W9Y A;  2Q9B A;  3MX3 A;  2R02 A;  3EGD A;  2LP4 A;  1ZU4 A;  3B0P A;  1FFH A;  4Z9H A;  1EQ1 A;  1Z3I X;  1NG1 A;  4KBL A;  3RW0 A;  3Q6M A;  3LES A;  2Y69 C;  1CPR A;  3POV A;  4JTC B;  1PCX A;  3R7C A;  3U8P A;  3HNJ A;  3FVY A;  2QY9 A;  4NY3 A;  3ZWI A;  1JR8 A;  2CGE A;  4EHP A;  1H7I A;  2KW3 C;  4FWV A;  1T6I A;  3PDM P;  3DKA A;  2HKV A;  1Q0K A;  3NYL A;  5A6J A;  3DM5 A;  1GM5 A;  2NUP B;  4AL0 A;  2ZXR A;  4EBJ A;  3V5Y A;  1ZVZ A;  2G3K A;  2ZXO A;  2OJE D;  3GAN A;  4O6N A;  3U3F A;  4E0H A;  2HSB A;  4EBK A;  4OIQ F;  2Q4F A;  5B1B C;  2L81 A;  3A11 A;  3ITF A;  4N06 A;  4AE4 A;  1MMD A;  1MMN A;  2IXM A;  1F1M A;  4NTB A;  3NMI A;  3GEH A;  2Z15 A;  1S05 A;  4YL0 A;  3S90 A;  2J46 A;  2LCH A;  4YK5 A;  3W8I A;  2KNH A;  1O5H A;  2Y3G A;  2PNO A;  2WVO A;  1A7D A;  4WGY A;  1APC A;  1FTS A;  1ZHW A;  2Y3H A;  1A7E A;  4NTF A;  3EPV A;  1LVK A;  2M64 A;  5D92 A;  3V5X A;  1CPQ A;  3K33 A;  5L3V A;  1E86 A;  4JEA A;  1TFK B;  4MND A;  4XTK A;  1BR4 A;  2R7R A;  2CDQ A;  2P1A A;  4IAR A;  1HY5 A;  1NFN A;  1YLM A;  2W45 A;  5JVE A;  2EPN A;  2QNL A;  2P61 A;  2CW0 F;  1WOL A;  3L8I A;  3Q7G A;  3W2V A;  5A6B A;  1U89 A;  4BJ5 A;  5HV9 A;  3NMJ A;  1IZM A;  3RYL A;  5L0H A;  3UGP A;  5BUO A;  1WWP A;  2XL6 A;  2G3V A;  1Y4C A;  3ASO C;  3F46 A;  4JUR I;  4K1O A;  4Z9J A;  2YEV A;  4PAC A;  3LUT B;  2H7O A;  1HMO A;  3MYF A;  3JZ0 A;  2WVN A;  3W2W A;  2BL2 A;  3GWN A;  1LM3 B;  4GYT A;  1U6H A;  5KYU A;  3DWW A;  2EPM X;  2YL0 A;  4XPX A;  4JEB A;  5EHH A;  1RMV A;  5DS5 A;  2LSE A;  1L3P A;  5T3W A;  1RJ9 B;  2P6V A;  1XWJ A;  2L9J A;  4HFK B;  3C62 A;  4MVQ A;  4LLC A;  3B29 A;  1TWC A;  1ZZP A;  1M2V B;  1HE1 A;  256B A;  4H4K C;  3T6G B;  1C03 A;  1HW2 A;  1A41 A;  4ZLD A;  2LFF A;  2H7V C;  3BEH A;  3DJU B;  3G4Z A;  3IQC A;  3NKD A;  5AGF A;  1CGM E;  1LPE A;  1Q0M A;  3VF0 A;  1Z23 A;  2OJQ A;  2XSE A;  3C8Z A;  3E9V A;  1JPJ A;  1VYK A;  2L6F A;  2VB6 A;  3EFO B;  3NMK A;  5BQG A;  1JPN A;  3FAP B;  3S28 A;  2HMZ A;  2VAS A;  4ER9 A;  1I4Y A;  5DLJ A;  1JRA A;  1YJG A;  4PR9 A;  5COM A;  3DXJ F;  3ECS A;  1H6G A;  4ONS A;  3S0X A;  2V3C C;  1A0B A;  1B68 A;  2HSQ A;  4JW1 A;  4XEK A;  4C3E A;  2Q9A A;  3QMK A;  1DOV A;  3RIP A;  1LKX A;  4CS9 C;  1VYI A;  3WAQ A;  2A68 F;  5A69 A;  3K1H A;  4IGG A;  4BJ1 A;  4DRJ B;  5L0D A;  4W8P A;  2G62 A;  2KC3 A;  4O7G A;  3LNR A;  2AP3 A;  1YZC A;  4Z9I A;  4J32 B;  1M6T A;  5D91 A;  3S29 A;  2OG2 A;  2L7A A;  3PMR A;  5E3A A;  4N4W A;  3ZVR A;  5FCL A;  1O3U A;  4WJ0 A;  2R7V A;  5F28 E;  2H7B A;  1QPU A;  1WGW A;  3C8G A;  1OCR C;  2Q00 A;  2D4U A;  4P9F A;  3SXM A;  2MYS A;  2I8B A;  4DVY P;  2D5R B;  4JJF A;  3G50 A;  1BR2 A;  4PK4 A;  4P9T A;  3FXH A;  3S27 A;  1FNT c;  3JT1 A;  4ZLC A;  2YLD A;  4LLE A;  3FHD A;  5TJ5 E;  4E7S A;  1OR3 A;  4Q5S F;  4BEJ A;  4Q4Z F;  2XXA A;  4JVS A;  2W4M A;  3DE9 A;  1G4W R;  4PJN A;  5KYY B;  2XLO A;  4DOZ A;  5KYN A;  4KNV A;  3ZQY A;  3WOD F;  4OIP F;  1BDJ B;  1VOM A;  3KMI A;  1LE4 A;  2LK4 A;  4YT4 A;  3DAG A;  4XWJ A;  3US6 A;  3ABL C;  3L1M A;  4CS9 A;  4U9D A;  3ABK C;  3LNM B;  2R7S A;  4IRU A;  2R25 A;  1SR2 A;  2P7V A;  3JSZ A;  3X1O A;  2OEV A;  3K66 A;  4MVR A;  2J7P A;  4IWB A;  5T3T A;  3TD7 A;  2R7X A;  2AU5 A;  3TJ6 A;  5JS5 A;  4OD5 A;  5B3I A;  3GEE A;  3EH2 A;  1HMD A;  4U5H A;  4DRH B;  3CQZ A;  2AVK A;  2A0B A;  3KYI A;  3AQB A;  5KYW A;  4JC7 A;  4NC3 A;  4UDV A;  3B9Q A;  1Y6D A;  3HKK A;  3WG7 C;  1D1B A;  4MQ9 F;  2BC5 A;  1BR1 A;  2BE5 F;  2YZS A;  3LLK A;  4I3M A;  1ORS C;  1TWG A;  4JIO A;  3SNH A;  3W4Y A;  2Y3B A;  2RD9 A;  3EGX B;  4O79 A;  1D0Y A;  2B0H A;  1V54 C;  5DVW A;  2XRH A;  3SXZ A;  2UUI A;  3MYI A;  3NRH A;  4JCZ A;  3JCU Q;  3K7D A;  4YWQ A;  1D1A A;  2KQ9 A;  5B3S C;  2EIN C;  1C17 M;  1V55 C;  3CAX A;  2Y39 A;  5JLI A;  1YA9 A;  3O39 A;  3U2L A;  3VAY A;  1VLS A;  1TFO B;  4C7O A;  3AG2 C;  3MBG A;  4U5B E;  2WVQ A;  3AGU A;  4OIR F;  3M1C B;  4CDY A;  4MVO A;  2PFD A;  5A6A A;  3E70 C;  4NCQ A;  1FR0 A;  3GM2 A;  1RKE A;  1OW7 A;  3RQE A;  4HFF B;  1MMG A;  5CI9 A;  2IXP A;  2LIG A;  2WZF A;  5L3Q A;  2MHR A;  1ST6 A;  2J7P D;  4CIH A;  2OU6 A;  2R05 A;  3EH1 A;  2HZ8 A;  