2KGTA

Solution structure of sh3 domain of ptk6
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
72
structure length
72
Chain Sequence
MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAERET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase 6
publication title The solution structure of SH3 domain of PTK6
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 3
structure length 72
sequence length 72
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kgtA00
1I0CA 1N5ZA 2DRMA 2K79A 1T0JA 2DL4A 2L3PA 2L3SA 2LX7A 1OOTA 4K11A 1G83A 2O2OA 3PE0A 3R6NA 3M0UA 1RLQC 1KFZA 1W6XA 1WXBA 4X1VA 1QKXA 4CC4B 3NPFA 1PHTA 1X27A 1SRLA 4JZ4A 4IIOA 1ARKA 2P4RA 4RTZA 1X69A 1WXTA 2DBKA 1X43A 2JTEA 2PTKA 3EG2A 2VKNA 2B86A 2J6KA 3I5SA 2J6OA 5FWCA 2C0IA 2EVRA 1PKSA 2O9VA 4OMPA 3TSWA 1SHFA 1MUZA 4CC3A 3I35A 1K0SA 3VRZA 4RUGA 2D0NA 1PRLC 1OEBA 1JU5C 1SSHA 2DE0X 2FPEA 2A37A 3LH5A 2DBMA 4LUDA 1JO8A 2PNIA 4J9IA 4AG1C 3U23A 2M51A 1G2BA 5L23A 1NEGA 3H0IA 2J05A 2RN8A 2EPDA 2FPDA 4JJBA 2SRCA 1WYXA 2X3WD 2OAWA 4R0KA 4KRTA 2RQTA 3EG0A 1SEMA 1NM7A 2JS2A 2CSQA 2PZ1A 3PVQA 4LNPA 2FPFA 1GBQA 4OMLA 4AFSC 1E7OA 5FW9A 2A08A 1M3CA 1GBRA 1B07A 1U06A 2OI3A 3EG1A 2KXDA 1XOVA 3EHQA 1AOJA 4GLMA 2F2WA 2GTJA 2GTOA 1AWXA 2DA9A 3UATA 1AVZC 3C0CA 1X6BA 1GCQC 1PWTA 2J7IA 2HBWA 3M0SA 1UE9A 2HEQA 3VS6A 4Z88A 4ESRA 2K6DA 1Z9QA 2EQIA 1SRMA 2V1QA 2C0OA 1HSQA 4J9GA 2CUDA 2FEIA 1QCFA 3H41A 1FYNA 5GJVB 1A0NB 3VS5A 2CH4W 2D8HA 4D8DA 2BTTA 2JMAA 3VS7A 2C0TA 1K76A 2ENMA 1W1FA 2IIMA 4OMMA 1BB9A 4F16A 4AG2C 1VYVA 2SEMA 2LJ1A 2H8HA 2VVKA 2LJ3A 2CT3A 4RTWA 3RBBB 2NWMA 1BBZA 1HD3A 1RUWA 2CH4A 5I22A 1OPKA 1UG1A 1WLPB 2MIOA 2RQRA 2W0ZA 4J9BA 4ORZA 2CSIA 1NLPC 1ZSGA 1H8KA 2AZSA 2DL7A 2LQWA 1UHFA 3A98A 2YUPA 2KR3A 3REBB 2F2XA 4D8KA 2DRKA 2YSQA 4GBQA 3FJ5A 4OMQA 4J9EA 3JV3A 2VWFA 1U5SA 3I5RA 5IHNA 2FRYA 5FWBA 1M3BA 2J6FA 2JMCA 4ZNXA 2DL3A 2JXBA 2LQNA 1RI9A 1AWOA 1OV3A 4JJCA 1X2QA 2ECZA 3IQLA 1AEYA 2A28A 3TVTA 1E6GA 1H3HA 3EG3A 1AWJA 3NHNA 1M30A 4HXJA 1S1NA 3ULRB 2K7AA 2LCSA 1UJ0A 1GRIA 1WFWA 2DF6A 3EGUA 1TUDA 3VS2A 1SPKA 2CT4A 1K9AA 2YT6A 2DL5A 5I11A 4JPBW 1CKAA 2A36A 4HCKA 4F17A 2AZVA 3M0RA 2LZ6B 1NEBA 3GBQA 1M3AA 2BZYA 2O88A 1CSKA 1QLYA 4AFUC 4DEXA 1X6GA 5IHKA 2KGTA 1YWPA 2EYXA 1AWWA 4RTVA 2DJQA 1U3OA 2FO0A 2RF0A 1WI7A 2I0NA 4Y92A 2JW4A 1JXMA 2D8JA 1W70A 1UHCA 2V1RA 1UUEA 1QWFA 3VS4A 3UA7A 2HDAA 3O5ZA 2GGRA 2HCKA 4JJDA 5IHIA 1ZLMA 3SEMA 2DILA 4WCIA 2EGCA 2YUOA 2LP5A 1JXOA 1UECA 1ZUYA 3THKA 1GL5A 1T3LA 1UDLA 1MV3A 3SHWA 2O9SA 3REAB 1JQQA 4FSSA 1AZGB 4M4ZA 1UJYA 2KROA 3M0QA 2F2VA 2J06A 3TSZA 1OPLA 1V1CA 5IH2A 2JM8A 3UA6A 1BU1A 2X3XD 1BK2A 1LCKA 2ABLA 2MOXA 2KRNA 3H0HA 1T0HA 3VS3A 1AD5A 4CC7A 3QWYA 2ED0A 1UTIA 4LUEA 2CUBA 1FMKA 2D1XA 2KXCA 1K1ZA 2ROLA 1PNJA 3M0PA 4JZ3A 4F14A 2KBTA 4LN2A 2JS0A 5IXFA 1SHGA 1ZUKA 2KRMA 1TG0A 2KRSA 4AFZC 4J9CA 2DL8A 1J3TA 2DM1A 2E5KA 1IO6A 1UFFA 2L3QA 4AFQC 2K2MA 1K0XA 4DEYA 2KT1A 2K9GA 2GNCA 4OMOA 2KEAA 2FRWA 1YP5A 4LE9A 1NG2A 2CDTA 4RTTA 2DVJA 2DYBA 3CQTA 4Z89A 2KE9A 2DLPA 2BZ8A 2EYWA 1VYTA 1ZBJA 3UF4A 1WIEA 2CREA 1PKTA 3NGPA 2M0YA 2YUQA 2KT8A 3VS1A 4HVUA 2RQVA 2RMOA 4RTXA 5ECAA 2YUNA 2EKHA 2KYBA 1EFNA 2QDLA 2EYZA 2OJ2A 2K3BA 3RNJA 1NLOC 1T3SA 2LMJA 2ROTA 2EYYA 1Z9ZA 1AZEA 3M0TA 1GCQA 4J9HA 2W10A 5IXBA 1YWOA 1M27C 4QT7A 1WXUA 1ZX6A 2JM9A 1NYFA 1QKWA 1GCPA 1NYGA 2KNBB 2EGEA 4J9FA 1H92A 2AK5A 2DNUA 1WDXA 2L2PA 2L0AA 2ED1A 1YN8A 2NUZA 3I9QA 4IIMA 1KSWA 2ESWA 1YNZA 2RNAA 1PRMC 1X2KA 5GJWB 5EC7A 2GQIA 2AKKA 4Z8AA 2O31A 2LNHB 3EHRA 2AKLA 2RQUA 2XMFA 1YCSB 2EGAA 5HCKA 3KFVA 2G6FX 3NMZC 2BZXA 4EIKA 1ZUUA 4A63B 1QWEA 3PVLA 4HVWA 4RTYA 4CC2A 2JT4A 3ZL7C 1B3QA 1WX6A 2GBQA 1JEGA 4HVVA 1HJDA 1Y57A 2DX1A 2YDLA 2MCNA 2EBPA 4RTUA 1ABQA 1GFCA 1RLPC 1E6HA 3H0FA 2HSPA 2RQWA 4J9DA 1WA7A 1TUCA 2DMOA 1MV0B 1VA7A 2RPNA 1Y0MA 2EW3A 1ABOA 2KYMA 4E6RA 3VS0A 1GFDA 4OMNA 3VRYA 1I1JA 2LJ0A 1KJWA 1VYUA 1CKBA 1KIKA 1UGVA 1M8MA 1I07A 1K4US 2FG0A 3QWXX
chains in the Genus database with same CATH superfamily
4X34A 1XJWB 3OSVA 3OMCA 2L3PA 2LX7A 3CCEQ 1WHJA 5KYUB 1YJWQ 1G83A 1TTHB 2ZPHB 3M0UA 4D6WA 1C6VX 3QDFA 1W6XA 1VQPT 4X1VA 3CCMT 3OYDA 3NPFA 5GAN3 2QQBA 1TOVA 2JTFA 4Y91A 2QA4Q 1VQ7A 3PFSA 4KUIA 4PLLA 4RTZA 5CIUA 3D7SB 4ANJA 1K8AR 3JCMV 3EG2A 3UDCA 2B86A 5D7UA 3FDRA 2XDPA 2J6OA 3I5SA 4X9DA 3JCMW 3VJPA 2BE9B 2QDYB 2CKKA 2F5TX 5FWCA 2EQKA 3CD6Q 1SHFA 1QQJA 4CC3A 3I35A 3EH1A 2OAUA 1K0SA 3VRZA 4RUGA 2DIQA 2RI3A 4C0GA 1VQMT 1VQ5A 1SSHA 2DE0X 2LT4A 1PD0A 3MHXA 3CC2A 3LH5A 2E6NA 1JO8A 2PNIA 2DFUA 4J9IA 2COZA 1NJIR 3CCRA 2QGFB 3NTHA 1NEGA 3OYLA 4JJBA 2FPDA 1Q82R 2X3WD 1MNEA 3G1JA 4KRTA 3SWNC 2CSQA 5CKEA 3MEVA 3CC7Q 5GANe 5I2MA 2HKQB 2RD1A 2R58A 2A08A 1M3CA 3META 5CKBA 1KK7A 1B07A 1U06A 3E9GA 3EG1A 1IGQA 1IRXA 4GLMA 2F2WA 3KXTA 2E70A 2GTJA 3ME9A 5KYNA 4AMCA 4LDXA 1IB8A 3UATA 3C0CA 3BE3A 3CXCA 1FX7A 1GCQC 1PWTA 2J7IA 4FM4B 3RESA 3CCJA 3M0SA 1KQSP 4XTVA 1LOJA 2K6DA 3X24B 1Q7YR 2EJGA 1HSQA 2K5LA 2CUDA 1UGQB 1YJ9A 2E6ZA 1RADB 4BUGA 2K5IA 5GANj 1ZSZA 3VS5A 1K8AU 3PGGA 5GAMd 2ZGWA 2JMAA 2DJZA 1VIFA 3CC4T 3ZBDA 2ENMA 1W1FA 2H3EB 1VQKA 1BB9A 3HP9A 4B9WA 1VYVA 2H8HA 2PQWA 2LJ3A 3JCMQ 4RTWA 2DTOA 5GAOm 5FU7C 4OMFB 3CMEQ 4DOWA 2W0ZA 1RI0A 2YRDA 4TVRA 1YFNA 1XQHA 1QCOA 2AZSA 2KAFA 2LQWA 1NBEB 3QO3A 3JV3A 3S3NA 2VWFA 2O01E 2JMCA 2DL3A 5GAN5 1OV3A 2DXTA 1KC8C 1BKBA 3QJYA 3BFMA 4ZTFA 1M9SA 1AEYA 3I55A 3ZEHA 3TVTA 4PJOG 1VQ7T 3TCJA 1M90R 1H3HA 1EX4A 4DA4A 1M30A 1K73C 2YHTA 3ULRB 2K7AA 3A8LB 2X4XA 1V29B 3QIIA 1PC0A 1BIBA 3VS2A 1X01A 2YT6A 3CMAA 4FU6A 4NS5A 4C92G 4F17A 4C5EA 2LZ6B 4PJOA 3CC2T 1XNIA 3PNWC 2BZYA 3EFOA 3CCRT 2GF7A 3L1AA 4AFUC 2WSFE 2HQXA 5LJ3d 5IHKA 4ME7A 1YWPA 2A3LA 2JVVA 2EYXA 1G3SA 1QVPA 4YTLA 4OB2B 5CAIA 1VQNQ 5AYFA 2FO0A 2I0NA 2M16A 2CZ0B 2V1RA 4FYXB 4PJJA 1MMDA 2HDAA 2ZCFB 3UA7A 1I5OB 2AT1B 5IHIA 1ZLMA 4BE2A 4E7HA 2YUOA 2DD5A 2LP5A 1UECA 1GXIE 1ZUYA 1N27A 1D1CA 1GL5A 1MMGA 4JLGA 3REAB 2VB6A 2ZPIB 4M4ZA 3CPWP 3UWNA 1UJYA 2K3YA 3CCJT 5KYYB 4FL6A 2C06A 4F7UB 1TXQA 2L3RA 4J7FA 3V7SA 5GAOp 1ZA1B 1TWBA 3A8OB 2J06A 3OYYA 3CCSQ 4M77B 6AT1B 1VQLQ 2RI5A 3G6EA 4MMKA 1Y96A 4E47A 5LJ5e 