2KGTA

Solution structure of sh3 domain of ptk6
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
72
structure length
72
Chain Sequence
MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAERET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase 6
publication title The solution structure of SH3 domain of PTK6
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 3
structure length 72
sequence length 72
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kgtA00
1IO6A 2BZ8A 2DJQA 3H0IA 5EC7A 2CUDA 3VS5A 3RBBB 1KIKA 2J05A 3A98A 1Y0MA 1PWTA 2VVKA 2K79A 2JS2A 1BBZA 1T3SA 2VWFA 2C0TA 2LQNA 1GL5A 2RF0A 2HSPA 2LQWA 2OI3A 3TSZA 1Z9ZA 2HDAA 5IHKA 1Y57A 1QWEA 2P4RA 4F16A 3H41A 2L2PA 2DA9A 3U23A 1WXBA 2GQIA 1JU5C 2HEQA 2JM8A 2O9SA 3VRYA 2DNUA 4J9EA 2LP5A 1M3AA 2QDLA 1CKAA 4CC2A 4HVWA 1WLPB 5IHNA 3UA6A 1GBQA 4QT7A 4D8DA 1GFDA 1G83A 2G6FX 1V1CA 3VS7A 1W1FA 1UHFA 1K9AA 2L3SA 4K11A 2AK5A 2K3BA 1SHFA 3PVLA 1GCQA 2VKNA 1H3HA 3VS1A 2KBTA 2A36A 2EKHA 4RTZA 4EIKA 3REAB 1HSQA 1VYTA 3C0CA 1UUEA 3M0QA 2MCNA 4ESRA 1TUDA 1K0XA 4WCIA 4OMMA 4RTUA 2GGRA 2AZVA 2JXBA 4LUDA 2LZ6B 1ABQA 3EG1A 1BK2A 2X3WD 1QCFA 2FPEA 2LJ1A 4RTYA 5L23A 2KYBA 2DBKA 2J6KA 2LCSA 1UTIA 3I35A 2YUOA 1SPKA 2DL3A 1YCSB 2EVRA 1SEMA 1NYFA 1WIEA 1M30A 5GJWB 2KNBB 2ABLA 1YWPA 2CT4A 3THKA 1ZBJA 1I0CA 1ZLMA 2EW3A 1AZGB 1NM7A 1UDLA 1K76A 1K0SA 1MUZA 1KFZA 2J06A 1PRMC 1PHTA 1BB9A 1SRMA 2L3PA 1AWWA 2E5KA 3IQLA 2DBMA 2AZSA 2MOXA 4DEXA 3KFVA 4OMQA 1AWJA 2FG0A 1H92A 5HCKA 2EBPA 1GCQC 3I5SA 1H8KA 2JMCA 1YN8A 2CH4A 2M0YA 2KE9A 2YSQA 1GFCA 1MV0B 3NPFA 2GTJA 1PNJA 1RI9A 2LJ3A 1AD5A 2KEAA 4OMLA 3PVQA 3VS6A 3SEMA 2C0IA 2KRSA 2XMFA 1AVZC 1YP5A 1VYVA 2FPFA 1CSKA 1LCKA 1NLOC 2BZYA 5ECAA 2D8HA 2K2MA 2ESWA 2KT8A 4JJBA 1WDXA 1MV3A 4OMOA 2EGAA 4HCKA 1KSWA 2DL4A 3EHQA 2GNCA 4HVUA 3PE0A 2DLPA 4JPBW 1QKXA 2CREA 1JO8A 4J9DA 4J9FA 1K1ZA 4GBQA 1NG2A 4AFSC 1AEYA 2FRYA 3FJ5A 2YUPA 2JTEA 1UJ0A 3M0TA 3R6NA 1T3LA 2CH4W 2K6DA 1E6GA 4ORZA 1JEGA 1NEBA 2DVJA 1OPLA 2DL8A 2X3XD 2RQTA 4J9HA 1OV3A 3EGUA 4CC4B 2W0ZA 2DX1A 3QWYA 2H8HA 2O2OA 2J6OA 4CC3A 1GBRA 1T0JA 1X6GA 4LN2A 3UF4A 4AFZC 3EG3A 1WA7A 5I11A 4LE9A 1W70A 3VS3A 2JW4A 2RQUA 2KRNA 1WYXA 1RUWA 3H0FA 2KRMA 1NLPC 2PNIA 1AZEA 3NGPA 2LJ0A 1YNZA 3M0UA 4FSSA 3EG0A 2OJ2A 1GRIA 1PKTA 2LMJA 2A37A 2A08A 1NYGA 1XOVA 1K4US 3QWXX 4AFQC 2FO0A 2O31A 1BU1A 1UJYA 2CSIA 1U06A 1CKBA 1KJWA 1WXUA 1RLPC 1WX6A 2YDLA 1I1JA 2D1XA 1M27C 1X27A 2EYXA 4HXJA 2DRMA 2EYYA 2LX7A 4F14A 2KXCA 1RLQC 1HJDA 2JMAA 1YWOA 4RTVA 4J9CA 2DE0X 4J9BA 2KT1A 2FPDA 2ENMA 2EYZA 2AKLA 4ZNXA 1ZUUA 1SHGA 1G2BA 2ED0A 2PTKA 4IIOA 4IIMA 4AG1C 3ULRB 3VS0A 4RUGA 1HD3A 2ROTA 2HCKA 2NWMA 5IXFA 1U5SA 1JXOA 2DRKA 3NHNA 4OMNA 2DL5A 2YUNA 4JJDA 2V1QA 3TVTA 1ZSGA 4JZ4A 1ZUYA 2B86A 2FRWA 1UECA 1TUCA 1W6XA 1FYNA 4DEYA 5IXBA 1ZX6A 2L3QA 4HVVA 4X1VA 4E6RA 3UA7A 4RTTA 1WFWA 1OPKA 2J6FA 3UATA 2K9GA 4LUEA 4D8KA 4R0KA 1GCPA 5IHIA 2F2XA 1X6BA 4RTXA 1UG1A 1AWXA 2CUBA 2ECZA 1J3TA 2KROA 1QWFA 2CSQA 1VYUA 1S1NA 1T0HA 2CT3A 2DMOA 2JT4A 1U3OA 1NEGA 3H0HA 1WXTA 4AG2C 1A0NB 1SSHA 1SRLA 2ROLA 2HBWA 3O5ZA 5I22A 1E6HA 3VS4A 2I0NA 2RMOA 5FWCA 2AKKA 1PKSA 3TSWA 4KRTA 3SHWA 2YUQA 2M51A 2JM9A 1VA7A 2EYWA 1UGVA 2D8JA 2KXDA 2RNAA 2RPNA 3CQTA 1QKWA 2GTOA 2DL7A 1N5ZA 1WI7A 2PZ1A 2JS0A 4JJCA 3VRZA 2J7IA 2RN8A 3M0RA 4J9IA 1X2KA 1B3QA 1X43A 1M3BA 1Z9QA 2NUZA 2KYMA 2O9VA 2YT6A 2IIMA 1I07A 2O88A 1ABOA 1FMKA 2F2VA 1M3CA 1PRLC 2EQIA 3REBB 2EGCA 2EPDA 2EGEA 4GLMA 4Y92A 5FW9A 2SRCA 1EFNA 4JZ3A 3EG2A 4F17A 2F2WA 4AFUC 1OOTA 2A28A 1AOJA 1ARKA 2LNHB 2KGTA 3NMZC 1JQQA 1M8MA 2KR3A 3EHRA 3M0PA 1B07A 2RQRA 1X2QA 5FWBA 1UE9A 2FEIA 4Z88A 1E7OA 3ZL7C 2SEMA 1X69A 2RQWA 4CC7A 3VS2A 3I9QA 2C0OA 4RTWA 3JV3A 5GJVB 4M4ZA 5IH2A 1AWOA 2D0NA 2RQVA 3RNJA 1ZUKA 1TG0A 1UHCA 3LH5A 4LNPA 2W10A 4OMPA 2L0AA 2CDTA 2OAWA 1QLYA 2ED1A 2DILA 3GBQA 4Z89A 2V1RA 2MIOA 2DYBA 2DM1A 2BZXA 4Z8AA 2BTTA 2K7AA 4J9GA 1JXMA 2DF6A 4A63B 1OEBA 3M0SA 2GBQA 1UFFA 3I5RA
chains in the Genus database with same CATH superfamily