5AC5 A;  3FMS A;  4I44 A;  1FMW A;  3AQC A;  3S9O A;  2IBF A;  5IY5 C;  2HMQ A;  2J9W A;  1WAT A;  1D0X A;  4J30 B;  5KYX B;  2A69 F;  1ZU5 A;  3QVY A;  3FOO A;  1TWH A;  1QSP A;  1V4A A;  2QTV A;  1NU9 C;  3FAJ A;  2IM8 A;  2Q7R A;  4I1O B;  1RKC A;  2YL3 A;  1ZYR F;  1T9K A;  3IQ5 A;  2DI3 A;  2W4B A;  3JYY A;  2GDC A;  4EWC A;  4A2N B;  1Q0D A;  3OA1 A;  1JAF A;  2XLD A;  5B1A C;  5BQI A;  1U0B B;  2J0X A;  1ORY A;  2HV7 A;  5DS4 A;  4OIO F;  3B71 A;  4G7H F;  1G5Z A;  1C02 A;  5HSW A;  1KU2 A;  2CYD A;  2OQM A;  1SF8 A;  3EG9 A;  1TWA A;  3QTH A;  1SYQ A;  3KPH A;  3SP1 A;  4G7Z F;  2H8A A;  3JSE O;  4PJM A;  1KTM A;  1VK5 A;  1UFB A;  3ZC4 A;  1OCO C;  1NLX A;  1T01 A;  2CNW A;  4C3D A;  4Q7C A;  2F22 A;  4C3B A;  5L0C A;  3MFN A;  1WTY A;  2FFH A;  1UG7 A;  3ABM C;  3KH2 A;  3SXY A;  5BQH A;  4LDR A;  2LQG A;  3NYJ A;  4XEF A;  3LEO A;  1YYJ A;  2HUJ A;  3A9C A;  3C7J A;  3TOL A;  5F5F A;  2NUT B;  3LS1 A;  2FAP B;  3ATP A;  3LLI A;  3H65 A;  1SMY F;  4CX9 A;  4IB4 A;  1OKK A;  3KL4 A; 
#chains in the Genus database with same CATH homology
 5CI8 A;  4JJG A;  2YHS A;  3EHN A;  3NKE A;  4KI2 A;  2GFH A;  4P6I C;  3LEV A;  2PP4 A;  1O87 A;  2A6E F;  4U5E E;  4CS8 C;  5F5H A;  3L0I A;  4F4B A;  3NDB B;  1NU7 D;  3ZSU A;  2NUP A;  4YN0 B;  3HTK C;  2NG1 A;  4OD4 A;  2R7U A;  2E87 A;  1IW7 F;  3OEO A;  3AG1 C;  1W2W A;  4BJ6 C;  4YT2 A;  3EGD B;  2IXO A;  2CNW D;  3UNG C;  4YT8 A;  4G7O F;  4AX2 A;  5T1D B;  1J8Y F;  3RH3 A;  2EIM C;  4HEA J;  3CSK A;  1MMA A;  1Z6A A;  4QI2 A;  3T6B A;  1PD0 A;  2Q3T A;  1OCZ C;  3F47 A;  3ZIB A;  3I5P A;  4G0H A;  4IJJ A;  1MNE A;  4C7O B;  4CS8 A;  3CZ6 A;  2C03 A;  3VYW A;  4AE4 B;  4BG0 A;  2WZL A;  2IYL D;  1ZHY A;  2FGY A;  3LJB A;  1M56 C;  3W8H A;  1N1C A;  3X2Q C;  3K1I C;  3AG3 C;  3DZA A;  5E2Q A;  2EIK C;  4M63 A;  1RJ9 A;  4O6Y A;  4EBB A;  2JD3 A;  4LER A;  1M2V A;  3EJN A;  2OCC C;  4PJL A;  2KJG A;  3L34 A;  3T6J A;  2DGJ A;  1D1C A;  3EHM A;  2B0J A;  3EFO A;  3SYN A;  4QI0 A;  1ZHZ A;  5KYU B;  2O9X A;  4K0D A;  4CSA C;  3O6X A;  2ZXP A;  3LAY A;  2R7W A;  2J9U