1YJ9T 3HRSA 2QEXA 1I5LA 3L2VA 2ED0A 1UTIA 1M90U 2CUBA 1FMKA 4PJOD 1PD1A 4E2FB 8ATCB 4M7DC 4QQDA 1YJNA 3MEWA 3EGDA 2RJDA 4CRIA 3QG1A 5IXFA 4PJOE 3I56A 1ZA2B 1KHIA 3JCMd 2COWA 1LPLA 1N8RC 2DM1A 3OW2S 1I8FA 1YHQA 4J8OA 2LVMA 2L3QA 4C92D 1U8RA 2K2MA 3CPFA 1H3ZA 3PMIA 3OYFA 2KEAA 4IUPA 4LE9A 4LDVA 3DB4A 2ZPBB 4WF2A 3RKWA 4C5GA 3RIRA 4ZGDB 1NE8A 4C92E 4DOVA 5CCAA 1RAGB 2BZ8A 2EYWA 5A2QE 4B9XA 3M53A 1WIEA 2BKDN 2CREA 1PKTA 1QW1A 4MDWA 1WHLA 4XTWA 5ECAA 4E7IA 2V26A 2RB6A 2YUNA 3GIBA 3I55T 3X28B 4DQ2A 2OJ2A 2LMJA 1H641 3TU4K 4QW2A 1I4K1 3MPUB 3G71A 1YITA 2DPPB 5J3BA 4M7DG 1YWOA 1ZX6A 1NYFA 1QKWA 2M02A 1Q86C 2RHZA 2OTJA 3QUIA 2AK5A 1RACB 4O5VA 5GANf 2L2PA 2LX9A 3CMAT 4M78C 1YN8A 2NUZA 7AT1B 1KSWA 2DZ9A 1OZ2A 2MPXC 2RNAA 2QA4A 3P8DA 1X2KA 3CCVQ 5EC7A 2QXFA 4Z8AA 4A4KA 4KH1B 3CCLQ 5FLXE 4Y28E 3EHRA 4PJMA 1WJRA 3PIOA 1Q81C 1VQ4Q 5HCKA 1AT1B 1S72A 2G6FX 3CD6A 2CP7A 1UEBA 5KYUA 3QHSA 1BI3A 1O9SA 4HVWA 4ZGEB 3CCUA 1NJIC 4FT2A 1WX6A 3G4SQ 2DX1A 2MCNA 2YRCA 2DZCA 2HAXA 1ABQA 1Q82C 2HSPA 2V8JA 3FC3A 2WSCE 1JJ2S 1MV0B 1K73R 4JJNK 4WTOB 2PVDB 1OU9A 1VOMA 2KYMA 3HRTA 4X9CA 3OA6A 1HXDA 4IUVA 3DLMA 1I1JA 2LJ0A 4Q5WA 3G6ET 1VQ8A 1K4US 1HK9A 2FG0A 4OB3B 3OS1A 4PLIA 3GLXA 1N5ZA 1NPRA 2DRMA 5FU7B 4PJNA 1RAHB 2K5FA 2EQJA 1BIAA 4C8QG 2FB7A 3PE0A 1YI2A 5D6WA 4M75G 1WXBA 1VQ6Q 4M7DD 2RHIA 5DLQE 2E3HA 2E5QA 1VQOQ 3ZFJA 2D6FA 3MO8A 3CXCP 4NL2A 2P4RA 3MEUA 1X69A 4HCZA 2JTEA 2PTKA 1YHQT 3CPWA 4M7DE 1N6AA 2X4WA 2C0IA 4OMPA 1PKSA 3TSWA 4C8QA 3S3OA 2M0OA 2P84A 4M75A 2GFAA 1OEBA 5KYWB 4KT0E 1WPYA 1VQ9T 4BD3A 2NLUA 2A37A 1JBMA 5I2SA 2M51A 2XD0A 3RKXA 1KC8U 3H0IA 2RN8A 2SRCA 1WYXA 3EGXB 4JS4A 1OI1A 2OAWA 1BI1A 2ZPEB 4M7AG 4XU2A 5GAN2 3V8JA 3JCMX 3G71T 3ASKA 2FPFA 1C1AA 5M9OA 3M5AA 2MMPA 1E7OA 3OYEA 3OYMA 1GBRA 3PMTA 2P0QA 2NYSA 1M2VB 3EHQA 1AOJA 3SD4A 2VYTA 5GMKi 2QQ9A 2OTJT 1YIJQ 2DA9A 5GANh 2AHJB 4F7UF 1X6BA 4XU3A 3JCMJ 4GLKA 1N8RR 3SFMA 4M78D 2GCXA 1UE9A 4M77F 3MJXA 2CZ7B 3VS6A 2LTOA 2DXUA 2VGMA 1Z9QA 2D0QB 2EQIA 1KG1A 2LNVA 4M78E 1WGSA 1QCFA 1S72T 4M75D 2VXEA 1M1KR 3WVEB 3JB9I 1SF9A 3H41A 5GJVB 4J6XA 1A0NB 2CH4W 1R77A 3CCUT 4C8QE 3A1PA 5KE3A 2C0TA 2IIMA 5LJ5f 4M75E 2K57A 3SB2A 1MGQA 2R5MA 3A5ZB 3RBBB 1HD3A 1RUWA 5CR2A 2WSEE 4KGZB 4IUTA 1WLPB 4ATOA 4CI0C 1VQNA 4R56A 1Q86R 2DL7A 1UHFA 2YUPA 2KR3A 2F2XA 3P8HA 1VQ8T 4MZPA 2P0PA 4J9EA 4HT9A 1OX9A 2FRYA 2DO3A 2B8AA 3JB9J 4M7AD 2J6FA 4LXCA 3M57A 5DY9A 5LJ5g 4VUBA 1N9RA 2CZ1B 2X9HA 2E64A 1YI2T 3JCMc 2ECZA 4RKUE 2A28A 1Q81R 4M7AE 3BDLA 3CCSA 2X4JA 2LC4A 2DKGA 2IG0A 1VQLA 3RKYA 3GOXA 1RABB 2RHXA 4PKCC 2DTIA 4HXJA 2E4HA 1VUBA 2DXCA 2LCSA 3GNFB 3HHTB 1GRIA 5GMKl 3EGUA 4ZTJA 2QTXA 2CT4A 2AIRB 1K9AA 4EMHA 5I11A 3M0RA 1M3AA 3HSBA 4XK8E 1QLYA 4DEXA 2LCLA 2Y90A 2JW4A 2D8JA 2WACA 2RA2A 2PUKB 4KUDK 4M78B 2YLBA 1VQPQ 1QWFA 3QYHB 3CCMQ 3O5ZA 5HK0A 4JJDA 3SEMA 2Y4YA 4WCIA 4Z02A 1Q86U 3OYCA 3HFOA 5CK9A 2XKOC 2RHUA 4ELZC 1KQ2A 4PJOC 4HCCA 4XQ3A 2KROA 4LDYA 1JJ2P 3M0QA 1OYXA 2MYSA 1D3BB 2NUTB 3Q1JA 3OQ5A 5IH2A 3EAEA 3EFRA 1VQMQ 2EAYA 1LCKA 1W2BS 2ABLA 1IREB 4QVDA 2MOXA 3VS3A 3H0HA 3CCQA 4RMOA 1Q81U 5GAMg 4C92C 4CC7A 1U1SA 4PNOA 1C0MA 1QP2A 2CP0A 2KXCA 2RJCA 2HNIA 3VKIA 3M0PA 1NJIU 2KBTA 5LJ5h 3CCVA 2JS0A 2NUPB 1RL2A 1QVGS 1Q82U 1RAEB 1TG0A 2Z0WA 4AFZC 3NFCA 1VQ4A 3ER0A 1UFFA 4AFQC 3N5BB 1K0XA 2KT1A 2GNCA 4P5NA 4EMKA 1BI0A 4FYYB 1LNXA 2DYBA 2XHCA 4C5IA 2QYZA 2MWPA 1ZBJA 2EWNA 2HMAA 3NGPA 3OYBA 2YUQA 4RCBA 4HVUA 2RQVA 4RTXA 3VUBA 3P8BB 4PFPA 4PFZA 2EKHA 5FRMA 2EYZA 1Q7YU 3MP8A 2ROTA 3SDZA 1VQ5T 3PT9A 1Z9ZA 2DAQA 2JN0A 3CC4Q 1AZEA 1WJQA 1GCQA 3M59A 2F5KA 1SG5A 3OW2A 4QT7A 1Y71A 2DK3A 4PL6A 2KNBB 2EGEA 2RM4A 4DBFA 2HSEB 2EQMA 3S3MA 2L0AA 2ED1A 3I9QA 4IIMA 4GY5A 1PRMC 3WVDB 5GAOl 1VQOA 5LJ3g 5GJWB 2GQIA 2RQUA 2XMFA 2QQSA 3FEOA 2EGAA 4O6JA 2XI9A 3KFVA 2VXFA 3CBOA 2DXBA 4UC4A 4EIKA 3X25B 3PVLA 4CC2A 1B3QA 1JEGA 1HJDA 4HVVA 3QXEB 1VQ7Q 4RTUA 1GFCA 1WHGA 2RQWA 3CBMA 4DBHA 3JCMP 3H8ZA 2DTHA 4NOYA 2M1HA 4E6RA 2YRVA 4M7DF 1GFDA 3C4SA 3F70A 4OMNA 1IXDA 1VQKT 2GQVA 3RDVA 4ZN1A 3CC2Q 5KYWA 3CCQT 3QWXX 3CCRQ 4IUUA 4BY6C 1I0CA 2K79A 1T0JA 4HCBA 2DL4A 4N4IA 2RI2A 5KE2A 1IZ6A 4HKEA 2JOYA 4K11A 4II1A 2O2OA 1RLQC 1KFZA 3OYHA 3QZ5B 4KGVB 4CC4B 4QVCA 5LJ5j 1SRLA 1R8OB 4IURA 5L8RE 4IIOA 1ARKA 1WXTA 3QSUA 1M1KC 2DBKA 4J6YA 4E7LA 4KULA 2E41A 2VKNA 1OULA 1JJ2A 2P4TA 3OYIA 2XIDA 3M58A 4FYWB 3FB9A 2OTLA 2KDSA 2VUBA 5J39A 3CCJQ 2DETA 2KY9A 1PRLC 1IHWA 4IKFA 1JU5C 2FPEA 1PSEA 4LUDA 1PG5B 3E1SA 4AG1C 2FZKB 3U23A 3QJ6A 1V76A 5L23A 1UGRB 1YJ9Q 3CCEA 1D1BA 1KQ1A 1YJWA 4BI4A 1PCXA 1OQKA 3EG0A 4M78F 5CKHA 3O8VA 3C94A 4A54A 1K9MR 2MI6A 3DLLA 3SWNB 3PVQA 1QCNA 4QQGA 1FMVA 1GBQA 2G3RA 5FW9A 4A4EA 4C8QC 5GAMe 2OI3A 2KXDA 5CKDA 1UB4A 1WQWA 2I2LA 4M75C 3OYKA 4IUQA 4L59A 1LVKA 2X35A 3MP6A 2RJFA 4FT4A 2HBWA 2EJ9A 3HRUA 2BE7D 3LWIA 4FW2A 4Z88A 4ESRA 1WHMA 1SRMA 4N0AA 2L5QA 2V1QA 3HL8A 2C0OA 3T9NA 4J9GA 1FMWA 3GNGA 1MHNA 5GANd 3HPWA 1RAAB 2HD0A 1FYNA 1KQSS 4PJOB 3HTRA 2K3XA 5IAYA 2R57A 3CC7A 3VS7A 3I55Q 5GAMj 3E19A 4XAXB 1N9SA 4AG2C 3DKMA 2VVKA 2DIGA 3VV0A 4DBQA 2LCCA 3LW5E 4MMLA 2NWMA 4M7AC 1BBZA 1UGSB 2CH4A 1QP3A 2QEXT 2MIOA 1UG1A 3URGA 1WHHA 3NTIA 4ORZA 2CGHA 2LQ8A 3L42A 4C92B 5GMKe 2CSIA 1NLPC 1ZSGA 3CMAQ 3A98A 4L5GA 5AT1B 3REBB 1YJNT 3CCMA 2YSQA 1IGUA 4GBQA 4OMQA 2FVUA 3L2UA 3I56T 3I5RA 5IHNA 4N4GA 4ZNXA 3EG9B 1RI9A 1DJ7B 1G3WA 4E7ZA 3OBWA 1ACMB 4JJCA 1X2QA 2RH2A 3LH0A 4KGXB 2LT1A 2DVEA 3IQLA 4A4GA 2RHYA 1JRIA 5LJ3e 1IHVA 2CP5A 4J5YA 1WZOA 2HL5C 1E6GA 3A8GB 1M1GA 1D0ZA 4BDYA 1AWJA 3RR6A 4BB7A 3OBYA 3CMEA 4ZN3A 1ZHIA 1UJ0A 2CP3A 1WFWA 4BE0A 4RG2A 3EGDB 2OTLT 3FRNA 1AHJB 1SPKA 1QVFS 2DL5A 1MMNA 3RMQA 1CKAA 2A36A 4PK4A 2EYQA 3A8MB 5HK3A 2AZVA 3QZ9B 1NEBA 1YITT 1G8XA 3JB9H 1M2OA 3G6EQ 4FSXA 3M9QA 4B6MA 5CVIA 4XU0A 2O88A 1K73U 3CCET 2KVQG 1YJWT 2FYKA 5LJ3j 2DJQA 1U3OA 2RF0A 1WI7A 1UHCA 1BCMA 3JB9G 4A53A 3RMSA 1UUEA 4PFOA 2QA4T 3VS4A 4JUVA 3CBPA 3VYGA 2GGRA 3M55A 3QYGB 1FWZA 1O75A 2EGCA 3VUZA 3L2ZA 4C8QD 2ATCB 5D6XA 3THKA 1YHQQ 1MV3A 4AT1B 3SHWA 4BACA 2O9SA 1JQQA 3OY9A 3CD6T 3JCMe 1I81A 4E7KA 3EFSA 3LGFA 4BDZA 3C12A 3TSZA 3CC4A 2LRQA 1VQ9Q 2JM8A 1BU1A 4A4FA 