3OB9A 3P8BB 3X25B 3V8KA 2QASA 4ZGEB 1VOMA 1YJNT 3CCEQ 5FU7B 2FZCB 2DD4A 3H0IA 3CPWS 2CUDA 1WPYA 2QQAA 3A98A 1PWTA 2K79A 1B7TA 4PL6A 1W2BA 2C0TA 1GL5A 2R57A 3LW5E 2RF0A 1BIBA 2K4YA 1U8RA 3SWNB 3INZA 4MZMA 5J39A 2HDAA 5IHKA 5M9OA 1Y57A 4HCCA 3CXCS 2P4RA 3MEUA 2XU8A 2L2PA 4QVCA 3L2UA 3BDUA 2GQIA 1M3AA 1NE8A 4M77D 3HRTA 2V8JA 2FL7A 2XIDA 1R8OB 1MNDA 3X26B 1EIFA 1GFDA 1G83A 3CCJA 2KAFA 2G6FX 1P92A 1W1FA 5KE2A 2L3SA 1WHMA 4K11A 5D6WA 5A0DA 2VGNA 1WHLA 1JJ2S 3ZBDA 5GAOm 7AT1B 1GCQA 2VKNA 1YHQA 3VS1A 1K73C 5LJ5j 4EIKA 2YRVA 1HSQA 1VYTA 3QBYA 2HAXA 1UUEA 4IUQA 3C95A 1TUDA 4WCIA 2QEXQ 4OMMA 5FRMA 4E7SA 6AT1B 2AZVA 4FYVB 4B6MA 2NUTA 5KYYA 1TSFA 1SSFA 1ABQA 2DFUA 4ZTJA 4ZTFA 2X3WD 1H641 4RTYA 4NS5A 3CCJT 4HCZA 1MNEA 1S72A 1R0BG 3WVEB 2YRCA 5KYXA 1AHJB 1SPKA 1SEMA 4GY5A 1WJQA 3OS1A 3V8LA 1N9SA 1JJ2A 5DY9A 4XTXA 1KG1A 2M16A 4KUIA 5GMKm 5GAN7 4D6WA 5LJ5f 3G6EQ 1K76A 5GMKh 3JB9D 1PRMC 4E7HA 2E5KA 3PT9A 5CK9A 2AZSA 2BKDN 4OMQA 2HQHA 1H92A 1H8KA 1O75A 4FW1A 2YSQA 4PJLA 1V76A 1GFCA 1OZ3A 4M7AD 1MV0B 3OYAA 3NPFA 2C06A 2OTLA 2MK5A 5LJ5d 3EAEA 2KEAA 1KQ2A 2QDYB 3VS6A 4BE0A 2ZCFB 1AVZC 4C8QG 1VYVA 1LCKA 2BZYA 2K2MA 4L6V5 5GAN5 5LJ5e 4MZPA 1NBEB 1M4ZA 3R6OA 2EGAA 2KI7A 3OYBA 1PD1A 2GNCA 2DLPA 4Z02A 3N5BB 2A7YA 2YLCA 2CREA 4J9DA 1K1ZA 3JB9I 2GFUA 1AEYA 1D0XA 1RL2A 5KYYB 4ELYC 4II1A 2OTLT 3CCMT 3DLMA 2FB7A 3CC4A 5DLQE 3GLXA 4OB1B 1YBYA 3RR6A 4C0ZA 1E6GA 2DVJA 2LCLA 1TH7A 3RESA 4C92B 2VXFA 3HP9A 4J9HA 3X20B 2R5AA 2W0ZA 5KYNA 2V8IA 3V8JA 3OSSC 2F1LA 4PJJA 2O2OA 3PFSA 4BI3A 3A1PA 2HL3A 1UGQB 3UF4A 5EG2A 4M7DD 4AFZC 2E64A 4JRKA 1VQ8Q 3PMTA 5I11A 3HTRA 1W70A 4B9WA 1K8AU 2VUBA 4J6YA 4LDVA 4PJOC 1AZEA 3SFMA 1EZZB 4FYWB 3OYCA 4RMOA 1VQPQ 2M9UA 1M1FA 3M0UA 4FSSA 3KXTA 3JB9H 2LMJA 2R58A 3PMIA 2A37A 1NYGA 1XOVA 1K4US 1QMCA 3CBPA 3QWXX 4A4GA 1Q82U 4AFQC 1VQ4A 2KSSA 4BI8B 3EH2A 4C8QC 2CSIA 3OYGA 2HQXA 4LD6A 1JRIA 2EJFA 3A8MB 2VB6A 1SG5A 2ZPIB 1FWZA 1WX6A 2YDLA 3OYNA 3WXMB 3CC7A 2DRMA 2LC4A 4F14A 4KH0B 4PFZA 2KXCA 1YWOA 4RTVA 4M78C 1Y71A 2RJCA 4J9CA 3TCJA 5A2QE 4N0AC 3M59A 3C12A 1MGQA 5C6SA 1BI0A 2ENMA 2EYZA 2AKLA 1W4SA 3VUBA 4ZN1A 1SHGA 1G2BA 2ED0A 1SKUB 2WACA 3VS0A 2FZKB 3QJYA 3CCVT 2NWMA 5IXFA 3MEAA 1U5SA 2DRKA 3NHNA 4OMNA 2O4XA 3TQ7P 2DL5A 2YUNA 1KD1U 2RO0A 4OB2B 5AYFA 3CC7T 1ZSGA 4JZ4A 1VQOA 4L59A 2FRWA 1W6XA 1Q86U 3OW2P 2OAUA 1VQMQ 4DEYA 4MDXA 2L3QA 4HVVA 2RB6A 4RTTA 1WFWA 4FL6A 1X6OA 3OMGA 1GCPA 2RJEA 2M0OA 5IHIA 1X6BA 4RTXA 3AHUA 3CCET 2I2LA 2ECZA 2QQSA 2X35A 5AT1B 1VQ6A 3EFOA 1VYUA 1S1NA 1T0HA 3T9NA 2EJGA 2YRDA 2DMOA 3BY7A 1OI1A 4AG2C 2AHJB 1MHNA 3CPFA 2ROLA 2COYA 5CVIA 2DAQA 3O5ZA 5GAN2 2I0NA 1KD1R 2RI3A 3JCMe 5FWCA 2AKKA 1PKSA 4KRTA 3RMQA 1RAFB 3RKWA 3CCSA 3JCMJ 2YUQA 2M51A 4KULA 1FMWA 4IUTA 1QVPA 2ZPGB 4IKFA 2EYWA 2X4WA 1UGVA 2JUFA 2D8JA 2KXDA 2EQJA 3CQTA 2GTOA 1WI7A 3VRZA 2RN8A 1X2KA 3FEOA 2YLBA 1D1CA 2NUZA 3M56A 2KYMA 1M90U 4QQ6A 4A4FA 5GAOn 3BDLA 1PD0A 2FHDA 2KDSA 4HKEA 5GANj 2DZ9A 1FMKA 2EQIA 3REBB 5LJ5g 3HFOA 2EGCA 3NTKA 4F04B 2QGGA 4M77E 5FW9A 4DOVA 1RABB 4F17A 2HL5C 2QEXT 2O4XB 3NMZC 1M8MA 2RQRA 5FWBA 1KC8U 3QYHB 4MZTA 5IAYA 2BE9B 1Y07A 1WJSA 3M9QA 4JRIA 3CCRA 4XQ3A 3JRZA 4XTYA 1Q81U 3I9QA 4M4ZA 4FSXA 1AWOA 4C5EA 2RQVA 5FU7C 5KCHA 4LDXA 2W10A 3OY9A 2QAZA 2DVEA 1VQNQ 4OMPA 2DXTA 1ZSZA 3EFOB 4KBMB 1QLYA 1BYMA 1UB4A 2ED1A 4M7AG 5GANf 2DYBA 4OB0B 2X4XA 1TOVA 4M75C 4EMHA 4JUVA 2QQBA 1XJWB 3SWNC 2GBQA 4QKUA 2CKKA 3O8VA 2CP5A 4FM4B 1D09B 1IO6A 3GPLA 5KYWB 3CCRT 1PSEA 3VS5A 3OW2A 3RBBB 1KIKA 2J05A 3FDRA 4PJOD 1Y0MA 1C6VX 2X51A 2JS2A 1BBZA 1T3SA 2P0PA 3OYDA 3OYYA 2RJFA 5GANd 1VQKQ 2HSPA 2LQWA 3VKIA 3TSZA 3SDZA 3MP8A 5FRNA 4FYYB 1QWEA 4F16A 1VQLA 3J7AF 5GANe 1Q7YC 3EGDA 3HL8A 3U23A 3VJPA 1JU5C 3JCMW 1ZQ1A 2CP3A 3VRYA 2DNUA 4EDUA 2LP5A 4O6JA 2LT4A 1QCOA 1CKAA 2HNIA 4CC2A 3UA6A 1WLPB 3M57A 4IUVA 4PLLA 4A4KA 4M7AE 2PVGB 4M77A 4HA8A 1IB8A 2JNGA 2QGFB 5I21A 4LDWA 1RAEB 2QA4A 1SHFA 3CMEQ 3CMAA 4PK4A 4KGXB 5KYUA 1VQPA 2A36A 2EKHA 3SWNA 3AT1B 3M0QA 3FJPA 1VQLT 1K0XA 1YITQ 4BY6C 4RTUA 2GGRA 4C92G 2CYZB 1GXIE 3MKDA 3CCLA 4EMKB 2P0KA 1ZSZB 3M54A 2JVVA 1PCXA 1BK2A 3M4GA 3L2RA 1PC0A 2DXBA 1UTIA 2DTHA 2QA4T 1YCSB 2EVRA 3G4SQ 1WIEA 3E1SA 1YJNA 4R55A 2ABLA 1VQPT 3OS0A 3TU4K 3OS2A 1QQJA 