A;  3DAF A;  1NZE A;  4CBE A;  4PFO A;  1J8M F;  4HE8 D;  1M57 C;  3K6B A;  1Z5Z A;  4KC9 A;  1ZHX A;  4JCH A;  5DQT A;  2DYR C;  1G8X A;  3Q6N A;  3AG4 C;  2DYS C;  3B0U X;  2C04 A;  4PJJ A;  3EZI A;  4E7Z A;  2A1D D;  2PF4 E;  4FX5 A;  3B0V C;  2A6H F;  4BJ5 C;  1PD1 A;  2J9V A;  2EIL C;  4U5G A;  3JYH A;  3DM9 B;  4YJW A;  2IXN A;  1TR2 A;  3KKB A;  3RKO F;  2EIJ C;  4ULW A;  4XLN F;  5KYY A;  4CSA A;  3DJN B;  1FMV A;  2R7T A;  2Y3D A;  3GOD A;  3OWT A;  4IAO A;  4AK9 A;  2J45 A;  2XL4 A;  5E3C A;  4JZA A;  4U5D E;  4RBN A;  3NG1 A;  3UMI A;  5E33 A;  3I5Q A;  1QLE C;  4GEH A;  4W8K A;  2XXA B;  3RFY A;  3EZH A;  3N24 A;  3QZC A;  4YT5 A;  3SEO A;  3EGX A;  4KNW A;  4PFP A;  2J0W A;  4DBR A;  1OCC C;  3JRT A;  4RD9 A;  4K7B A;  2IOQ A;  2X51 A;  3I4U A;  1TKN A;  2M4E A;  4I1M A;  5DQZ A;  1MND A;  5KYW B;  3Q7L A;  1LS1 A;  2Q9C A;  4XLP F;  1Z63 A;  2WZG A;  4O6M A;  1FFT C;  1D0Z A;  2PX3 A;  2WB7 A;  2WL8 A;  2MWQ A;  5KYX A;  3LS0 A;  1VMA A;  3MLG A;  2VH3 A;  1OKK D;  4U5C E;  2V26 A;  3N0T A;  1ZHT A;  4U5F E;  1SZI A;  4BJT A;  4FES A;  4OIN F;  2R7O A;  3IEE A;  3ASN C;  3UMH A;  3ZG1 A;  4BJ6 A;  3V7O A;  2ZPA A;  3UR3 C;  3FDQ A;  1M2O A;  2NUT A;  1S7Z A;  4DBQ A;  5DS6 A;  4DVZ A;  4RDA A;  1QZX A;  2KGO A;  3SZR A;  3HLZ A;  3NYM A;  3HJC A;  4X0R A;  2PX0 A;  3EG9 B;  3T4R A;  4B6I A;  3N2Z B;  2R7Q A;  3EQL F;  4ANJ A;  3UGO A;  3DD7 A;  5EGY A;  2ZXW C;  2HV6 A;  4LAC B;  3UMK A;  3PHF 2;  4QDL A;  4CS7 A;  3DMD A;  2W9Y A;  2Q9B A;  3MX3 A;  3EGD A;  3B0P A;  1ZU4 A;  1FFH A;  1Z3I X;  1NG1 A;  4KBL A;  3Q6M A;  3LES A;  2Y69 C;  3POV A;  1PCX A;  3FVY A;  2QY9 A;  4NY3 A;  2CGE A;  2KW3 C;  4FWV A;  3NYL A;  3DM5 A;  2NUP B;  2ZXR A;  2G3K A;  2ZXO A;  3GAN A;  4O6N A;  4OIQ F;  5B1B C;  2L81 A;  3ITF A;  4N06 A;  4AE4 A;  1MMD A;  1MMN A;  2IXM A;  2Z15 A;  2J46 A;  3W8I A;  2KNH A;  1O5H A;  2Y3G A;  2WVO A;  1FTS A;  1ZHW A;  2Y3H A;  3EPV A;  1LVK A;  5D92 A;  3K33 A;  5L3V A;  4MND A;  4XTK A;  1BR4 A;  2R7R A;  2CDQ A;  2W45 A;  3Q7G A;  2CW0 F;  3W2V A;  4BJ5 A;  1IZM A;  3RYL A;  