2FHDA 4XTXA 2XDDA 2VASA 1FXXA 5A0LA 1AD5A 3QWYA 1QMCA 4LUEA 3OW2P 2VC8A 2KI7A 1K1ZA 3KUFA 2ROLA 3CC7T 1KHCA 1PNJA 3V7RA 5CKFA 4M7DB 4MZMA 4NL3A 3G71Q 1SHGA 2KRMA 2JNGA 4JRKA 2X51A 4RG8A 3OYJA 1ZSZC 1J3TA 2E5KA 1IO6A 2QGGA 4BY6B 3E9FA 4PJLA 2E1HA 2OTJQ 2V8IA 2JJ9A 4JRPA 5LJ5d 3M54A 4LDUA 2MWOA 1NG2A 1Y07A 3OYGA 4F7UG 2DVJA 1WJSA 3QBYA 1W2BA 2DLPA 3H9NA 3HKSA 2HL3A 4M77G 3UF4A 2KK4A 1YCYA 3LYIA 3V8KA 1W4SA 1N8RU 3JB9D 1YBYA 3VS1A 3R6OA 2RMOA 1S72Q 1M1FA 5GAN8 2DEQA 2GFUA 1EFNA 2QDLA 2K3BA 3CCUQ 3RNJA 1NLOC 1QVGA 4J7IA 3PIPA 3OB9A 5KYYA 4F7UA 4J9HA 4MDXA 1M1KU 2W10A 5GAN7 3TREA 5IXBA 3CMET 1M27C 4M77A 1WXUA 2VV5A 4OP0A 2QASA 4EMKC 9ATCB 1GCPA 1NYGA 5GAN6 4J9FA 2DNUA 1WDXA 3TEEA 2X4YA 3NTKA 5GAMf 5A0DA 1VQ8Q 3CEYA 2E65A 3TQ7P 2O31A 2XK0A 1TS9A 2XG8D 3V7CA 3JCMb 1D0XA 2AKLA 2DERA 3JAME 4C8QB 5FROA 3EH2A 1YCSB 4M75B 2LDMA 5I21A 3GP8A 4PJOF 3NMZC 4LD6A 4OGEA 1YI2Q 4A63B 2RJEA 4RTYA 3ZL7C 3AHUA 2GBQA 3FIFA 2YDLA 2EBPA 1RLPC 3GF5A 1B34B 3INZA 4F04B 4J9DA 4C92F 1K9MC 2R5AA 2RPNA 1RAIB 1PM3A 1ABOA 5KYXB 2IPOB 5KH6A 4M77D 4BI3A 4A4HA 1KJWA 3BW1A 3FLGA 1B7TA 2ZPGB 3CCLA 1P92A 4F7UE 4C0DC 1G5VA 4QQ6A 4MZTA 5CQYA 4M7AB 4M77E 4BE1A 1VQNT 2L3SA 2QG9B 1OOTA 4HT8A 2E10A 2MK5A 4EPCA 1D0YA 2BIVA 3R6NA 3OYNA 2KSSA 1QKXA 3OMGA 2CYZB 3J7AF 3G4SA 1PHTA 4QVZA 1X27A 4LDWA 4JZ4A 1NPPA 3SWNA 2QQRA 2A0FB 1X43A 3FJPA 2O4XB 1SKUB 1LJOA 1KD1C 2J6KA 5LJ3f 2KQWA 4N4HA 2EVRA 2O9VA 1MUZA 3G7ZA 1HYOA 3CCST 3CXCS 1VQLT 2D0NA 3OS5A 1QVFP 2FL7A 1PSFA 2DBMA 3OYAA 2QAZA 1XTDA 1X75C 1G2BA 2FZGB 2QTVA 3L2WA 2J05A 2EPDA 3MEAA 4R0KA 2CS7A 2RQTA 1SEMA 1NM7A 2JS2A 2MF2A 1VQ6A 3M4GA 2EJFA 2PZ1A 4LNPA 4EDUA 3DB3A 2RK1A 4OMLA 2CP2A 4AFSC 5DM7R 2EFIA 1XOVA 3QDRB 3OS2A 4FYVB 2GTOA 1AWXA 1AVZC 2FZCB 2MAMA 2KMTA 5FU6C 4OVAA 3L2QA 4C92A 5GAMh 2HEQA 2CP6A 2H3JA 4C0FA 3PTAA 2QK0A 2FEIA 5KCHA 1UGPB 3MP1A 3JCMf 3MKDA 5D6YA 3EG9A 2D8HA 3C95A 1OZ3A 2E12A 2BUDA 2BTTA 4D8DA 1R0BG 1K76A 1U1TA 4OMMA 1VQ5Q 4E7SA 1OU8A 2HKNA 4F16A 2SEMA 1BCOA 2LJ1A 2RO0A 1WHKA 2CT3A 2E3IA 5A0GA 1OPKA 5I22A 2RQRA 1EZZB 2JTMA 1VIEA 4J9BA 1YIJA 3MCAB 3X26B 4XTZA 1H8KA 4N0AC 1TSFA 4D8KA 2DRKA 3EGXA 3CCVT 2LQKA 3JCMg 3FJ5A 3HFNA 3CCLT 1U5SA 5FWBA 1M4ZA 3LLRA 1M3BA 5GMKh 1VQ4T 1MNDA 1ZSZB 2PVOB 2JXBA 3LGLA 2LQNA 5GAN4 1AWOA 3WXMB 4J83A 1KQSA 3RERA 3BY7A 1M2VA 3QKJA 4JS5A 3M4YA 2HBPA 4XU1A 3J80E 4JLIA 3G4ST 5C0MA 2F1LA 1VQ9A 5LL6S 3EG3A 3VYHB 2V8KA 2L89A 3NHNA 2DEUA 3V8LA 1S1NA 2XU8A 1WNLA 2YLCA 2PUOB 5LJ3h 2DF6A 3H6ZA 4QKUA 1TUDA 2L8DA 3E2UA 4JPBW 5GAOq 4HCKA 3GBQA 2A7YA 3RUXA 1VQKQ 3JSCA 4C8QF 1CSKA 2K2VA 3CCQQ 4E7JA 1X6GA 4HA8A 1ZBXA 2KGTA 4M75F 4OGCA 8AT1B 4C5HA 2QQAA 4EMKB 4JRQA 1AWWA 4RTVA 5HY6A 4Y92A 1JXMA 1VQ6T 1W70A 1K8AC 3JRZA 1VQOT 2XDBA 3UT1A 2HCKA 2DILA 3LX7A 4M7DA 2CZ6B 1JXOA 5J26A 4C0ZA 1T3LA 1UDLA 4FCYA 2QI2A 1W2BP 2DD4A 4FSSA 2COYA 1AZGB 1QVFA 1KD1R 4FIBA 4LD9K 1KC8R 3EFOB 2F2VA 3GPLA 1OPLA 1V1CA 3KBGA 5GAOn 4KBMB 2YWWA 3S6WA 5GANg 3UA6A 2X3XD 5HKCA 1BK2A 1QVGP 1M8VA 4ZGJB 4M7AF 1OX8A 2IVWA 1T0HA 2KRNA 3JCMh 4FW1A 4V2SA 4DBRA 4ELYC 2D1XA 2JUFA 2EKOA 1JB0E 3UPUA 5C6SA 3M56A 4JZ3A 4F14A 2ZPFB 4LN2A 2K4YA 1VQPA 3AT1B 3OSSC 1TUGB 4BI8B 4M78G 1ZUKA 2KRSA 3X20B 3L2RA 1D09B 4OF1A 4J9CA 2DL8A 3QPHA 4C0DB 3JB9F 2M9UA 1YIJT 1K9MU 4JDSA 2PU9B 5IN1A 1M5Q1 2OX7A 4DEYA 1NZ9A 1RAFB 2K9GA 4OMOA 5KCOA 1Q7YC 2FRWA 2RK2A 1YP5A 2CDTA 1Y96B 2F69A 4RTTA 5EG2A 1VQMA 3CQTA 4Z89A 2KE9A 4M78A 1VYTA 5GMKj 2P0KA 2M0YA 2KT8A 2VGNA 1D1AA 4R55A 2Y4XA 2KYBA 2HZYA 2YXYA 1MMAA 1T3SA 2ZAEA 2EYYA 3M0TA 1D3BA 2NUTA 1G3YA 1KD1U 2JM9A 4XTUA 2QEXQ 1B34A 1H92A 3J81E 2HQEA 3BDUA 1Q95G 1X6OA 3A8HB 5CO7A 2ESWA 2HQHA 2PVGB 1YNZA 3LWHA 5DLOA 1YJNQ 5KYXA 1SSFA 2AKKA 2LNHB 1BI2A 3I56Q 4RCCA 2NUPA 3VU3C 1BYMA 2JZ2A 5GAOr 1TH7A 2BZXA 2ZZDA 1M90C 4M7AA 5FU6B 1ZUUA 1F1BB 1R0CB 1QWEA 1ZQ1A 4M77C 5GMKm 2JT4A 2EIFA 1Y57A 2DYIA 5FRNA 3OS0A 4KH0B 1EIFA 1E6HA 4XTYA 3H0FA 4J6WA 4JRIA 1WA7A 3CPWS 2EQUA 1TUCA 2D9TA 2O4XA 2DMOA 1VA7A 1TU0B 1Y0MA 2EW3A 4OB0B 2OTLQ 4L6V5 3VS0A 1G3TA 4OB1B 4EMGA 3VRYA 5IT9E 1WQ7A 1VYUA 1CKBA 1Y7XA 1UGVA 1KIKA 1M8MA 5CQXA 1I07A 1YITQ 2XICA
chains in the Genus database with same CATH topology
1I0CA 1N5ZA 2DRMA 2K79A 1T0JA 2DL4A 2L3PA 2L3SA 2LX7A 1OOTA 4K11A 1G83A 2O2OA 3PE0A 3R6NA 3M0UA 1RLQC 1KFZA 1W6XA 1WXBA 4X1VA 1QKXA 4CC4B 3NPFA 1PHTA 1X27A 1SRLA 4JZ4A 4IIOA 1ARKA 2P4RA 4RTZA 1X69A 1WXTA 2DBKA 1X43A 2JTEA 2PTKA 3EG2A 2VKNA 2B86A 2J6KA 3I5SA 2J6OA 5FWCA 2C0IA 2EVRA 1PKSA 2O9VA 4OMPA 3TSWA 1SHFA 1MUZA 4CC3A 3I35A 1K0SA 3VRZA 4RUGA 2D0NA 1PRLC 1OEBA 1JU5C 1SSHA 2DE0X 2FPEA 2A37A 3LH5A 2DBMA 4LUDA 1JO8A 2PNIA 4J9IA 4AG1C 3U23A 2M51A 1G2BA 5L23A 1NEGA 3H0IA 2J05A 2RN8A 2EPDA 2FPDA 4JJBA 2SRCA 1WYXA 2X3WD 2OAWA 4R0KA 4KRTA 2RQTA 3EG0A 1SEMA 1NM7A 2JS2A 2CSQA 2PZ1A 3PVQA 4LNPA 2FPFA 1GBQA 4OMLA 4AFSC 1E7OA 5FW9A 2A08A 1M3CA 1GBRA 1B07A 1U06A 2OI3A 3EG1A 2KXDA 1XOVA 3EHQA 1AOJA 4GLMA 2F2WA 2GTJA 2GTOA 1AWXA 2DA9A 3UATA 1AVZC 3C0CA 1X6BA 1GCQC 1PWTA 2J7IA 2HBWA 3M0SA 1UE9A 2HEQA 3VS6A 4Z88A 4ESRA 2K6DA 1Z9QA 2EQIA 1SRMA 2V1QA 2C0OA 1HSQA 4J9GA 2CUDA 2FEIA 1QCFA 3H41A 1FYNA 5GJVB 1A0NB 3VS5A 2CH4W 2D8HA 4D8DA 2BTTA 2JMAA 3VS7A 2C0TA 1K76A 2ENMA 1W1FA 2IIMA 4OMMA 1BB9A 4F16A 4AG2C 1VYVA 2SEMA 2LJ1A 2H8HA 2VVKA 2LJ3A 2CT3A 4RTWA 3RBBB 2NWMA 1BBZA 1HD3A 1RUWA 2CH4A 5I22A 1OPKA 1UG1A 1WLPB 2MIOA 2RQRA 2W0ZA 4J9BA 4ORZA 2CSIA 1NLPC 1ZSGA 1H8KA 2AZSA 2DL7A 2LQWA 1UHFA 3A98A 2YUPA 2KR3A 3REBB 2F2XA 4D8KA 2DRKA 2YSQA 4GBQA 3FJ5A 4OMQA 4J9EA 3JV3A 2VWFA 1U5SA 3I5RA 5IHNA 2FRYA 5FWBA 1M3BA 2J6FA 2JMCA 4ZNXA 2DL3A 2JXBA 2LQNA 1RI9A 1AWOA 1OV3A 4JJCA 1X2QA 2ECZA 3IQLA 1AEYA 2A28A 3TVTA 1E6GA 1H3HA 3EG3A 1AWJA 3NHNA 1M30A 4HXJA 1S1NA 3ULRB 2K7AA 2LCSA 1UJ0A 1GRIA 1WFWA 2DF6A 3EGUA 1TUDA 3VS2A 1SPKA 2CT4A 1K9AA 2YT6A 2DL5A 5I11A 4JPBW 1CKAA 2A36A 4HCKA 4F17A 2AZVA 3M0RA 2LZ6B 1NEBA 3GBQA 1M3AA 2BZYA 2O88A 1CSKA 1QLYA 4AFUC 4DEXA 1X6GA 5IHKA 2KGTA 1YWPA 2EYXA 1AWWA 4RTVA 2DJQA 1U3OA 2FO0A 2RF0A 1WI7A 2I0NA 4Y92A 2JW4A 1JXMA 2D8JA 1W70A 1UHCA 2V1RA 1UUEA 1QWFA 3VS4A 3UA7A 2HDAA 3O5ZA 2GGRA 2HCKA 4JJDA 5IHIA 1ZLMA 3SEMA 2DILA 4WCIA 