3THKA 3L2WA 1ZBJA 1NJIR 3CCQQ 4M7DE 1NM7A 3L42A 2XDDA 1MUZA 1KFZA 4OGCA 4J8OA 1D1BA 2L3PA 3CBMA 2D6FA 1NJIC 2H3JA 1VQ5Q 2PVDB 1GCQC 2VC8A 5CKEA 3EGDB 1K73U 1G5VA 4C92E 2KE9A 3NFCA 5CO7A 4C0GA 4M77B 4JJNK 4M7AA 1PNJA 2E1HA 4OMLA 3JCMb 3L2VA 2KRSA 2ZGWA 2FPFA 5ECAA 1OQKA 2D8HA 5KYUB 1QVGS 4F7UF 2ESWA 1WDXA 4OMOA 2DXUA 2Y4XA 2DL4A 3OYKA 3RERA 1B34B 2COWA 1BI3A 1QKXA 4GBQA 4AFSC 3CCUQ 1VIEA 2DYIA 1VQMT 3FJ5A 4Y28E 5LJ5h 2YUPA 1K73R 4XTVA 4X9CA 3WVDB 1T3LA 2DIGA 3RIRA 1PM3A 2XHCA 3G71Q 3H9NA 2RQTA 4J7IA 2HBPA 4IUUA 3EGUA 1EX4A 1YJ9Q 4E7KA 2H8HA 2KK4A 1YFNA 1X6GA 1QVGA 1QW1A 2YWWA 5GMKi 4XU3A 3EG3A 2EQUA 5CKDA 1OX9A 4M7DA 1IZ6A 4LE9A 3CC2A 2JW4A 1IREB 4O5VA 4M75D 4GLKA 1KQSS 1WGSA 3BFMA 4CRIA 2KRMA 2E5QA 3UDCA 3FB9A 3GF5A 2QTXA 4ZN3A 3EG0A 2OJ2A 4KH1B 4PJNA 5GAN6 4C92A 2FO0A 4M7AB 1BU1A 1HYOA 3SD4A 4MMKA 1YIJA 1WXUA 2DERA 1RLPC 3OYHA 5GANg 1I1JA 4OVAA 2D1XA 3CC2T 1X27A 4XU2A 1RLQC 4E7LA 1HJDA 2VV5A 1BCMA 1G3SA 2NUPB 1KQSA 2KT1A 2MYSA 1N27A 2IG0A 3OYIA 4PJOF 3VYGA 1ZUUA 1UGPB 2DTIA 8AT1B 1VQ7A 3CCMA 4IIMA 1VQ9Q 4RUGA 1YIJT 1HD3A 2JTMA 3ER0A 1KK7A 4C8QF 4WTOB 4OB3B 1VQNT 1ZUYA 2NYSA 2E65A 4E6RA 3LX7A 3A8LB 3UATA 4A54A 1YJWQ 4R0KA 4M7DB 1QCNA 3EG9A 3GOXA 4M78F 1AWXA 1VQ7T 2MPXC 1IHWA 2KROA 4NL2A 2EQKA 1QWFA 2L5QA 1C0MA 1U3OA 1NEGA 3OYJA 1I81A 4ZGJB 4FW2A 2KQWA 2E4HA 2HBWA 5I22A 1XQHA 3PIOA 4AT1B 4A53A 1IRXA 2DETA 4BE1A 3RUXA 3LYIA 3JCMX 4DBRA 3NTIA 2E12A 1QKWA 3QG1A 1JBMA 1YI2Q 2ZPEB 2COZA 3JCMh 4JJCA 5A0LA 1QVFP 1M3BA 4PKCC 1Z9QA 2F69A 1K9MR 3CMET 4N4IA 1V29B 2M02A 1I07A 2O88A 2F2VA 2BE7D 1RACB 2EPDA 1OULA 3CCVA 2F2WA 1K9MC 2PUOB 4AFUC 1G8XA 1YITT 4LDYA 1AOJA 2CZ1B 2MAMA 2LNHB 2WSCE 2KGTA 3I56A 3S3MA 3EHRA 1ZA1B 1UE9A 4Z88A 4RG8A 3ZL7C 1X69A 1IHVA 4RCBA 4CC7A 3VS2A 2C0OA 5GJVB 1TU0B 5IH2A 3EG9B 1IGQA 3G4ST 4MMLA 3CCEA 1ZUKA 1UHCA 3MHXA 5LL6S 2CDTA 2OAWA 3CCQT 2DILA 2Y90A 3GBQA 3JCMc 4Z89A 1RAAB 2DM1A 3MP6A 3I56T 3OA6A 2QXFA 3M4YA 3M0SA 1VUBA 5D6YA 3JCMf 3LWHA 2IVWA 1M2VA 1ACMB 2BZ8A 4OMFB 4L5GA 4BUGA 2DJQA 1RAHB 5EC7A 1BCOA 3FRNA 3CCUA 2L3RA 1FX7A 2A3LA 2H3EB 1PSFA 2O01E 3ME9A 3MP1A 3S3OA 2CZ0B 2EKOA 3CD6Q 2XD0A 4RG2A 1M1KR 2LQNA 3TREA 2E41A 1RAGB 5FROA 5I2MA 4M77G 3J81E 3FC3A 3JCMd 2RHIA 2OX7A 1WXBA 1YJ9A 1LOJA 1M1KC 2LNVA 2O9SA 3E2UA 1WHHA 3BE3A 4HVWA 5IHNA 4M75F 1GBQA 5KYWA 3QDRB 2RI2A 4D8DA 4DBQA 2CP6A 2QEXA 3CCUT 2GQVA 3TEEA 4EMKC 5GANh 1V1CA 2KY9A 1ZSZC 1UHFA 1K9AA 4QVZA 2K3BA 1UGSB 2K2VA 2PVOB 4JLIA 1ZA2B 4XAXB 1H3HA 3MPUB 3VUZA 4RTZA 4FYXB 3REAB 2XG8D 2HQEA 1M2OA 2BUDA 1YJ9T 4C5IA 3QUIA 3CCJQ 4LUDA 2XDBA 2EAYA 2QG9B 1YHQQ 1IXDA 2FPEA 2MI6A 3G6EA 1ZHIA 5L23A 2DBKA 2J6KA 3LLRA 3I35A 3OYLA 2DL3A 1M2VB 3OW2S 2MWOA 1NYFA 5CKBA 1M30A 5GJWB 2KNBB 3JB9G 1Q7YU 1YWPA 2F5TX 2RJDA 1WJRA 1Y96A 3QZ5B 1I0CA 2JOYA 4OP0A 4M77C 2DZCA 3OQ5A 1UDLA 1SF9A 1S72Q 2J06A 3VV0A 4EMKA 2JZ2A 1LVKA 1PHTA 2DJZA 2M1HA 1AWWA 3IQLA 1M1GA 4OGEA 1X01A 2MOXA 4DEXA 2FG0A 3G6ET 2E6NA 1LPLA 3I5SA 2XICA 3GNFB 3M53A 3FIFA 4DBFA 3HRSA 1DJ7B 3CEYA 2ZAEA 2GTJA 1XNIA 1OU8A 1RI9A 2LJ3A 1OX8A 3C94A 3PVQA 3SEMA 2C0IA 2DO3A 2XK0A 2XMFA 3QDFA 5IT9E 1WHJA 3QIIA 1Q7YR 1NLOC 3M58A 2KT8A 2MMPA 2V26A 2K3YA 4JJBA 5GAMj 1MV3A 2RA2A 2LQ8A 3EHQA 8ATCB 4C8QD 1W2BP 2OTLQ 4J9FA 1NG2A 2QYZA 1C1AA 4ELZC 4J83A 3DKMA 2FRYA 2FYKA 2L8DA 1WHKA 2R5MA 3DLLA 4XTUA 2VYTA 2RM4A 2JTEA 1MMDA 1UJ0A 1VQ8A 3FLGA 2CS7A 3M0TA 5CIUA 3M55A 1F1BB 5IN1A 4M78D 2K6DA 1JEGA 2DEQA 2DTOA 4C5HA 1OPLA 2DL8A 3JB9J 4M7DG 5CR2A 1LNXA 4CC4B 5GAOr 4N4GA 1NJIU 2DX1A 2J6OA 4JS5A 4CC3A 1QP2A 9ATCB 1Y96B 4KGVB 3CPWP 1B34A 2HD0A 2YXYA 2PU9B 2DEUA 1WA7A 1OZ2A 5GAMf 3CC4Q 4M7AC 2LX9A 2K5IA 2KRNA 4VUBA 5HY6A 1WYXA 1RUWA 2PQWA 3H0FA 4ME7A 2ZPBB 4QQGA 1VQ8T 3J80E 3NGPA 1YNZA 3OYFA 3CXCP 1GRIA 2EWNA 5GAN8 2A08A 1NPRA 2QTVA 1YI2T 2O31A 5GAMd 2EYQA 1U06A 2DIQA 2WSEE 2F5KA 4PJMA 3QHSA 5LJ3j 2EYXA 3JSCA 4HXJA 5D7UA 5GAMe 4KT0E 2EYYA 1JJ2P 5CQYA 5CKHA 4J5YA 3JCMg 1VQ4Q 2XDPA 1JB0E 2D9TA 3A8HB 4YTLA 1VQMA 1X75C 1TXQA 3H6ZA 3MEWA 5DLOA 4M7DC 4AG1C 1MMNA 3ULRB 5KCOA 4RKUE 4J6WA 1LJOA 3META 3H8ZA 2QQRA 4JJDA 2V1QA 3TVTA 1WQWA 3OS5A 2G3RA 3ASKA 1TUCA 1FYNA 