3UGP A;  5BUO A;  2G3V A;  3ASO C;  3F46 A;  4JUR I;  2YEV A;  2H7O A;  2WVN A;  3W2W A;  4GYT A;  5KYU A;  5EHH A;  5DS5 A;  2LSE A;  5T3W A;  1RJ9 B;  2P6V A;  2L9J A;  4HFK B;  4LLC A;  1TWC A;  1M2V B;  4H4K C;  4ZLD A;  2H7V C;  3DJU B;  3NKD A;  1Z23 A;  2XSE A;  3E9V A;  1JPJ A;  1VYK A;  2VB6 A;  3EFO B;  1JPN A;  3S28 A;  2VAS A;  5DLJ A;  2V3C C;  3DXJ F;  3ECS A;  3S0X A;  4C3E A;  4JW1 A;  2Q9A A;  3QMK A;  3RIP A;  1LKX A;  4CS9 C;  1VYI A;  2A68 F;  3K1H A;  4BJ1 A;  2G62 A;  4O7G A;  3LNR A;  4J32 B;  5D91 A;  3S29 A;  2OG2 A;  3PMR A;  5E3A A;  3ZVR A;  5FCL A;  4WJ0 A;  2R7V A;  2H7B A;  1WGW A;  4DVY P;  1OCR C;  2MYS A;  2I8B A;  2D5R B;  4JJF A;  1BR2 A;  4PK4 A;  3S27 A;  3JT1 A;  4ZLC A;  4LLE A;  3FHD A;  4E7S A;  4Q5S F;  4BEJ A;  4Q4Z F;  2XXA A;  4JVS A;  2W4M A;  5KYY B;  4PJN A;  4DOZ A;  5KYN A;  4KNV A;  3WOD F;  4OIP F;  1VOM A;  3KMI A;  4YT4 A;  3DAG A;  4XWJ A;  3ABL C;  4CS9 A;  3ABK C;  2R7S A;  4IRU A;  3JSZ A;  2P7V A;  3X1O A;  3K66 A;  5T3T A;  2R7X A;  2J7P A;  4IWB A;  3TD7 A;  4OD5 A;  3EH2 A;  4U5H A;  3CQZ A;  3AQB A;  5KYW A;  3B9Q A;  3WG7 C;  1D1B A;  4MQ9 F;  1BR1 A;  2BE5 F;  2YZS A;  3LLK A;  4I3M A;  1TWG A;  3SNH A;  2Y3B A;  3EGX B;  4O79 A;  1D0Y A;  1V54 C;  5DVW A;  2XRH A;  3NRH A;  3JCU Q;  3K7D A;  4YWQ A;  1D1A A;  2KQ9 A;  5B3S C;  2EIN C;  1V55 C;  2Y39 A;  3O39 A;  3VAY A;  4C7O A;  3AG2 C;  4U5B E;  2WVQ A;  4OIR F;  3M1C B;  2PFD A;  3E70 C;  4HFF B;  1MMG A;  5CI9 A;  2IXP A;  2WZF A;  5L3Q A;  1ST6 A;  2J7P D;  4CIH A;  3EH1 A;  4I44 A;  1FMW A;  3AQC A;  5IY5 C;  2J9W A;  4J30 B;  1D0X A;  5KYX B;  2A69 F;  1ZU5 A;  1TWH A;  2QTV A;  1NU9 C;  3FAJ A;  4I1O B;  1ZYR F;  2W4B A;  4EWC A;  4A2N B;  3OA1 A;  5B1A C;  2J0X A;  2HV7 A;  5DS4 A;  4OIO F;  4G7H F;  5HSW A;  1KU2 A;  3EG9 A;  1SF8 A;  4G7Z F;  1TWA A;  3SP1 A;  4PJM A;  1VK5 A;  3ZC4 A;  1OCO C;  2CNW A;  4C3D A;  4Q7C A;  4C3B A;  2FFH A;  3ABM C;  3KH2 A;  3NYJ A;  5F5F A;  2NUT B;  3LS1 A;  3LLI A;  3H65 A;  1SMY F;  1OKK A;  3KL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...