2EGCA 2YUOA 2LP5A 1JXOA 1UECA 1ZUYA 3THKA 1GL5A 1T3LA 1UDLA 1MV3A 3SHWA 2O9SA 3REAB 1JQQA 4FSSA 1AZGB 4M4ZA 1UJYA 2KROA 3M0QA 2F2VA 2J06A 3TSZA 1OPLA 1V1CA 5IH2A 2JM8A 3UA6A 1BU1A 2X3XD 1BK2A 1LCKA 2ABLA 2MOXA 2KRNA 3H0HA 1T0HA 3VS3A 1AD5A 4CC7A 3QWYA 2ED0A 1UTIA 4LUEA 2CUBA 1FMKA 2D1XA 2KXCA 1K1ZA 2ROLA 1PNJA 3M0PA 4JZ3A 4F14A 2KBTA 4LN2A 2JS0A 5IXFA 1SHGA 1ZUKA 2KRMA 1TG0A 2KRSA 4AFZC 4J9CA 2DL8A 1J3TA 2DM1A 2E5KA 1IO6A 1UFFA 2L3QA 4AFQC 2K2MA 1K0XA 4DEYA 2KT1A 2K9GA 2GNCA 4OMOA 2KEAA 2FRWA 1YP5A 4LE9A 1NG2A 2CDTA 4RTTA 2DVJA 2DYBA 3CQTA 4Z89A 2KE9A 2DLPA 2BZ8A 2EYWA 1VYTA 1ZBJA 3UF4A 1WIEA 2CREA 1PKTA 3NGPA 2M0YA 2YUQA 2KT8A 3VS1A 4HVUA 2RQVA 2RMOA 4RTXA 5ECAA 2YUNA 2EKHA 2KYBA 1EFNA 2QDLA 2EYZA 2OJ2A 2K3BA 3RNJA 1NLOC 1T3SA 2LMJA 2ROTA 2EYYA 1Z9ZA 1AZEA 3M0TA 1GCQA 4J9HA 2W10A 5IXBA 1YWOA 1M27C 4QT7A 1WXUA 1ZX6A 2JM9A 1NYFA 1QKWA 1GCPA 1NYGA 2KNBB 2EGEA 4J9FA 1H92A 2AK5A 2DNUA 1WDXA 2L2PA 2L0AA 2ED1A 1YN8A 2NUZA 3I9QA 4IIMA 1KSWA 2ESWA 1YNZA 2RNAA 1PRMC 1X2KA 5GJWB 5EC7A 2GQIA 2AKKA 4Z8AA 2O31A 2LNHB 3EHRA 2AKLA 2RQUA 2XMFA 1YCSB 2EGAA 5HCKA 3KFVA 2G6FX 3NMZC 2BZXA 4EIKA 1ZUUA 4A63B 1QWEA 3PVLA 4HVWA 4RTYA 4CC2A 2JT4A 3ZL7C 1B3QA 1WX6A 2GBQA 1JEGA 4HVVA 1HJDA 1Y57A 2DX1A 2YDLA 2MCNA 2EBPA 4RTUA 1ABQA 1GFCA 1RLPC 1E6HA 3H0FA 2HSPA 2RQWA 4J9DA 1WA7A 1TUCA 2DMOA 1MV0B 1VA7A 2RPNA 1Y0MA 2EW3A 1ABOA 2KYMA 4E6RA 3VS0A 1GFDA 4OMNA 3VRYA 1I1JA 2LJ0A 1KJWA 1VYUA 1CKBA 1KIKA 1UGVA 1M8MA 1I07A 1K4US 2FG0A 3QWXX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I0C A;  1N5Z A;  2DRM A;  2K79 A;  1T0J A;  2DL4 A;  2L3P A;  2L3S A;  2LX7 A;  1OOT A;  4K11 A;  1G83 A;  2O2O A;  3PE0 A;  3R6N A;  3M0U A;  1RLQ C;  1KFZ A;  1W6X A;  1WXB A;  4X1V A;  1QKX A;  4CC4 B;  3NPF A;  1PHT A;  1X27 A;  1SRL A;  4JZ4 A;  4IIO A;  1ARK A;  2P4R A;  4RTZ A;  1X69 A;  1WXT A;  2DBK A;  1X43 A;  2JTE A;  2PTK A;  3EG2 A;  2VKN A;  2B86 A;  2J6K A;  3I5S A;  2J6O A;  5FWC A;  2C0I A;  2EVR A;  1PKS A;  2O9V A;  4OMP A;  3TSW A;  1SHF A;  1MUZ A;  4CC3 A;  3I35 A;  1K0S A;  3VRZ A;  4RUG A;  2D0N A;  1PRL C;  1OEB A;  1JU5 C;  1SSH A;  2DE0 X;  2FPE A;  2A37 A;  3LH5 A;  2DBM A;  4LUD A;  1JO8 A;  2PNI A;  4J9I A;  4AG1 C;  3U23 A;  2M51 A;  1G2B A;  5L23 A;  1NEG A;  3H0I A;  2J05 A;  2RN8 A;  2EPD A;  2FPD A;  4JJB A;  2SRC A;  1WYX A;  2X3W D;  2OAW A;  4R0K A;  4KRT A;  2RQT A;  3EG0 A;  1SEM A;  1NM7 A;  2JS2 A;  2CSQ A;  2PZ1 A;  3PVQ A;  4LNP A;  2FPF A;  1GBQ A;  4OML A;  4AFS C;  1E7O A;  5FW9 A;  2A08 A;  1M3C A;  1GBR A;  1B07 A;  1U06 A;  2OI3 A;  3EG1 A;  2KXD A;  1XOV A;  3EHQ A;  1AOJ A;  4GLM A;  2F2W A;  2GTJ A;  2GTO A;  1AWX A;  2DA9 A;  3UAT A;  1AVZ C;  3C0C A;  1X6B A;  1GCQ C;  1PWT A;  2J7I A;  2HBW A;  3M0S A;  1UE9 A;  2HEQ A;  3VS6 A;  4Z88 A;  4ESR A;  2K6D A;  1Z9Q A;  2EQI A;  1SRM A;  2V1Q A;  2C0O A;  1HSQ A;  4J9G A;  2CUD A;  2FEI A;  1QCF A;  3H41 A;  1FYN A;  5GJV B;  1A0N B;  3VS5 A;  2CH4 W;  2D8H A;  4D8D A;  2BTT A;  2JMA A;  3VS7 A;  2C0T A;  1K76 A;  2ENM A;  1W1F A;  2IIM A;  4OMM A;  1BB9 A;  4F16 A;  4AG2 C;  1VYV A;  2SEM A;  2LJ1 A;  2H8H A;  2VVK A;  2LJ3 A;  2CT3 A;  4RTW A;  3RBB B;  2NWM A;  1BBZ A;  1HD3 A;  1RUW A;  2CH4 A;  5I22 A;  1OPK A;  1UG1 A;  1WLP B;  2MIO A;  2RQR A;  2W0Z A;  4J9B A;  4ORZ A;  2CSI A;  1NLP C;  1ZSG A;  1H8K A;  2AZS A;  2DL7 A;  2LQW A;  1UHF A;  3A98 A;  2YUP A;  2KR3 A;  3REB B;  2F2X A;  4D8K A;  2DRK A;  2YSQ A;  4GBQ A;  3FJ5 A;  4OMQ A;  4J9E A;  3JV3 A;  2VWF A;  1U5S A;  3I5R A;  5IHN A;  2FRY A;  5FWB A;  1M3B A;  2J6F A;  2JMC A;  4ZNX A;  2DL3 A;  2JXB A;  2LQN A;  1RI9 A;  1AWO A;  1OV3 A;  4JJC A;  1X2Q A;  2ECZ A;  3IQL A;  1AEY A;  2A28 A;  3TVT A;  1E6G A;  1H3H A;  3EG3 A;  1AWJ A;  3NHN A;  1M30 A;  4HXJ A;  1S1N A;  3ULR B;  2K7A A;  2LCS A;  1UJ0 A;  1GRI A;  1WFW A;  2DF6 A;  3EGU A;  1TUD A;  3VS2 A;  1SPK A;  2CT4 A;  1K9A A;  2YT6 A;  2DL5 A;  5I11 A;  4JPB W;  1CKA A;  2A36 A;  4HCK A;  4F17 A;  2AZV A;  3M0R A;  2LZ6 B;  1NEB A;  3GBQ A;  1M3A A;  2BZY A;  2O88 A;  1CSK A;  1QLY A;  4AFU C;  4DEX A;  1X6G A;  5IHK A;  2KGT A;  1YWP A;  2EYX A;  1AWW A;  4RTV A;  2DJQ A;  1U3O A;  2FO0 A;  2RF0 A;  1WI7 A;  2I0N A;  4Y92 A;  2JW4 A;  1JXM A;  2D8J A;  1W70 A;  1UHC A;  2V1R A;  1UUE A;  1QWF A;  3VS4 A;  3UA7 A;  2HDA A;  3O5Z A;  2GGR A;  2HCK A;  4JJD A;  5IHI A;  1ZLM A;  3SEM A;  2DIL A;  4WCI A;  2EGC A;  2YUO A;  2LP5 A;  1JXO A;  1UEC A;  1ZUY A;  3THK A;  1GL5 A;  1T3L A;  1UDL A;  1MV3 A;  3SHW A;  2O9S A;  3REA B;  1JQQ A;  4FSS A;  1AZG B;  4M4Z A;  1UJY A;  2KRO A;  3M0Q A;  2F2V A;  2J06 A;  3TSZ A;  1OPL A;  1V1C A;  5IH2 A;  2JM8 A;  3UA6 A;  1BU1 A;  2X3X D;  1BK2 A;  1LCK A;  2ABL A;  2MOX A;  2KRN A;  3H0H A;  1T0H A;  3VS3 A;  1AD5 A;  4CC7 A;  3QWY A;  2ED0 A;  1UTI A;  4LUE A;  2CUB A;  1FMK A;  2D1X A;  2KXC A;  1K1Z A;  2ROL A;  1PNJ A;  3M0P A;  4JZ3 A;  4F14 A;  2KBT A;  4LN2 A;  2JS0 A;  5IXF A;  1SHG A;  1ZUK A;  2KRM A;  1TG0 A;  2KRS A;  4AFZ C;  4J9C A;  2DL8 A;  1J3T A;  2DM1 A;  2E5K A;  1IO6 A;  1UFF A;  2L3Q A;  4AFQ C;  2K2M A;  1K0X A;  4DEY A;  2KT1 A;  2K9G A;  2GNC A;  4OMO A;  2KEA A;  2FRW A;  1YP5 A;  4LE9 A;  1NG2 A;  2CDT A;  4RTT A;  2DVJ A;  2DYB A;  3CQT A;  4Z89 A;  2KE9 A;  2DLP A;  2BZ8 A;  2EYW A;  1VYT A;  1ZBJ A;  3UF4 A;  1WIE A;  2CRE A;  1PKT A;  3NGP A;  2M0Y A;  2YUQ A;  2KT8 A;  3VS1 A;  4HVU A;  2RQV A;  2RMO A;  4RTX A;  5ECA A;  2YUN A;  2EKH A;  2KYB A;  1EFN A;  2QDL A;  2EYZ A;  2OJ2 A;  2K3B A;  3RNJ A;  1NLO C;  1T3S A;  2LMJ A;  2ROT A;  2EYY A;  1Z9Z A;  1AZE A;  3M0T A;  1GCQ A;  4J9H A;  2W10 A;  5IXB A;  1YWO A;  1M27 C;  4QT7 A;  1WXU A;  1ZX6 A;  2JM9 A;  1NYF A;  1QKW A;  1GCP A;  1NYG A;  2KNB B;  2EGE A;  4J9F A;  1H92 A;  2AK5 A;  2DNU A;  1WDX A;  2L2P A;  2L0A A;  2ED1 A;  1YN8 A;  2NUZ A;  3I9Q A;  4IIM A;  1KSW A;  2ESW A;  1YNZ A;  2RNA A;  1PRM C;  1X2K A;  5GJW B;  5EC7 A;  2GQI A;  2AKK A;  4Z8A A;  2O31 A;  2LNH B;  3EHR A;  2AKL A;  2RQU A;  2XMF A;  1YCS B;  2EGA A;  5HCK A;  3KFV A;  2G6F X;  3NMZ C;  2BZX A;  4EIK A;  1ZUU A;  4A63 B;  1QWE A;  3PVL A;  4HVW A;  4RTY A;  4CC2 A;  2JT4 A;  3ZL7 C;  1B3Q A;  1WX6 A;  2GBQ A;  1JEG A;  4HVV A;  1HJD A;  1Y57 A;  2DX1 A;  2YDL A;  2MCN A;  2EBP A;  4RTU A;  1ABQ A;  1GFC A;  1RLP C;  1E6H A;  3H0F A;  2HSP A;  2RQW A;  4J9D A;  1WA7 A;  1TUC A;  2DMO A;  1MV0 B;  1VA7 A;  2RPN A;  1Y0M A;  2EW3 A;  1ABO A;  2KYM A;  4E6R A;  3VS0 A;  1GFD A;  4OMN A;  3VRY A;  1I1J A;  2LJ0 A;  1KJW A;  1VYU A;  1CKB A;  1KIK A;  1UGV A;  1M8M A;  1I07 A;  1K4U S;  2FG0 A;  3QWX X; 