2VASA 3UT1A 1RI0A 2CP2A 1KQ1A 1Q95G 3C4SA 4IUPA 2X4YA 4X1VA 5LJ3f 4C92C 1OPKA 4XTZA 3URGA 2NUPA 1U1SA 2LT1A 4XU0A 2E6ZA 2ZPHB 2F2XA 4HCBA 4BDZA 4F7UG 4M75B 3MEVA 4BI4A 4C0DB 3HPWA 1VQOQ 4EPCA 2CSQA 4C5GA 5FU6B 2JT4A 3H0HA 3CD6T 3OSVA 1TUGB 5LJ3d 3HFNA 4BDYA 5GAOl 1E6HA 3I55Q 3VS4A 2RMOA 1IGUA 4FCYA 3TSWA 5LJ3e 3SHWA 1VQ6Q 4A4HA 2RHYA 2E3HA 2HKNA 2JM9A 1UEBA 4PLIA 3CPWA 2EIFA 2RNAA 2JN0A 2DL7A 1NZ9A 1N5ZA 2PZ1A 2J7IA 4FT2A 3M0RA 1B3QA 1X43A 2E70A 2OTJQ 3V7SA 3JAME 2MF2A 2EJ9A 2YT6A 5HK0A 2K5LA 4CI0C 3CCSQ 4V2SA 3CXCA 1ABOA 1M3CA 3BW1A 4F7UE 3A5ZB 3A8OB 4Y92A 2SRCA 4JZ3A 4KGZB 5L8RE 1BKBA 1OOTA 2RK2A 5DM7R 1JQQA 5HK3A 5GMKl 1VQNA 3M0PA 3KUFA 2NLUA 2FEIA 3HRUA 2MWPA 1E7OA 3L2ZA 1YHQT 4BY6B 4RTWA 2D0NA 4P5NA 4JRQA 4NL3A 1TG0A 4LNPA 2DPPB 3GP8A 2CP0A 3MO8A 4ZGDB 1I4K1 2DXCA 3CCRQ 2WSFE 4BACA 3V7RA 3QO3A 2X4JA 2K7AA 3ZEHA 2DF6A 4A63B 1S72T 1VQKA 4PJOG 1UFFA 3I5RA 1ZBXA 5GMKj 4HT9A 1N6AA 3EGXA 3JCMQ 4Q5WA 2LCCA 2E3IA 5A0GA 2VVKA 2Z0WA 3F70A 2VWFA 1K9MU 3X24B 2RH2A 2OI3A 1I5LA 1Z9ZA 4PFPA 2RHZA 3G7ZA 4IURA 1QP3A 3QPHA 3RMSA 2K5FA 4BD3A 4DQ2A 3CMEA 3H41A 1PG5B 4BE2A 2P0QA 5GAOp 2DA9A 1VQKT 2HEQA 3RDVA 2JM8A 4J9EA 4M78G 5GAMg 2EQMA 2NUTB 2QDLA 4J7FA 4F7UA 4QT7A 1O9SA 2X9HA 1YITA 3P8HA 4LDUA 3V7CA 4C0FA 3VS7A 2HSEB 4PJOE 5KYXB 2AK5A 3QSUA 1VQLQ 3PVLA 4B9XA 2KBTA 3MCAB 3GNGA 2CZ7B 3E9FA 3C0CA 1TWBA 4QQDA 2MCNA 4ESRA 4C8QE 1TTHB 3G4SA 2RI5A 1D1AA 2VGMA 2GF7A 2JXBA 3PIPA 2AIRB 4PFOA 2Y4YA 1G3TA 2QA4Q 2LZ6B 3CMAQ 3EG1A 3CCQA 4RCCA 1WHGA 1QCFA 3CC4T 2LJ1A 3RKXA 2KYBA 4C92D 1N8RU 5GAN3 2LCSA 4M78E 4J6XA 5GMKe 2YUOA 4XK8E 1VQ5A 1WZOA 3EGXB 5CAIA 3CCLQ 2K3XA 3VU3C 1M1KU 3HHTB 3E9GA 1N9RA 2CT4A 2E10A 2JJ9A 1ZLMA 2EW3A 1D0YA 1AZGB 1K0SA 3A8GB 1KHIA 5KH6A 2GCXA 3ZFJA 1BB9A 1SRMA 1BI2A 4ANJA 2DBMA 3L2QA 1K8AR 3KFVA 1AWJA 4Y91A 2ATCB 1YJNQ 5HCKA 2EBPA 4NOYA 2LDMA 5LJ3g 2JMCA 1U1TA 5GAOq 2XKOC 4DA4A 1YN8A 3JCMP 2CH4A 2M0YA 3QZ9B 4F7UB 5GAN4 1N8RR 3LGLA 1VQ4T 1VQ5T 4XU1A 1K8AC 5D6XA 1AD5A 1WQ7A 1D0ZA 1NPPA 1M9SA 1Q82R 1MMGA 2KMTA 5KE3A 4PJOA 1YP5A 1CSKA 1AT1B 3PTAA 1N8RC 1MMAA 2AT1B 3OBWA 4HCKA 1QVFS 2RHXA 1RAIB 4M77F 1KSWA 1VIFA 1UGRB 4HVUA 4N4HA 3PE0A 3LGFA 4DBHA 4E7IA 4BB7A 4JPBW 5HKCA 3G71A 1Q82C 5CCAA 2PUKB 1JO8A 3SB2A 2XI9A 4C8QA 3QYGB 2FVUA 2EFIA 3I55A 2IPOB 1G3WA 3JCMV 4E2FB 4JS4A 3R6NA 2FZGB 2CH4W 3OBYA 3LH0A 4ORZA 1NEBA 2X3XD 3HSBA 4XTWA 4M78A 1OV3A 2YHTA 4QVDA 1VQOT 4N0AA 3QWYA 2OTJA 3E19A 2DD5A 3OMCA 1OYXA 3G1JA 1WNLA 4M75G 1GBRA 1T0JA 4LN2A 3G71T 3S3NA 1Q86R 3L1AA 1QVFA 1OU9A 2GFAA 5FLXE 3VS3A 3I55T 2RQUA 1KD1C 1TS9A 2JTFA 1NLPC 2PNIA 2D0QB 1VQ6T 2LJ0A 1Q86C 4KUDK 1PKTA 3UPUA 2LQKA 1HK9A 3DB4A 3CC2Q 4ATOA 2OTJT 4DOWA 3EFSA 1UJYA 3JB9F 1CKBA 4FU6A 2DK3A 5J26A 1KJWA 2LRQA 3PNWC 4PJOB 3LWIA 2KVQG 3CCST 1M27C 2LX7A 1VQ9A 1H3ZA 2VXEA 1R0CB 2CGHA 2HMAA 2JMAA 4M75E 4E7ZA 4M7AF 2P4TA 4EMGA 2DE0X 2HKQB 4J9BA 4JLGA 2K57A 4C8QB 3OYEA 1YIJQ 2FPDA 4A4EA 1D3BA 5GAMh 4ZNXA 5CKFA 4JRPA 4WF2A 4HT8A 2PTKA 4IIOA 2QI2A 1M90R 5J3BA 1YJWA 4JDSA 2HZYA 1M5Q1 2ROTA 3P8DA 2HCKA 5I2SA 1JXOA 1KHCA 3M5AA 4UC4A 4E7JA 4M78B 4C0DC 4TVRA 2B86A 1VQ9T 1UECA 5FU6C 4E47A 1M90C 5IXBA 1ZX6A 4FIBA 3CBOA 3UA7A 1VQ7Q 4FT4A 2J6FA 3CCMQ 2K9GA 4PNOA 3UWNA 1FMVA 1KC8R 4LUEA 4D8KA 3GIBA 1UG1A 3EFRA 1Q81R 2CUBA 1J3TA 3HKSA 1YJWT 2CT3A 1KC8C 2A0FB 1BI1A 1WXTA 1A0NB 1SSHA 3QJ6A 4M7DF 1SRLA 1Q81C 3QKJA 1YI2A 4AMCA 2LTOA 2P84A 1BIAA 3PGGA 1Y7XA 4MDWA 4LD9K 2RD1A 4C92F 2RK1A 3OYMA 1VA7A 2RPNA 1QVGP 2CP7A 4M75A 2JS0A 4J9IA 5LJ3h 2L89A 1XTDA 1D3BB 2O9VA 2CZ6B 2IIMA 1PRLC 1I8FA 1I5OB 2V8KA 2EGEA 3Q1JA 4GLMA 1EFNA 2LVMA 3EG2A 2RHUA 2A28A 1ARKA 1R77A 3VYHB 3S6WA 2KR3A 1B07A 2DKGA 1X2QA 3CMAT 3KBGA 3QXEB 2B8AA 3MJXA 3DB3A 2SEMA 4X34A 1YCYA 1FXXA 2RQWA 1W2BS 3JV3A 2QK0A 3CCVQ 1RADB 3D7SB 5C0MA 3RKYA 3RNJA 3LH5A 1HXDA 4QW2A 4OF1A 4X9DA 3CCLT 3NTHA 3I56Q 4R56A 3CC7Q 3EH1A 2L0AA 1KQSP 1G3YA 3X28B 2ZPFB 4LXCA 2BIVA 2ZZDA 2V1RA 3CD6A 2MIOA 1M8VA 2QQ9A 2BZXA 4Z8AA 2BTTA 4J9GA 1JXMA 5CQXA 1OEBA
chains in the Genus database with same CATH topology
1IO6A 2BZ8A 2DJQA 3H0IA 5EC7A 2CUDA 3VS5A 3RBBB 1KIKA 2J05A 3A98A 1Y0MA 1PWTA 2VVKA 2K79A 2JS2A 1BBZA 1T3SA 2VWFA 2C0TA 2LQNA 1GL5A 2RF0A 2HSPA 2LQWA 2OI3A 3TSZA 1Z9ZA 2HDAA 5IHKA 1Y57A 1QWEA 2P4RA 4F16A 3H41A 2L2PA 2DA9A 3U23A 1WXBA 2GQIA 1JU5C 2HEQA 2JM8A 2O9SA 3VRYA 2DNUA 4J9EA 2LP5A 1M3AA 2QDLA 1CKAA 4CC2A 4HVWA 1WLPB 5IHNA 3UA6A 1GBQA 4QT7A 4D8DA 1GFDA 1G83A 2G6FX 1V1CA 3VS7A 1W1FA 1UHFA 1K9AA 2L3SA 4K11A 2AK5A 2K3BA 1SHFA 3PVLA 1GCQA 2VKNA 1H3HA 3VS1A 2KBTA 2A36A 2EKHA 4RTZA 4EIKA 3REAB 1HSQA 1VYTA 3C0CA 1UUEA 3M0QA 2MCNA 4ESRA 1TUDA 1K0XA 4WCIA 4OMMA 4RTUA 2GGRA 2AZVA 2JXBA 4LUDA 2LZ6B 1ABQA 3EG1A 1BK2A 2X3WD 1QCFA 2FPEA 2LJ1A 4RTYA 5L23A 2KYBA 2DBKA 2J6KA 2LCSA 1UTIA 3I35A 2YUOA 1SPKA 2DL3A 1YCSB 2EVRA 1SEMA 1NYFA 1WIEA 1M30A 5GJWB 2KNBB 2ABLA 1YWPA 2CT4A 3THKA 1ZBJA 1I0CA 1ZLMA 2EW3A 1AZGB 1NM7A 1UDLA 1K76A 1K0SA 1MUZA 1KFZA 2J06A 1PRMC 1PHTA 1BB9A 1SRMA 2L3PA 1AWWA 2E5KA 3IQLA 2DBMA 2AZSA 2MOXA 4DEXA 3KFVA 4OMQA 1AWJA 2FG0A 1H92A 5HCKA 2EBPA 1GCQC 3I5SA 1H8KA 2JMCA 1YN8A 2CH4A 2M0YA 2KE9A 2YSQA 1GFCA 1MV0B 3NPFA 2GTJA 1PNJA 1RI9A 2LJ3A 1AD5A 2KEAA 4OMLA 3PVQA 3VS6A 3SEMA 2C0IA 2KRSA 2XMFA 1AVZC 1YP5A 1VYVA 2FPFA 1CSKA 1LCKA 1NLOC 2BZYA 5ECAA 2D8HA 2K2MA 2ESWA 2KT8A 4JJBA 1WDXA 1MV3A 4OMOA 2EGAA 4HCKA 1KSWA 2DL4A 3EHQA 2GNCA 4HVUA 3PE0A 2DLPA 4JPBW 1QKXA 2CREA 1JO8A 4J9DA 4J9FA 1K1ZA 4GBQA 1NG2A 4AFSC 1AEYA 2FRYA 3FJ5A 2YUPA 2JTEA 1UJ0A 3M0TA 3R6NA 1T3LA 2CH4W 2K6DA 1E6GA 4ORZA 1JEGA 1NEBA 2DVJA 1OPLA 2DL8A 2X3XD 2RQTA 4J9HA 1OV3A 3EGUA 4CC4B 2W0ZA 2DX1A 3QWYA 2H8HA 2O2OA 2J6OA 4CC3A 1GBRA 1T0JA 1X6GA 4LN2A 3UF4A 4AFZC 3EG3A 1WA7A 5I11A 4LE9A 1W70A 3VS3A 2JW4A 2RQUA 2KRNA 1WYXA 1RUWA 3H0FA 2KRMA 1NLPC 2PNIA 1AZEA 3NGPA 2LJ0A 1YNZA 3M0UA 4FSSA 3EG0A 2OJ2A 1GRIA 1PKTA 2LMJA 2A37A 2A08A 1NYGA 1XOVA 1K4US 3QWXX 4AFQC 2FO0A 2O31A 1BU1A 1UJYA 2CSIA 1U06A 1CKBA 1KJWA 1WXUA 1RLPC 1WX6A 2YDLA 1I1JA 2D1XA 1M27C 1X27A 2EYXA 4HXJA 2DRMA 2EYYA 2LX7A 4F14A 2KXCA 1RLQC 1HJDA 2JMAA 1YWOA 4RTVA 4J9CA 2DE0X 4J9BA 2KT1A 2FPDA 2ENMA 2EYZA 2AKLA 4ZNXA 1ZUUA 1SHGA 1G2BA 2ED0A 2PTKA 4IIOA 4IIMA 4AG1C 3ULRB 3VS0A 4RUGA 1HD3A 2ROTA 2HCKA 2NWMA 5IXFA 1U5SA 1JXOA 2DRKA 3NHNA 4OMNA 2DL5A 2YUNA 4JJDA 2V1QA 3TVTA 1ZSGA 4JZ4A 1ZUYA 2B86A 2FRWA 1UECA 1TUCA 1W6XA 1FYNA 4DEYA 5IXBA 1ZX6A 2L3QA 4HVVA 4X1VA 4E6RA 3UA7A 4RTTA 1WFWA 1OPKA 2J6FA 3UATA 2K9GA 4LUEA 4D8KA 4R0KA 1GCPA 5IHIA 2F2XA 1X6BA 4RTXA 1UG1A 1AWXA 2CUBA 2ECZA 1J3TA 2KROA 1QWFA 2CSQA 1VYUA 1S1NA 1T0HA 2CT3A 2DMOA 2JT4A 1U3OA 1NEGA 3H0HA 1WXTA 4AG2C 1A0NB 1SSHA 1SRLA 2ROLA 2HBWA 3O5ZA 5I22A 1E6HA 3VS4A 2I0NA 2RMOA 5FWCA 2AKKA 1PKSA 3TSWA 4KRTA 3SHWA 2YUQA 2M51A 2JM9A 1VA7A 2EYWA 1UGVA 2D8JA 2KXDA 2RNAA 2RPNA 3CQTA 1QKWA 2GTOA 2DL7A 1N5ZA 1WI7A 2PZ1A 2JS0A 4JJCA 3VRZA 2J7IA 2RN8A 3M0RA 4J9IA 1X2KA 1B3QA 1X43A 1M3BA 1Z9QA 2NUZA 2KYMA 2O9VA 2YT6A 2IIMA 1I07A 2O88A 1ABOA 1FMKA 2F2VA 1M3CA 1PRLC 2EQIA 3REBB 2EGCA 2EPDA 2EGEA 4GLMA 4Y92A 5FW9A 2SRCA 1EFNA 4JZ3A 3EG2A 4F17A 2F2WA 4AFUC 1OOTA 2A28A 1AOJA 1ARKA 2LNHB 2KGTA 3NMZC 1JQQA 1M8MA 2KR3A 3EHRA 3M0PA 1B07A 2RQRA 1X2QA 5FWBA 1UE9A 2FEIA 4Z88A 1E7OA 3ZL7C 2SEMA 1X69A 2RQWA 4CC7A 3VS2A 3I9QA 2C0OA 4RTWA 3JV3A 5GJVB 4M4ZA 5IH2A 1AWOA 2D0NA 2RQVA 3RNJA 1ZUKA 1TG0A 1UHCA 3LH5A 4LNPA 2W10A 4OMPA 2L0AA 2CDTA 2OAWA 1QLYA 2ED1A 2DILA 3GBQA 4Z89A 2V1RA 2MIOA 2DYBA 2DM1A 2BZXA 4Z8AA 2BTTA 2K7AA 4J9GA 1JXMA 2DF6A 4A63B 1OEBA 3M0SA 2GBQA 1UFFA 3I5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IO6 A;  2BZ8 A;  2DJQ A;  3H0I A;  5EC7 A;  2CUD A;  3VS5 A;  3RBB B;  1KIK A;  2J05 A;  3A98 A;  1Y0M A;  1PWT A;  2VVK A;  2K79 A;  2JS2 A;  1BBZ A;  1T3S A;  2VWF A;  2C0T A;  2LQN A;  1GL5 A;  2RF0 A;  2HSP A;  2LQW A;  2OI3 A;  3TSZ A;  1Z9Z A;  2HDA A;  5IHK A;  1Y57 A;  1QWE A;  2P4R A;  4F16 A;  3H41 A;  2L2P A;  2DA9 A;  3U23 A;  1WXB A;  2GQI A;  1JU5 C;  2HEQ A;  2JM8 A;  2O9S A;  3VRY A;  2DNU A;  4J9E A;  2LP5 A;  1M3A A;  2QDL A;  1CKA A;  4CC2 A;  4HVW A;  1WLP B;  5IHN A;  3UA6 A;  1GBQ A;  4QT7 A;  4D8D A;  1GFD A;  1G83 A;  2G6F X;  1V1C A;  3VS7 A;  1W1F A;  1UHF A;  1K9A A;  2L3S A;  4K11 A;  2AK5 A;  2K3B A;  1SHF A;  3PVL A;  