#chains in the Genus database with same CATH topology
 4X34 A;  1XJW B;  3OSV A;  3OMC A;  2L3P A;  2LX7 A;  3CCE Q;  1WHJ A;  5KYU B;  1YJW Q;  1G83 A;  1TTH B;  2ZPH B;  3M0U A;  4D6W A;  1C6V X;  3QDF A;  1W6X A;  1VQP T;  4X1V A;  3CCM T;  3OYD A;  3NPF A;  5GAN 3;  2QQB A;  1TOV A;  2JTF A;  4Y91 A;  2QA4 Q;  1VQ7 A;  3PFS A;  4KUI A;  4PLL A;  4RTZ A;  5CIU A;  3D7S B;  4ANJ A;  1K8A R;  3JCM V;  3EG2 A;  3UDC A;  2B86 A;  5D7U A;  3FDR A;  2XDP A;  2J6O A;  3I5S A;  4X9D A;  3JCM W;  3VJP A;  2BE9 B;  2QDY B;  2CKK A;  2F5T X;  5FWC A;  2EQK A;  3CD6 Q;  1SHF A;  1QQJ A;  4CC3 A;  3I35 A;  3EH1 A;  2OAU A;  1K0S A;  3VRZ A;  4RUG A;  2DIQ A;  2RI3 A;  4C0G A;  1VQM T;  1VQ5 A;  1SSH A;  2DE0 X;  2LT4 A;  1PD0 A;  3MHX A;  3CC2 A;  3LH5 A;  2E6N A;  1JO8 A;  2PNI A;  2DFU A;  4J9I A;  2COZ A;  1NJI R;  3CCR A;  2QGF B;  3NTH A;  1NEG A;  3OYL A;  4JJB A;  2FPD A;  1Q82 R;  2X3W D;  1MNE A;  3G1J A;  4KRT A;  3SWN C;  2CSQ A;  5CKE A;  3MEV A;  3CC7 Q;  5GAN e;  5I2M A;  2HKQ B;  2RD1 A;  2R58 A;  2A08 A;  1M3C A;  3MET A;  5CKB A;  1KK7 A;  1B07 A;  1U06 A;  3E9G A;  3EG1 A;  1IGQ A;  1IRX A;  4GLM A;  2F2W A;  3KXT A;  2E70 A;  2GTJ A;  3ME9 A;  5KYN A;  4AMC A;  4LDX A;  1IB8 A;  3UAT A;  3C0C A;  3BE3 A;  3CXC A;  1FX7 A;  1GCQ C;  1PWT A;  2J7I A;  4FM4 B;  3RES A;  3CCJ A;  3M0S A;  1KQS P;  4XTV A;  1LOJ A;  2K6D A;  3X24 B;  1Q7Y R;  2EJG A;  1HSQ A;  2K5L A;  2CUD A;  1UGQ B;  1YJ9 A;  2E6Z A;  1RAD B;  4BUG A;  2K5I A;  5GAN j;  1ZSZ A;  3VS5 A;  1K8A U;  3PGG A;  5GAM d;  2ZGW A;  2JMA A;  2DJZ A;  1VIF A;  3CC4 T;  3ZBD A;  2ENM A;  1W1F A;  2H3E B;  1VQK A;  1BB9 A;  3HP9 A;  4B9W A;  1VYV A;  2H8H A;  2PQW A;  2LJ3 A;  3JCM Q;  4RTW A;  2DTO A;  5GAO m;  5FU7 C;  4OMF B;  3CME Q;  4DOW A;  2W0Z A;  1RI0 A;  2YRD A;  4TVR A;  1YFN A;  1XQH A;  1QCO A;  2AZS A;  2KAF A;  2LQW A;  1NBE B;  3QO3 A;  3JV3 A;  3S3N A;  2VWF A;  2O01 E;  2JMC A;  2DL3 A;  5GAN 5;  1OV3 A;  2DXT A;  1KC8 C;  1BKB A;  3QJY A;  3BFM A;  4ZTF A;  1M9S A;  1AEY A;  3I55 A;  3ZEH A;  3TVT A;  4PJO G;  1VQ7 T;  3TCJ A;  1M90 R;  1H3H A;  1EX4 A;  4DA4 A;  1M30 A;  1K73 C;  2YHT A;  3ULR B;  2K7A A;  3A8L B;  2X4X A;  1V29 B;  3QII A;  1PC0 A;  1BIB A;  3VS2 A;  1X01 A;  2YT6 A;  3CMA A;  4FU6 A;  4NS5 A;  4C92 G;  4F17 A;  4C5E A;  2LZ6 B;  4PJO A;  3CC2 T;  1XNI A;  3PNW C;  2BZY A;  3EFO A;  3CCR T;  2GF7 A;  3L1A A;  4AFU C;  2WSF E;  2HQX A;  5LJ3 d;  5IHK A;  4ME7 A;  1YWP A;  2A3L A;  2JVV A;  2EYX A;  1G3S A;  1QVP A;  4YTL A;  4OB2 B;  5CAI A;  1VQN Q;  5AYF A;  2FO0 A;  2I0N A;  2M16 A;  2CZ0 B;  2V1R A;  4FYX B;  4PJJ A;  1MMD A;  2HDA A;  2ZCF B;  3UA7 A;  1I5O B;  2AT1 B;  5IHI A;  1ZLM A;  4BE2 A;  4E7H A;  2YUO A;  2DD5 A;  2LP5 A;  1UEC A;  1GXI E;  1ZUY A;  1N27 A;  1D1C A;  1GL5 A;  1MMG A;  4JLG A;  3REA B;  2VB6 A;  2ZPI B;  4M4Z A;  3CPW P;  3UWN A;  1UJY A;  2K3Y A;  3CCJ T;  5KYY B;  4FL6 A;  2C06 A;  4F7U B;  1TXQ A;  2L3R A;  4J7F A;  3V7S A;  5GAO p;  1ZA1 B;  1TWB A;  3A8O B;  2J06 A;  3OYY A;  3CCS Q;  4M77 B;  6AT1 B;  1VQL Q;  2RI5 A;  3G6E A;  4MMK A;  1Y96 A;  4E47 A;  5LJ5 e;  1YJ9 T;  3HRS A;  2QEX A;  1I5L A;  3L2V A;  2ED0 A;  1UTI A;  1M90 U;  2CUB A;  1FMK A;  4PJO D;  1PD1 A;  4E2F B;  8ATC B;  4M7D C;  4QQD A;  1YJN A;  3MEW A;  3EGD A;  2RJD A;  4CRI A;  3QG1 A;  5IXF A;  4PJO E;  3I56 A;  1ZA2 B;  1KHI A;  3JCM d;  2COW A;  1LPL A;  1N8R C;  2DM1 A;  3OW2 S;  1I8F A;  1YHQ A;  4J8O A;  2LVM A;  2L3Q A;  4C92 D;  1U8R A;  2K2M A;  3CPF A;  1H3Z A;  3PMI A;  3OYF A;  2KEA A;  4IUP A;  4LE9 A;  4LDV A;  3DB4 A;  2ZPB B;  4WF2 A;  3RKW A;  4C5G A;  3RIR A;  4ZGD B;  1NE8 A;  4C92 E;  4DOV A;  5CCA A;  1RAG B;  2BZ8 A;  2EYW A;  5A2Q E;  4B9X A;  3M53 A;  1WIE A;  2BKD N;  2CRE A;  1PKT A;  1QW1 A;  4MDW A;  1WHL A;  4XTW A;  5ECA A;  4E7I A;  2V26 A;  2RB6 A;  2YUN A;  3GIB A;  3I55 T;  3X28 B;  4DQ2 A;  2OJ2 A;  2LMJ A;  1H64 1;  3TU4 K;  4QW2 A;  1I4K 1;  3MPU B;  3G71 A;  1YIT A;  2DPP B;  5J3B A;  4M7D G;  1YWO A;  1ZX6 A;  1NYF A;  1QKW A;  2M02 A;  1Q86 C;  2RHZ A;  2OTJ A;  3QUI A;  2AK5 A;  1RAC B;  4O5V A;  5GAN f;  2L2P A;  2LX9 A;  3CMA T;  4M78 C;  1YN8 A;  2NUZ A;  7AT1 B;  1KSW A;  2DZ9 A;  1OZ2 A;  2MPX C;  2RNA A;  2QA4 A;  3P8D A;  1X2K A;  3CCV Q;  5EC7 A;  2QXF A;  4Z8A A;  4A4K A;  4KH1 B;  3CCL Q;  5FLX E;  4Y28 E;  3EHR A;  4PJM A;  1WJR A;  3PIO A;  1Q81 C;  1VQ4 Q;  5HCK A;  1AT1 B;  1S72 A;  2G6F X;  3CD6 A;  2CP7 A;  1UEB A;  5KYU A;  3QHS A;  1BI3 A;  1O9S A;  4HVW A;  4ZGE B;  3CCU A;  1NJI C;  4FT2 A;  1WX6 A;  3G4S Q;  2DX1 A;  2MCN A;  2YRC A;  2DZC A;  2HAX A;  1ABQ A;  1Q82 C;  2HSP A;  2V8J A;  3FC3 A;  2WSC E;  1JJ2 S;  1MV0 B;  1K73 R;  4JJN K;  4WTO B;  2PVD B;  1OU9 A;  1VOM A;  2KYM A;  3HRT A;  4X9C A;  3OA6 A;  1HXD A;  4IUV A;  3DLM A;  1I1J A;  2LJ0 A;  4Q5W A;  3G6E T;  1VQ8 A;  1K4U S;  1HK9 A;  2FG0 A;  4OB3 B;  3OS1 A;  4PLI A;  3GLX A;  1N5Z A;  1NPR A;  2DRM A;  5FU7 B;  4PJN A;  1RAH B;  2K5F A;  2EQJ A;  1BIA A;  4C8Q G;  2FB7 A;  3PE0 A;  1YI2 A;  5D6W A;  4M75 G;  1WXB A;  1VQ6 Q;  4M7D D;  2RHI A;  5DLQ E;  2E3H A;  2E5Q A;  1VQO Q;  3ZFJ A;  2D6F A;  3MO8 A;  3CXC P;  4NL2 A;  2P4R A;  3MEU A;  1X69 A;  4HCZ A;  2JTE A;  2PTK A;  1YHQ T;  3CPW A;  4M7D E;  1N6A A;  2X4W A;  2C0I A;  4OMP A;  1PKS A;  3TSW A;  4C8Q A;  3S3O A;  2M0O A;  2P84 A;  