1GCQ A;  2VKN A;  1H3H A;  3VS1 A;  2KBT A;  2A36 A;  2EKH A;  4RTZ A;  4EIK A;  3REA B;  1HSQ A;  1VYT A;  3C0C A;  1UUE A;  3M0Q A;  2MCN A;  4ESR A;  1TUD A;  1K0X A;  4WCI A;  4OMM A;  4RTU A;  2GGR A;  2AZV A;  2JXB A;  4LUD A;  2LZ6 B;  1ABQ A;  3EG1 A;  1BK2 A;  2X3W D;  1QCF A;  2FPE A;  2LJ1 A;  4RTY A;  5L23 A;  2KYB A;  2DBK A;  2J6K A;  2LCS A;  1UTI A;  3I35 A;  2YUO A;  1SPK A;  2DL3 A;  1YCS B;  2EVR A;  1SEM A;  1NYF A;  1WIE A;  1M30 A;  5GJW B;  2KNB B;  2ABL A;  1YWP A;  2CT4 A;  3THK A;  1ZBJ A;  1I0C A;  1ZLM A;  2EW3 A;  1AZG B;  1NM7 A;  1UDL A;  1K76 A;  1K0S A;  1MUZ A;  1KFZ A;  2J06 A;  1PRM C;  1PHT A;  1BB9 A;  1SRM A;  2L3P A;  1AWW A;  2E5K A;  3IQL A;  2DBM A;  2AZS A;  2MOX A;  4DEX A;  3KFV A;  4OMQ A;  1AWJ A;  2FG0 A;  1H92 A;  5HCK A;  2EBP A;  1GCQ C;  3I5S A;  1H8K A;  2JMC A;  1YN8 A;  2CH4 A;  2M0Y A;  2KE9 A;  2YSQ A;  1GFC A;  1MV0 B;  3NPF A;  2GTJ A;  1PNJ A;  1RI9 A;  2LJ3 A;  1AD5 A;  2KEA A;  4OML A;  3PVQ A;  3VS6 A;  3SEM A;  2C0I A;  2KRS A;  2XMF A;  1AVZ C;  1YP5 A;  1VYV A;  2FPF A;  1CSK A;  1LCK A;  1NLO C;  2BZY A;  5ECA A;  2D8H A;  2K2M A;  2ESW A;  2KT8 A;  4JJB A;  1WDX A;  1MV3 A;  4OMO A;  2EGA A;  4HCK A;  1KSW A;  2DL4 A;  3EHQ A;  2GNC A;  4HVU A;  3PE0 A;  2DLP A;  4JPB W;  1QKX A;  2CRE A;  1JO8 A;  4J9D A;  4J9F A;  1K1Z A;  4GBQ A;  1NG2 A;  4AFS C;  1AEY A;  2FRY A;  3FJ5 A;  2YUP A;  2JTE A;  1UJ0 A;  3M0T A;  3R6N A;  1T3L A;  2CH4 W;  2K6D A;  1E6G A;  4ORZ A;  1JEG A;  1NEB A;  2DVJ A;  1OPL A;  2DL8 A;  2X3X D;  2RQT A;  4J9H A;  1OV3 A;  3EGU A;  4CC4 B;  2W0Z A;  2DX1 A;  3QWY A;  2H8H A;  2O2O A;  2J6O A;  4CC3 A;  1GBR A;  1T0J A;  1X6G A;  4LN2 A;  3UF4 A;  4AFZ C;  3EG3 A;  1WA7 A;  5I11 A;  4LE9 A;  1W70 A;  3VS3 A;  2JW4 A;  2RQU A;  2KRN A;  1WYX A;  1RUW A;  3H0F A;  2KRM A;  1NLP C;  2PNI A;  1AZE A;  3NGP A;  2LJ0 A;  1YNZ A;  3M0U A;  4FSS A;  3EG0 A;  2OJ2 A;  1GRI A;  1PKT A;  2LMJ A;  2A37 A;  2A08 A;  1NYG A;  1XOV A;  1K4U S;  3QWX X;  4AFQ C;  2FO0 A;  2O31 A;  1BU1 A;  1UJY A;  2CSI A;  1U06 A;  1CKB A;  1KJW A;  1WXU A;  1RLP C;  1WX6 A;  2YDL A;  1I1J A;  2D1X A;  1M27 C;  1X27 A;  2EYX A;  4HXJ A;  2DRM A;  2EYY A;  2LX7 A;  4F14 A;  2KXC A;  1RLQ C;  1HJD A;  2JMA A;  1YWO A;  4RTV A;  4J9C A;  2DE0 X;  4J9B A;  2KT1 A;  2FPD A;  2ENM A;  2EYZ A;  2AKL A;  4ZNX A;  1ZUU A;  1SHG A;  1G2B A;  2ED0 A;  2PTK A;  4IIO A;  4IIM A;  4AG1 C;  3ULR B;  3VS0 A;  4RUG A;  1HD3 A;  2ROT A;  2HCK A;  2NWM A;  5IXF A;  1U5S A;  1JXO A;  2DRK A;  3NHN A;  4OMN A;  2DL5 A;  2YUN A;  4JJD A;  2V1Q A;  3TVT A;  1ZSG A;  4JZ4 A;  1ZUY A;  2B86 A;  2FRW A;  1UEC A;  1TUC A;  1W6X A;  1FYN A;  4DEY A;  5IXB A;  1ZX6 A;  2L3Q A;  4HVV A;  4X1V A;  4E6R A;  3UA7 A;  4RTT A;  1WFW A;  1OPK A;  2J6F A;  3UAT A;  2K9G A;  4LUE A;  4D8K A;  4R0K A;  1GCP A;  5IHI A;  2F2X A;  1X6B A;  4RTX A;  1UG1 A;  1AWX A;  2CUB A;  2ECZ A;  1J3T A;  2KRO A;  1QWF A;  2CSQ A;  1VYU A;  1S1N A;  1T0H A;  2CT3 A;  2DMO A;  2JT4 A;  1U3O A;  1NEG A;  3H0H A;  1WXT A;  4AG2 C;  1A0N B;  1SSH A;  1SRL A;  2ROL A;  2HBW A;  3O5Z A;  5I22 A;  1E6H A;  3VS4 A;  2I0N A;  2RMO A;  5FWC A;  2AKK A;  1PKS A;  3TSW A;  4KRT A;  3SHW A;  2YUQ A;  2M51 A;  2JM9 A;  1VA7 A;  2EYW A;  1UGV A;  2D8J A;  2KXD A;  2RNA A;  2RPN A;  3CQT A;  1QKW A;  2GTO A;  2DL7 A;  1N5Z A;  1WI7 A;  2PZ1 A;  2JS0 A;  4JJC A;  3VRZ A;  2J7I A;  2RN8 A;  3M0R A;  4J9I A;  1X2K A;  1B3Q A;  1X43 A;  1M3B A;  1Z9Q A;  2NUZ A;  2KYM A;  2O9V A;  2YT6 A;  2IIM A;  1I07 A;  2O88 A;  1ABO A;  1FMK A;  2F2V A;  1M3C A;  1PRL C;  2EQI A;  3REB B;  2EGC A;  2EPD A;  2EGE A;  4GLM A;  4Y92 A;  5FW9 A;  2SRC A;  1EFN A;  4JZ3 A;  3EG2 A;  4F17 A;  2F2W A;  4AFU C;  1OOT A;  2A28 A;  1AOJ A;  1ARK A;  2LNH B;  2KGT A;  3NMZ C;  1JQQ A;  1M8M A;  2KR3 A;  3EHR A;  3M0P A;  1B07 A;  2RQR A;  1X2Q A;  5FWB A;  1UE9 A;  2FEI A;  4Z88 A;  1E7O A;  3ZL7 C;  2SEM A;  1X69 A;  2RQW A;  4CC7 A;  3VS2 A;  3I9Q A;  2C0O A;  4RTW A;  3JV3 A;  5GJV B;  4M4Z A;  5IH2 A;  1AWO A;  2D0N A;  2RQV A;  3RNJ A;  1ZUK A;  1TG0 A;  1UHC A;  3LH5 A;  4LNP A;  2W10 A;  4OMP A;  2L0A A;  2CDT A;  2OAW A;  1QLY A;  2ED1 A;  2DIL A;  3GBQ A;  4Z89 A;  2V1R A;  2MIO A;  2DYB A;  2DM1 A;  2BZX A;  4Z8A A;  2BTT A;  2K7A A;  4J9G A;  1JXM A;  2DF6 A;  4A63 B;  1OEB A;  3M0S A;  2GBQ A;  1UFF A;  3I5R A; 
#chains in the Genus database with same CATH topology
 3OB9 A;  3P8B B;  3X25 B;  3V8K A;  2QAS A;  4ZGE B;  1VOM A;  1YJN T;  3CCE Q;  5FU7 B;  2FZC B;  2DD4 A;  3H0I A;  3CPW S;  2CUD A;  1WPY A;  2QQA A;  3A98 A;  1PWT A;  2K79 A;  1B7T A;  4PL6 A;  1W2B A;  2C0T A;  1GL5 A;  2R57 A;  3LW5 E;  2RF0 A;  1BIB A;  2K4Y A;  1U8R A;  3SWN B;  3INZ A;  4MZM A;  5J39 A;  2HDA A;  5IHK A;  5M9O A;  1Y57 A;  4HCC A;  3CXC S;  2P4R A;  3MEU A;  2XU8 A;  2L2P A;  4QVC A;  3L2U A;  3BDU A;  2GQI A;  1M3A A;  1NE8 A;  4M77 D;  3HRT A;  2V8J A;  2FL7 A;  2XID A;  1R8O B;  1MND A;  3X26 B;  1EIF A;  1GFD A;  1G83 A;  3CCJ A;  2KAF A;  2G6F X;  1P92 A;  1W1F A;  5KE2 A;  2L3S A;  1WHM A;  4K11 A;  5D6W A;  5A0D A;  2VGN A;  1WHL A;  1JJ2 S;  3ZBD A;  5GAO m;  7AT1 B;  1GCQ A;  2VKN A;  1YHQ A;  3VS1 A;  1K73 C;  5LJ5 j;  4EIK A;  2YRV A;  1HSQ A;  1VYT A;  3QBY A;  2HAX A;  1UUE A;  4IUQ A;  3C95 A;  1TUD A;  4WCI A;  2QEX Q;  4OMM A;  5FRM A;  4E7S A;  6AT1 B;  2AZV A;  4FYV B;  4B6M A;  2NUT A;  5KYY A;  1TSF A;  1SSF A;  1ABQ A;  2DFU A;  4ZTJ A;  4ZTF A;  2X3W D;  1H64 1;  4RTY A;  4NS5 A;  3CCJ T;  4HCZ A;  1MNE A;  1S72 A;  1R0B G;  3WVE B;  2YRC A;  5KYX A;  1AHJ B;  1SPK A;  1SEM A;  4GY5 A;  1WJQ A;  3OS1 A;  3V8L A;  1N9S A;  1JJ2 A;  5DY9 A;  4XTX A;  1KG1 A;  2M16 A;  4KUI A;  5GMK m;  5GAN 7;  4D6W A;  5LJ5 f;  3G6E Q;  1K76 A;  5GMK h;  3JB9 D;  1PRM C;  4E7H A;  2E5K A;  3PT9 A;  5CK9 A;  2AZS A;  2BKD N;  4OMQ A;  2HQH A;  1H92 A;  1H8K A;  1O75 A;  4FW1 A;  2YSQ A;  4PJL A;  1V76 A;  1GFC A;  1OZ3 A;  4M7A D;  1MV0 B;  3OYA A;  3NPF A;  2C06 A;  2OTL A;  2MK5 A;  5LJ5 d;  3EAE A;  2KEA A;  1KQ2 A;  2QDY B;  3VS6 A;  4BE0 A;  2ZCF B;  1AVZ C;  4C8Q G;  1VYV A;  1LCK A;  2BZY A;  2K2M A;  4L6V 5;  5GAN 5;  5LJ5 e;  4MZP A;  1NBE B;  1M4Z A;  3R6O A;  2EGA A;  2KI7 A;  3OYB A;  1PD1 A;  2GNC A;  2DLP A;  4Z02 A;  3N5B B;  2A7Y A;  2YLC A;  2CRE A;  4J9D A;  1K1Z A;  3JB9 I;  2GFU A;  1AEY A;  1D0X A;  1RL2 A;  5KYY B;  4ELY C;  4II1 A;  2OTL T;  3CCM T;  3DLM A;  2FB7 A;  3CC4 A;  5DLQ E;  3GLX A;  4OB1 B;  1YBY A;  3RR6 A;  4C0Z A;  1E6G A;  2DVJ A;  2LCL A;  1TH7 A;  3RES A;  4C92 B;  2VXF A;  3HP9 A;  4J9H A;  3X20 B;  2R5A A;  2W0Z A;  5KYN A;  2V8I A;  3V8J A;  3OSS C;  2F1L A;  4PJJ A;  2O2O A;  3PFS A;  4BI3 A;  3A1P A;  2HL3 A;  1UGQ B;  3UF4 A;  5EG2 A;  4M7D D;  4AFZ C;  2E64 A;  4JRK A;  1VQ8 Q;  3PMT A;  5I11 A;  3HTR A;  1W70 A;  4B9W A;  1K8A U;  2VUB A;  4J6Y A;  4LDV A;  4PJO C;  1AZE A;  3SFM A;  1EZZ B;  4FYW B;  3OYC A;  4RMO A;  1VQP Q;  2M9U A;  1M1F A;  3M0U A;  4FSS A;  3KXT A;  3JB9 H;  2LMJ A;  2R58 A;  3PMI A;  2A37 A;  1NYG A;  1XOV A;  1K4U S;  1QMC A;  3CBP A;  3QWX X;  4A4G A;  1Q82 U;  4AFQ C;  1VQ4 A;  2KSS A;  4BI8 B;  3EH2 A;  4C8Q C;  2CSI A;  3OYG A;  2HQX A;  4LD6 A;  1JRI A;  2EJF A;  3A8M B;  2VB6 A;  1SG5 A;  2ZPI B;  1FWZ A;  1WX6 A;  2YDL A;  3OYN A;  3WXM B;  3CC7 A;  2DRM A;  2LC4 A;  4F14 A;  4KH0 B;  4PFZ A;  2KXC A;  1YWO A;  4RTV A;  4M78 C;  1Y71 A;  2RJC A;  4J9C A;  3TCJ A;  5A2Q E;  4N0A C;  3M59 A;  3C12 A;  1MGQ A;  5C6S A;  1BI0 A;  2ENM A;  2EYZ A;  2AKL A;  1W4S A;  3VUB A;  4ZN1 A;  1SHG A;  1G2B A;  2ED0 A;  1SKU B;  2WAC A;  3VS0 A;  2FZK B;  3QJY A;  3CCV T;  2NWM A;  5IXF A;  3MEA A;  1U5S A;  2DRK A;  3NHN A;  4OMN A;  2O4X A;  3TQ7 P;  2DL5 A;  2YUN A;  1KD1 U;  2RO0 A;  4OB2 B;  5AYF A;  3CC7 T;  1ZSG A;  4JZ4 A;  1VQO A;  4L59 A;  2FRW A;  1W6X A;  1Q86 U;  3OW2 P;  2OAU A;  1VQM Q;  4DEY A;  4MDX A;  2L3Q A;  4HVV A;  2RB6 A;  4RTT A;  1WFW A;  4FL6 A;  1X6O A;  3OMG A;  1GCP A;  2RJE A;  2M0O A;  5IHI A;  1X6B A;  4RTX A;  3AHU A;  