4M75 A;  2GFA A;  1OEB A;  5KYW B;  4KT0 E;  1WPY A;  1VQ9 T;  4BD3 A;  2NLU A;  2A37 A;  1JBM A;  5I2S A;  2M51 A;  2XD0 A;  3RKX A;  1KC8 U;  3H0I A;  2RN8 A;  2SRC A;  1WYX A;  3EGX B;  4JS4 A;  1OI1 A;  2OAW A;  1BI1 A;  2ZPE B;  4M7A G;  4XU2 A;  5GAN 2;  3V8J A;  3JCM X;  3G71 T;  3ASK A;  2FPF A;  1C1A A;  5M9O A;  3M5A A;  2MMP A;  1E7O A;  3OYE A;  3OYM A;  1GBR A;  3PMT A;  2P0Q A;  2NYS A;  1M2V B;  3EHQ A;  1AOJ A;  3SD4 A;  2VYT A;  5GMK i;  2QQ9 A;  2OTJ T;  1YIJ Q;  2DA9 A;  5GAN h;  2AHJ B;  4F7U F;  1X6B A;  4XU3 A;  3JCM J;  4GLK A;  1N8R R;  3SFM A;  4M78 D;  2GCX A;  1UE9 A;  4M77 F;  3MJX A;  2CZ7 B;  3VS6 A;  2LTO A;  2DXU A;  2VGM A;  1Z9Q A;  2D0Q B;  2EQI A;  1KG1 A;  2LNV A;  4M78 E;  1WGS A;  1QCF A;  1S72 T;  4M75 D;  2VXE A;  1M1K R;  3WVE B;  3JB9 I;  1SF9 A;  3H41 A;  5GJV B;  4J6X A;  1A0N B;  2CH4 W;  1R77 A;  3CCU T;  4C8Q E;  3A1P A;  5KE3 A;  2C0T A;  2IIM A;  5LJ5 f;  4M75 E;  2K57 A;  3SB2 A;  1MGQ A;  2R5M A;  3A5Z B;  3RBB B;  1HD3 A;  1RUW A;  5CR2 A;  2WSE E;  4KGZ B;  4IUT A;  1WLP B;  4ATO A;  4CI0 C;  1VQN A;  4R56 A;  1Q86 R;  2DL7 A;  1UHF A;  2YUP A;  2KR3 A;  2F2X A;  3P8H A;  1VQ8 T;  4MZP A;  2P0P A;  4J9E A;  4HT9 A;  1OX9 A;  2FRY A;  2DO3 A;  2B8A A;  3JB9 J;  4M7A D;  2J6F A;  4LXC A;  3M57 A;  5DY9 A;  5LJ5 g;  4VUB A;  1N9R A;  2CZ1 B;  2X9H A;  2E64 A;  1YI2 T;  3JCM c;  2ECZ A;  4RKU E;  2A28 A;  1Q81 R;  4M7A E;  3BDL A;  3CCS A;  2X4J A;  2LC4 A;  2DKG A;  2IG0 A;  1VQL A;  3RKY A;  3GOX A;  1RAB B;  2RHX A;  4PKC C;  2DTI A;  4HXJ A;  2E4H A;  1VUB A;  2DXC A;  2LCS A;  3GNF B;  3HHT B;  1GRI A;  5GMK l;  3EGU A;  4ZTJ A;  2QTX A;  2CT4 A;  2AIR B;  1K9A A;  4EMH A;  5I11 A;  3M0R A;  1M3A A;  3HSB A;  4XK8 E;  1QLY A;  4DEX A;  2LCL A;  2Y90 A;  2JW4 A;  2D8J A;  2WAC A;  2RA2 A;  2PUK B;  4KUD K;  4M78 B;  2YLB A;  1VQP Q;  1QWF A;  3QYH B;  3CCM Q;  3O5Z A;  5HK0 A;  4JJD A;  3SEM A;  2Y4Y A;  4WCI A;  4Z02 A;  1Q86 U;  3OYC A;  3HFO A;  5CK9 A;  2XKO C;  2RHU A;  4ELZ C;  1KQ2 A;  4PJO C;  4HCC A;  4XQ3 A;  2KRO A;  4LDY A;  1JJ2 P;  3M0Q A;  1OYX A;  2MYS A;  1D3B B;  2NUT B;  3Q1J A;  3OQ5 A;  5IH2 A;  3EAE A;  3EFR A;  1VQM Q;  2EAY A;  1LCK A;  1W2B S;  2ABL A;  1IRE B;  4QVD A;  2MOX A;  3VS3 A;  3H0H A;  3CCQ A;  4RMO A;  1Q81 U;  5GAM g;  4C92 C;  4CC7 A;  1U1S A;  4PNO A;  1C0M A;  1QP2 A;  2CP0 A;  2KXC A;  2RJC A;  2HNI A;  3VKI A;  3M0P A;  1NJI U;  2KBT A;  5LJ5 h;  3CCV A;  2JS0 A;  2NUP B;  1RL2 A;  1QVG S;  1Q82 U;  1RAE B;  1TG0 A;  2Z0W A;  4AFZ C;  3NFC A;  1VQ4 A;  3ER0 A;  1UFF A;  4AFQ C;  3N5B B;  1K0X A;  2KT1 A;  2GNC A;  4P5N A;  4EMK A;  1BI0 A;  4FYY B;  1LNX A;  2DYB A;  2XHC A;  4C5I A;  2QYZ A;  2MWP A;  1ZBJ A;  2EWN A;  2HMA A;  3NGP A;  3OYB A;  2YUQ A;  4RCB A;  4HVU A;  2RQV A;  4RTX A;  3VUB A;  3P8B B;  4PFP A;  4PFZ A;  2EKH A;  5FRM A;  2EYZ A;  1Q7Y U;  3MP8 A;  2ROT A;  3SDZ A;  1VQ5 T;  3PT9 A;  1Z9Z A;  2DAQ A;  2JN0 A;  3CC4 Q;  1AZE A;  1WJQ A;  1GCQ A;  3M59 A;  2F5K A;  1SG5 A;  3OW2 A;  4QT7 A;  1Y71 A;  2DK3 A;  4PL6 A;  2KNB B;  2EGE A;  2RM4 A;  4DBF A;  2HSE B;  2EQM A;  3S3M A;  2L0A A;  2ED1 A;  3I9Q A;  4IIM A;  4GY5 A;  1PRM C;  3WVD B;  5GAO l;  1VQO A;  5LJ3 g;  5GJW B;  2GQI A;  2RQU A;  2XMF A;  2QQS A;  3FEO A;  2EGA A;  4O6J A;  2XI9 A;  3KFV A;  2VXF A;  3CBO A;  2DXB A;  4UC4 A;  4EIK A;  3X25 B;  3PVL A;  4CC2 A;  1B3Q A;  1JEG A;  1HJD A;  4HVV A;  3QXE B;  1VQ7 Q;  4RTU A;  1GFC A;  1WHG A;  2RQW A;  3CBM A;  4DBH A;  3JCM P;  3H8Z A;  2DTH A;  4NOY A;  2M1H A;  4E6R A;  2YRV A;  4M7D F;  1GFD A;  3C4S A;  3F70 A;  4OMN A;  1IXD A;  1VQK T;  2GQV A;  3RDV A;  4ZN1 A;  3CC2 Q;  5KYW A;  3CCQ T;  3QWX X;  3CCR Q;  4IUU A;  4BY6 C;  1I0C A;  2K79 A;  1T0J A;  4HCB A;  2DL4 A;  4N4I A;  2RI2 A;  5KE2 A;  1IZ6 A;  4HKE A;  2JOY A;  4K11 A;  4II1 A;  2O2O A;  1RLQ C;  1KFZ A;  3OYH A;  3QZ5 B;  4KGV B;  4CC4 B;  4QVC A;  5LJ5 j;  1SRL A;  1R8O B;  4IUR A;  5L8R E;  4IIO A;  1ARK A;  1WXT A;  3QSU A;  1M1K C;  2DBK A;  4J6Y A;  4E7L A;  4KUL A;  2E41 A;  2VKN A;  1OUL A;  1JJ2 A;  2P4T A;  3OYI A;  2XID A;  3M58 A;  4FYW B;  3FB9 A;  2OTL A;  2KDS A;  2VUB A;  5J39 A;  3CCJ Q;  2DET A;  2KY9 A;  1PRL C;  1IHW A;  4IKF A;  1JU5 C;  2FPE A;  1PSE A;  4LUD A;  1PG5 B;  3E1S A;  4AG1 C;  2FZK B;  3U23 A;  3QJ6 A;  1V76 A;  5L23 A;  1UGR B;  1YJ9 Q;  3CCE A;  1D1B A;  1KQ1 A;  1YJW A;  4BI4 A;  1PCX A;  1OQK A;  3EG0 A;  4M78 F;  5CKH A;  3O8V A;  3C94 A;  4A54 A;  1K9M R;  2MI6 A;  3DLL A;  3SWN B;  3PVQ A;  1QCN A;  4QQG A;  1FMV A;  1GBQ A;  2G3R A;  5FW9 A;  4A4E A;  4C8Q C;  5GAM e;  2OI3 A;  2KXD A;  5CKD A;  1UB4 A;  1WQW A;  2I2L A;  4M75 C;  3OYK A;  4IUQ A;  4L59 A;  1LVK A;  2X35 A;  3MP6 A;  2RJF A;  4FT4 A;  2HBW A;  2EJ9 A;  3HRU A;  2BE7 D;  3LWI A;  4FW2 A;  4Z88 A;  4ESR A;  1WHM A;  1SRM A;  4N0A A;  2L5Q A;  2V1Q A;  3HL8 A;  2C0O A;  3T9N A;  4J9G A;  1FMW A;  3GNG A;  1MHN A;  5GAN d;  3HPW A;  1RAA B;  2HD0 A;  1FYN A;  1KQS S;  4PJO B;  3HTR A;  2K3X A;  5IAY A;  2R57 A;  3CC7 A;  3VS7 A;  3I55 Q;  5GAM j;  3E19 A;  4XAX B;  1N9S A;  4AG2 C;  3DKM A;  2VVK A;  2DIG A;  3VV0 A;  4DBQ A;  2LCC A;  3LW5 E;  4MML A;  2NWM A;  4M7A C;  1BBZ A;  1UGS B;  2CH4 A;  1QP3 A;  2QEX T;  2MIO A;  1UG1 A;  3URG A;  1WHH A;  3NTI A;  4ORZ A;  2CGH A;  2LQ8 A;  3L42 A;  4C92 B;  5GMK e;  2CSI A;  1NLP C;  1ZSG A;  3CMA Q;  3A98 A;  4L5G A;  5AT1 B;  3REB B;  1YJN T;  3CCM A;  2YSQ A;  1IGU A;  4GBQ A;  4OMQ A;  2FVU A;  3L2U A;  3I56 T;  3I5R A;  5IHN A;  4N4G A;  4ZNX A;  3EG9 B;  1RI9 A;  1DJ7 B;  1G3W A;  4E7Z A;  3OBW A;  1ACM B;  4JJC A;  1X2Q A;  2RH2 A;  3LH0 A;  4KGX B;  2LT1 A;  2DVE A;  3IQL A;  4A4G A;  2RHY A;  1JRI A;  5LJ3 e;  1IHV A;  2CP5 A;  4J5Y A;  1WZO A;  2HL5 C;  1E6G A;  3A8G B;  1M1G A;  1D0Z A;  4BDY A;  1AWJ A;  3RR6 A;  4BB7 A;  3OBY A;  3CME A;  4ZN3 A;  1ZHI A;  1UJ0 A;  2CP3 A;  1WFW A;  4BE0 A;  4RG2 A;  3EGD B;  2OTL T;  3FRN A;  1AHJ B;  1SPK A;  1QVF S;  2DL5 A;  1MMN A;  3RMQ A;  1CKA A;  2A36 A;  4PK4 A;  2EYQ A;  3A8M B;  5HK3 A;  2AZV A;  3QZ9 B;  1NEB A;  1YIT T;  1G8X A;  3JB9 H;  1M2O A;  3G6E Q;  4FSX A;  3M9Q A;  4B6M A;  5CVI A;  4XU0 A;  2O88 A;  1K73 U;  3CCE T;  2KVQ G;  1YJW T;  2FYK A;  5LJ3 j;  2DJQ A;  1U3O A;  2RF0 A;  1WI7 A;  1UHC A;  1BCM A;  3JB9 G;  4A53 A;  3RMS A;  1UUE A;  4PFO A;  2QA4 T;  3VS4 A;  4JUV A;  3CBP A;  3VYG A;  2GGR A;  3M55 A;  3QYG B;  1FWZ A;  1O75 A;  2EGC A;  3VUZ A;  3L2Z A;  4C8Q D;  2ATC B;  5D6X A;  3THK A;  1YHQ Q;  1MV3 A;  4AT1 B;  3SHW A;  4BAC A;  2O9S A;  1JQQ A;  3OY9 A;  3CD6 T;  3JCM e;  1I81 A;  4E7K A;  3EFS A;  3LGF A;  4BDZ A;  3C12 A;  3TSZ A;  3CC4 A;  2LRQ A;  1VQ9 Q;  2JM8 A;  1BU1 A;  4A4F A;  2FHD A;  4XTX A;  2XDD A;  2VAS A;  1FXX A;  5A0L A;  1AD5 A;  3QWY A;  1QMC A;  4LUE A;  3OW2 P;  2VC8 A;  2KI7 A;  1K1Z A;  3KUF A;  2ROL A;  3CC7 T;  1KHC A;  1PNJ A;  3V7R A;  5CKF A;  4M7D B;  4MZM A;  4NL3 A;  3G71 Q;  1SHG A;  2KRM A;  2JNG A;  4JRK A;  2X51 A;  4RG8 A;  3OYJ A;  1ZSZ C;  1J3T A;  2E5K A;  1IO6 A;  2QGG A;  4BY6 B;  3E9F A;  4PJL A;  2E1H A;  2OTJ Q;  2V8I A;  2JJ9 A;  4JRP A;  5LJ5 d;  3M54 A;  4LDU A;  2MWO A;  1NG2 A;  1Y07 A;  3OYG A;  4F7U G;  2DVJ A;  1WJS A;  3QBY A;  1W2B A;  2DLP A;  3H9N A;  3HKS A;  2HL3 A;  4M77 G;  3UF4 A;  2KK4 A;  1YCY A;  3LYI A;  3V8K A;  1W4S A;  1N8R U;  3JB9 D;  1YBY A;  3VS1 A;  3R6O A;  2RMO A;  1S72 Q;  1M1F A;  5GAN 8;  2DEQ A;  2GFU A;  1EFN A;  2QDL A;  2K3B A;  3CCU Q;  3RNJ A;  1NLO C;  1QVG A;  4J7I A;  3PIP A;  3OB9 A;  5KYY A;  4F7U A;  4J9H A;  4MDX A;  1M1K U;  2W10 A;  5GAN 7;  3TRE A;  5IXB A;  3CME T;  1M27 C;  4M77 A;  1WXU A;  2VV5 A;  4OP0 A;  2QAS A;  4EMK C;  9ATC B;  1GCP A;  1NYG A;  5GAN 6;  4J9F A;  2DNU A;  1WDX A;  3TEE A;  2X4Y A;  3NTK A;  5GAM f;  5A0D A;  1VQ8 Q;  3CEY A;  2E65 A;  3TQ7 P;  2O31 A;  2XK0 A;  1TS9 A;  2XG8 D;  3V7C A;  3JCM b;  1D0X A;  2AKL A;  2DER A;  3JAM E;  4C8Q B;  5FRO A;  3EH2 A;  1YCS B;  4M75 B;  2LDM A;  5I21 A;  3GP8 A;  4PJO F;  3NMZ C;  4LD6 A;  4OGE A;  1YI2 Q;  4A63 B;  2RJE A;  4RTY A;  3ZL7 C;  3AHU A;  2GBQ A;  3FIF A;  2YDL A;  2EBP A;  1RLP C;  3GF5 A;  1B34 B;  3INZ A;  4F04 B;  4J9D A;  4C92 F;  1K9M C;  2R5A A;  2RPN A;  1RAI B;  1PM3 A;  1ABO A;  5KYX B;  2IPO B;  5KH6 A;  4M77 D;  4BI3 A;  4A4H A;  1KJW A;  3BW1 A;  3FLG A;  1B7T A;  2ZPG B;  3CCL A;  1P92 A;  4F7U E;  4C0D C;  1G5V A;  4QQ6 A;  4MZT A;  5CQY A;  4M7A B;  4M77 E;  4BE1 A;  1VQN T;  2L3S A;  2QG9 B;  1OOT A;  4HT8 A;  2E10 A;  2MK5 A;  4EPC A;  1D0Y A;  2BIV A;  3R6N A;  3OYN A;  2KSS A;  1QKX A;  3OMG A;  2CYZ B;  3J7A F;  3G4S A;  1PHT A;  4QVZ A;  1X27 A;  4LDW A;  4JZ4 A;  1NPP A;  3SWN A;  2QQR A;  2A0F B;  1X43 A;  3FJP A;  2O4X B;  1SKU B;  1LJO A;  1KD1 C;  2J6K A;  5LJ3 f;  2KQW A;  4N4H A;  2EVR A;  2O9V A;  1MUZ A;  3G7Z A;  1HYO A;  3CCS T;  3CXC S;  1VQL T;  2D0N A;  3OS5 A;  1QVF P;  2FL7 A;  1PSF A;  2DBM A;  3OYA A;  2QAZ A;  1XTD A;  1X75 C;  1G2B A;  2FZG B;  2QTV A;  3L2W A;  2J05 A;  2EPD A;  3MEA A;  4R0K A;  2CS7 A;  2RQT A;  1SEM A;  1NM7 A;  2JS2 A;  2MF2 A;  1VQ6 A;  3M4G A;  2EJF A;  2PZ1 A;  4LNP A;  4EDU A;  3DB3 A;  2RK1 A;  4OML A;  2CP2 A;  4AFS C;  5DM7 R;  2EFI A;  1XOV A;  3QDR B;  3OS2 A;  4FYV B;  2GTO A;  1AWX A;  1AVZ C;  2FZC B;  2MAM A;  2KMT A;  5FU6 C;  4OVA A;  3L2Q A;  4C92 A;  5GAM h;  2HEQ A;  2CP6 A;  2H3J A;  4C0F A;  3PTA A;  2QK0 A;  2FEI A;  5KCH A;  1UGP B;  3MP1 A;  3JCM f;  3MKD A;  5D6Y A;  3EG9 A;  2D8H A;  3C95 A;  1OZ3 A;  2E12 A;  2BUD A;  2BTT A;  4D8D A;  1R0B G;  1K76 A;  1U1T A;  4OMM A;  1VQ5 Q;  4E7S A;  1OU8 A;  2HKN A;  4F16 A;  2SEM A;  1BCO A;  2LJ1 A;  2RO0 A;  1WHK A;  2CT3 A;  2E3I A;  5A0G A;  1OPK A;  5I22 A;  2RQR A;  1EZZ B;  2JTM A;  1VIE A;  4J9B A;  1YIJ A;  3MCA B;  3X26 B;  4XTZ A;  1H8K A;  4N0A C;  1TSF A;  4D8K A;  2DRK A;  3EGX A;  3CCV T;  2LQK A;  3JCM g;  3FJ5 A;  3HFN A;  3CCL T;  1U5S A;  5FWB A;  1M4Z A;  3LLR A;  1M3B A;  5GMK h;  1VQ4 T;  1MND A;  1ZSZ B;  2PVO B;  2JXB A;  3LGL A;  2LQN A;  5GAN 4;  1AWO A;  3WXM B;  4J83 A;  1KQS A;  3RER A;  3BY7 A;  1M2V A;  3QKJ A;  4JS5 A;  3M4Y A;  2HBP A;  4XU1 A;  3J80 E;  4JLI A;  3G4S T;  5C0M A;  2F1L A;  1VQ9 A;  5LL6 S;  3EG3 A;  3VYH B;  2V8K A;  2L89 A;  3NHN A;  2DEU A;  3V8L A;  1S1N A;  2XU8 A;  1WNL A;  2YLC A;  2PUO B;  5LJ3 h;  2DF6 A;  3H6Z A;  4QKU A;  1TUD A;  2L8D A;  3E2U A;  4JPB W;  5GAO q;  4HCK A;  3GBQ A;  2A7Y A;  3RUX A;  1VQK Q;  3JSC A;  4C8Q F;  1CSK A;  2K2V A;  3CCQ Q;  4E7J A;  1X6G A;  4HA8 A;  1ZBX A;  2KGT A;  4M75 F;  4OGC A;  8AT1 B;  4C5H A;  2QQA A;  4EMK B;  4JRQ A;  1AWW A;  4RTV A;  5HY6 A;  4Y92 A;  1JXM A;  1VQ6 T;  1W70 A;  1K8A C;  3JRZ A;  1VQO T;  2XDB A;  3UT1 A;  2HCK A;  2DIL A;  3LX7 A;  4M7D A;  2CZ6 B;  1JXO A;  5J26 A;  4C0Z A;  1T3L A;  1UDL A;  4FCY A;  2QI2 A;  1W2B P;  2DD4 A;  4FSS A;  2COY A;  1AZG B;  1QVF A;  1KD1 R;  4FIB A;  4LD9 K;  1KC8 R;  3EFO B;  2F2V A;  3GPL A;  1OPL A;  1V1C A;  3KBG A;  5GAO n;  4KBM B;  2YWW A;  3S6W A;  5GAN g;  3UA6 A;  2X3X D;  5HKC A;  1BK2 A;  1QVG P;  1M8V A;  4ZGJ B;  4M7A F;  1OX8 A;  2IVW A;  1T0H A;  2KRN A;  3JCM h;  4FW1 A;  4V2S A;  4DBR A;  4ELY C;  2D1X A;  2JUF A;  2EKO A;  1JB0 E;  3UPU A;  5C6S A;  3M56 A;  4JZ3 A;  4F14 A;  2ZPF B;  4LN2 A;  2K4Y A;  1VQP A;  3AT1 B;  3OSS C;  1TUG B;  4BI8 B;  4M78 G;  1ZUK A;  2KRS A;  3X20 B;  3L2R A;  1D09 B;  4OF1 A;  4J9C A;  2DL8 A;  3QPH A;  4C0D B;  3JB9 F;  2M9U A;  1YIJ T;  1K9M U;  4JDS A;  2PU9 B;  5IN1 A;  1M5Q 1;  2OX7 A;  4DEY A;  1NZ9 A;  1RAF B;  2K9G A;  4OMO A;  5KCO A;  1Q7Y C;  2FRW A;  2RK2 A;  1YP5 A;  2CDT A;  1Y96 B;  2F69 A;  4RTT A;  5EG2 A;  1VQM A;  3CQT A;  4Z89 A;  2KE9 A;  4M78 A;  1VYT A;  5GMK j;  2P0K A;  2M0Y A;  2KT8 A;  2VGN A;  1D1A A;  4R55 A;  2Y4X A;  2KYB A;  2HZY A;  2YXY A;  1MMA A;  1T3S A;  2ZAE A;  2EYY A;  3M0T A;  1D3B A;  2NUT A;  1G3Y A;  1KD1 U;  2JM9 A;  4XTU A;  2QEX Q;  1B34 A;  1H92 A;  3J81 E;  2HQE A;  3BDU A;  1Q95 G;  1X6O A;  3A8H B;  5CO7 A;  2ESW A;  2HQH A;  2PVG B;  1YNZ A;  3LWH A;  5DLO A;  1YJN Q;  5KYX A;  1SSF A;  2AKK A;  2LNH B;  1BI2 A;  3I56 Q;  4RCC A;  2NUP A;  3VU3 C;  1BYM A;  2JZ2 A;  5GAO r;  1TH7 A;  2BZX A;  2ZZD A;  1M90 C;  4M7A A;  5FU6 B;  1ZUU A;  1F1B B;  1R0C B;  1QWE A;  1ZQ1 A;  4M77 C;  5GMK m;  2JT4 A;  2EIF A;  1Y57 A;  2DYI A;  5FRN A;  3OS0 A;  4KH0 B;  1EIF A;  1E6H A;  4XTY A;  3H0F A;  4J6W A;  4JRI A;  1WA7 A;  3CPW S;  2EQU A;  1TUC A;  2D9T A;  2O4X A;  2DMO A;  1VA7 A;  1TU0 B;  1Y0M A;  2EW3 A;  4OB0 B;  2OTL Q;  4L6V 5;  3VS0 A;  1G3T A;  4OB1 B;  4EMG A;  3VRY A;  5IT9 E;  1WQ7 A;  1VYU A;  1CKB A;  1Y7X A;  1UGV A;  1KIK A;  1M8M A;  5CQX A;  1I07 A;  1YIT Q;  2XIC A; 
#chains in the Genus database with same CATH homology
 1I0C A;  1N5Z A;  2DRM A;  2K79 A;  1T0J A;  2DL4 A;  2L3P A;  2L3S A;  2LX7 A;  1OOT A;  4K11 A;  1G83 A;  2O2O A;  3PE0 A;  3R6N A;  3M0U A;  1RLQ C;  1KFZ A;  1W6X A;  1WXB A;  4X1V A;  1QKX A;  4CC4 B;  3NPF A;  1PHT A;  1X27 A;  1SRL A;  4JZ4 A;  4IIO A;  1ARK A;  2P4R A;  4RTZ A;  1X69 A;  1WXT A;  2DBK A;  1X43 A;  2JTE A;  2PTK A;  3EG2 A;  2VKN A;  2B86 A;  2J6K A;  3I5S A;  2J6O A;  5FWC A;  2C0I A;  2EVR A;  1PKS A;  2O9V A;  4OMP A;  3TSW A;  1SHF A;  1MUZ A;  4CC3 A;  3I35 A;  1K0S A;  3VRZ A;  4RUG A;  2D0N A;  1PRL C;  1OEB A;  1JU5 C;  1SSH A;  2DE0 X;  2FPE A;  2A37 A;  3LH5 A;  2DBM A;  4LUD A;  1JO8 A;  2PNI A;  4J9I A;  4AG1 C;  3U23 A;  2M51 A;  1G2B A;  5L23 A;  1NEG A;  3H0I A;  2J05 A;  2RN8 A;  2EPD A;  2FPD A;  4JJB A;  2SRC A;  1WYX A;  2X3W D;  2OAW A;  4R0K A;  4KRT A;  2RQT A;  3EG0 A;  1SEM A;  1NM7 A;  2JS2 A;  2CSQ A;  2PZ1 A;  3PVQ A;  4LNP A;  2FPF A;  1GBQ A;  4OML A;  4AFS C;  1E7O A;  5FW9 A;  2A08 A;  1M3C A;  1GBR A;  1B07 A;  1U06 A;  2OI3 A;  3EG1 A;  2KXD A;  1XOV A;  3EHQ A;  1AOJ A;  4GLM A;  2F2W A;  2GTJ A;  2GTO A;  1AWX A;  2DA9 A;  3UAT A;  1AVZ C;  3C0C A;  1X6B A;  1GCQ C;  1PWT A;  2J7I A;  2HBW A;  3M0S A;  1UE9 A;  2HEQ A;  3VS6 A;  4Z88 A;  4ESR A;  2K6D A;  1Z9Q A;  2EQI A;  1SRM A;  2V1Q A;  2C0O A;  1HSQ A;  4J9G A;  2CUD A;  2FEI A;  1QCF A;  3H41 A;  1FYN A;  5GJV B;  1A0N B;  3VS5 A;  2CH4 W;  2D8H A;  4D8D A;  2BTT A;  2JMA A;  3VS7 A;  2C0T A;  1K76 A;  2ENM A;  1W1F A;  2IIM A;  4OMM A;  1BB9 A;  4F16 A;  4AG2 C;  1VYV A;  2SEM A;  2LJ1 A;  2H8H A;  2VVK A;  2LJ3 A;  2CT3 A;  4RTW A;  3RBB B;  2NWM A;  1BBZ A;  1HD3 A;  1RUW A;  2CH4 A;  5I22 A;  1OPK A;  1UG1 A;  1WLP B;  2MIO A;  2RQR A;  2W0Z A;  4J9B A;  4ORZ A;  2CSI A;  1NLP C;  1ZSG A;  1H8K A;  2AZS A;  2DL7 A;  2LQW A;  1UHF A;  3A98 A;  2YUP A;  2KR3 A;  3REB B;  2F2X A;  4D8K A;  2DRK A;  2YSQ A;  4GBQ A;  3FJ5 A;  4OMQ A;  4J9E A;  3JV3 A;  2VWF A;  1U5S A;  3I5R A;  5IHN A;  2FRY A;  5FWB A;  1M3B A;  2J6F A;  2JMC A;  4ZNX A;  2DL3 A;  2JXB A;  2LQN A;  1RI9 A;  1AWO A;  1OV3 A;  4JJC A;  1X2Q A;  2ECZ A;  3IQL A;  1AEY A;  2A28 A;  3TVT A;  1E6G A;  1H3H A;  3EG3 A;  1AWJ A;  3NHN A;  1M30 A;  4HXJ A;  1S1N A;  3ULR B;  2K7A A;  2LCS A;  1UJ0 A;  1GRI A;  1WFW A;  2DF6 A;  3EGU A;  1TUD A;  3VS2 A;  1SPK A;  2CT4 A;  1K9A A;  2YT6 A;  2DL5 A;  5I11 A;  4JPB W;  1CKA A;  2A36 A;  4HCK A;  4F17 A;  2AZV A;  3M0R A;  2LZ6 B;  1NEB A;  3GBQ A;  1M3A A;  2BZY A;  2O88 A;  1CSK A;  1QLY A;  4AFU C;  4DEX A;  1X6G A;  5IHK A;  2KGT A;  1YWP A;  2EYX A;  1AWW A;  4RTV A;  2DJQ A;  1U3O A;  2FO0 A;  2RF0 A;  1WI7 A;  2I0N A;  4Y92 A;  2JW4 A;  1JXM A;  2D8J A;  1W70 A;  1UHC A;  2V1R A;  1UUE A;  1QWF A;  3VS4 A;  3UA7 A;  2HDA A;  3O5Z A;  2GGR A;  2HCK A;  4JJD A;  5IHI A;  1ZLM A;  3SEM A;  2DIL A;  4WCI A;  2EGC A;  2YUO A;  2LP5 A;  1JXO A;  1UEC A;  1ZUY A;  3THK A;  1GL5 A;  1T3L A;  1UDL A;  1MV3 A;  3SHW A;  2O9S A;  3REA B;  1JQQ A;  4FSS A;  1AZG B;  4M4Z A;  1UJY A;  2KRO A;  3M0Q A;  2F2V A;  2J06 A;  3TSZ A;  1OPL A;  1V1C A;  5IH2 A;  2JM8 A;  3UA6 A;  1BU1 A;  2X3X D;  1BK2 A;  1LCK A;  2ABL A;  2MOX A;  2KRN A;  3H0H A;  1T0H A;  3VS3 A;  1AD5 A;  4CC7 A;  3QWY A;  2ED0 A;  1UTI A;  4LUE A;  2CUB A;  1FMK A;  2D1X A;  2KXC A;  1K1Z A;  2ROL A;  1PNJ A;  3M0P A;  4JZ3 A;  4F14 A;  2KBT A;  4LN2 A;  2JS0 A;  5IXF A;  1SHG A;  1ZUK A;  2KRM A;  1TG0 A;  2KRS A;  4AFZ C;  4J9C A;  2DL8 A;  1J3T A;  2DM1 A;  2E5K A;  1IO6 A;  1UFF A;  2L3Q A;  4AFQ C;  2K2M A;  1K0X A;  4DEY A;  2KT1 A;  2K9G A;  2GNC A;  4OMO A;  2KEA A;  2FRW A;  1YP5 A;  4LE9 A;  1NG2 A;  2CDT A;  4RTT A;  2DVJ A;  2DYB A;  3CQT A;  4Z89 A;  2KE9 A;  2DLP A;  2BZ8 A;  2EYW A;  1VYT A;  1ZBJ A;  3UF4 A;  1WIE A;  2CRE A;  1PKT A;  3NGP A;  2M0Y A;  2YUQ A;  2KT8 A;  3VS1 A;  4HVU A;  2RQV A;  2RMO A;  4RTX A;  5ECA A;  2YUN A;  2EKH A;  2KYB A;  1EFN A;  2QDL A;  2EYZ A;  2OJ2 A;  2K3B A;  3RNJ A;  1NLO C;  1T3S A;  2LMJ A;  2ROT A;  2EYY A;  1Z9Z A;  1AZE A;  3M0T A;  1GCQ A;  4J9H A;  2W10 A;  5IXB A;  1YWO A;  1M27 C;  4QT7 A;  1WXU A;  1ZX6 A;  2JM9 A;  1NYF A;  1QKW A;  1GCP A;  1NYG A;  2KNB B;  2EGE A;  4J9F A;  1H92 A;  2AK5 A;  2DNU A;  1WDX A;  2L2P A;  2L0A A;  2ED1 A;  1YN8 A;  2NUZ A;  3I9Q A;  4IIM A;  1KSW A;  2ESW A;  1YNZ A;  2RNA A;  1PRM C;  1X2K A;  5GJW B;  5EC7 A;  2GQI A;  2AKK A;  4Z8A A;  2O31 A;  2LNH B;  3EHR A;  2AKL A;  2RQU A;  2XMF A;  1YCS B;  2EGA A;  5HCK A;  3KFV A;  2G6F X;  3NMZ C;  2BZX A;  4EIK A;  1ZUU A;  4A63 B;  1QWE A;  3PVL A;  4HVW A;  4RTY A;  4CC2 A;  2JT4 A;  3ZL7 C;  1B3Q A;  1WX6 A;  2GBQ A;  1JEG A;  4HVV A;  1HJD A;  1Y57 A;  2DX1 A;  2YDL A;  2MCN A;  2EBP A;  4RTU A;  1ABQ A;  1GFC A;  1RLP C;  1E6H A;  3H0F A;  2HSP A;  2RQW A;  4J9D A;  1WA7 A;  1TUC A;  2DMO A;  1MV0 B;  1VA7 A;  2RPN A;  1Y0M A;  2EW3 A;  1ABO A;  2KYM A;  4E6R A;  3VS0 A;  1GFD A;  4OMN A;  3VRY A;  1I1J A;  2LJ0 A;  1KJW A;  1VYU A;  1CKB A;  1KIK A;  1UGV A;  1M8M A;  1I07 A;  1K4U S;  2FG0 A;  3QWX X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...