3CCE T;  2I2L A;  2ECZ A;  2QQS A;  2X35 A;  5AT1 B;  1VQ6 A;  3EFO A;  1VYU A;  1S1N A;  1T0H A;  3T9N A;  2EJG A;  2YRD A;  2DMO A;  3BY7 A;  1OI1 A;  4AG2 C;  2AHJ B;  1MHN A;  3CPF A;  2ROL A;  2COY A;  5CVI A;  2DAQ A;  3O5Z A;  5GAN 2;  2I0N A;  1KD1 R;  2RI3 A;  3JCM e;  5FWC A;  2AKK A;  1PKS A;  4KRT A;  3RMQ A;  1RAF B;  3RKW A;  3CCS A;  3JCM J;  2YUQ A;  2M51 A;  4KUL A;  1FMW A;  4IUT A;  1QVP A;  2ZPG B;  4IKF A;  2EYW A;  2X4W A;  1UGV A;  2JUF A;  2D8J A;  2KXD A;  2EQJ A;  3CQT A;  2GTO A;  1WI7 A;  3VRZ A;  2RN8 A;  1X2K A;  3FEO A;  2YLB A;  1D1C A;  2NUZ A;  3M56 A;  2KYM A;  1M90 U;  4QQ6 A;  4A4F A;  5GAO n;  3BDL A;  1PD0 A;  2FHD A;  2KDS A;  4HKE A;  5GAN j;  2DZ9 A;  1FMK A;  2EQI A;  3REB B;  5LJ5 g;  3HFO A;  2EGC A;  3NTK A;  4F04 B;  2QGG A;  4M77 E;  5FW9 A;  4DOV A;  1RAB B;  4F17 A;  2HL5 C;  2QEX T;  2O4X B;  3NMZ C;  1M8M A;  2RQR A;  5FWB A;  1KC8 U;  3QYH B;  4MZT A;  5IAY A;  2BE9 B;  1Y07 A;  1WJS A;  3M9Q A;  4JRI A;  3CCR A;  4XQ3 A;  3JRZ A;  4XTY A;  1Q81 U;  3I9Q A;  4M4Z A;  4FSX A;  1AWO A;  4C5E A;  2RQV A;  5FU7 C;  5KCH A;  4LDX A;  2W10 A;  3OY9 A;  2QAZ A;  2DVE A;  1VQN Q;  4OMP A;  2DXT A;  1ZSZ A;  3EFO B;  4KBM B;  1QLY A;  1BYM A;  1UB4 A;  2ED1 A;  4M7A G;  5GAN f;  2DYB A;  4OB0 B;  2X4X A;  1TOV A;  4M75 C;  4EMH A;  4JUV A;  2QQB A;  1XJW B;  3SWN C;  2GBQ A;  4QKU A;  2CKK A;  3O8V A;  2CP5 A;  4FM4 B;  1D09 B;  1IO6 A;  3GPL A;  5KYW B;  3CCR T;  1PSE A;  3VS5 A;  3OW2 A;  3RBB B;  1KIK A;  2J05 A;  3FDR A;  4PJO D;  1Y0M A;  1C6V X;  2X51 A;  2JS2 A;  1BBZ A;  1T3S A;  2P0P A;  3OYD A;  3OYY A;  2RJF A;  5GAN d;  1VQK Q;  2HSP A;  2LQW A;  3VKI A;  3TSZ A;  3SDZ A;  3MP8 A;  5FRN A;  4FYY B;  1QWE A;  4F16 A;  1VQL A;  3J7A F;  5GAN e;  1Q7Y C;  3EGD A;  3HL8 A;  3U23 A;  3VJP A;  1JU5 C;  3JCM W;  1ZQ1 A;  2CP3 A;  3VRY A;  2DNU A;  4EDU A;  2LP5 A;  4O6J A;  2LT4 A;  1QCO A;  1CKA A;  2HNI A;  4CC2 A;  3UA6 A;  1WLP B;  3M57 A;  4IUV A;  4PLL A;  4A4K A;  4M7A E;  2PVG B;  4M77 A;  4HA8 A;  1IB8 A;  2JNG A;  2QGF B;  5I21 A;  4LDW A;  1RAE B;  2QA4 A;  1SHF A;  3CME Q;  3CMA A;  4PK4 A;  4KGX B;  5KYU A;  1VQP A;  2A36 A;  2EKH A;  3SWN A;  3AT1 B;  3M0Q A;  3FJP A;  1VQL T;  1K0X A;  1YIT Q;  4BY6 C;  4RTU A;  2GGR A;  4C92 G;  2CYZ B;  1GXI E;  3MKD A;  3CCL A;  4EMK B;  2P0K A;  1ZSZ B;  3M54 A;  2JVV A;  1PCX A;  1BK2 A;  3M4G A;  3L2R A;  1PC0 A;  2DXB A;  1UTI A;  2DTH A;  2QA4 T;  1YCS B;  2EVR A;  3G4S Q;  1WIE A;  3E1S A;  1YJN A;  4R55 A;  2ABL A;  1VQP T;  3OS0 A;  3TU4 K;  3OS2 A;  1QQJ A;  3THK A;  3L2W A;  1ZBJ A;  1NJI R;  3CCQ Q;  4M7D E;  1NM7 A;  3L42 A;  2XDD A;  1MUZ A;  1KFZ A;  4OGC A;  4J8O A;  1D1B A;  2L3P A;  3CBM A;  2D6F A;  1NJI C;  2H3J A;  1VQ5 Q;  2PVD B;  1GCQ C;  2VC8 A;  5CKE A;  3EGD B;  1K73 U;  1G5V A;  4C92 E;  2KE9 A;  3NFC A;  5CO7 A;  4C0G A;  4M77 B;  4JJN K;  4M7A A;  1PNJ A;  2E1H A;  4OML A;  3JCM b;  3L2V A;  2KRS A;  2ZGW A;  2FPF A;  5ECA A;  1OQK A;  2D8H A;  5KYU B;  1QVG S;  4F7U F;  2ESW A;  1WDX A;  4OMO A;  2DXU A;  2Y4X A;  2DL4 A;  3OYK A;  3RER A;  1B34 B;  2COW A;  1BI3 A;  1QKX A;  4GBQ A;  4AFS C;  3CCU Q;  1VIE A;  2DYI A;  1VQM T;  3FJ5 A;  4Y28 E;  5LJ5 h;  2YUP A;  1K73 R;  4XTV A;  4X9C A;  3WVD B;  1T3L A;  2DIG A;  3RIR A;  1PM3 A;  2XHC A;  3G71 Q;  3H9N A;  2RQT A;  4J7I A;  2HBP A;  4IUU A;  3EGU A;  1EX4 A;  1YJ9 Q;  4E7K A;  2H8H A;  2KK4 A;  1YFN A;  1X6G A;  1QVG A;  1QW1 A;  2YWW A;  5GMK i;  4XU3 A;  3EG3 A;  2EQU A;  5CKD A;  1OX9 A;  4M7D A;  1IZ6 A;  4LE9 A;  3CC2 A;  2JW4 A;  1IRE B;  4O5V A;  4M75 D;  4GLK A;  1KQS S;  1WGS A;  3BFM A;  4CRI A;  2KRM A;  2E5Q A;  3UDC A;  3FB9 A;  3GF5 A;  2QTX A;  4ZN3 A;  3EG0 A;  2OJ2 A;  4KH1 B;  4PJN A;  5GAN 6;  4C92 A;  2FO0 A;  4M7A B;  1BU1 A;  1HYO A;  3SD4 A;  4MMK A;  1YIJ A;  1WXU A;  2DER A;  1RLP C;  3OYH A;  5GAN g;  1I1J A;  4OVA A;  2D1X A;  3CC2 T;  1X27 A;  4XU2 A;  1RLQ C;  4E7L A;  1HJD A;  2VV5 A;  1BCM A;  1G3S A;  2NUP B;  1KQS A;  2KT1 A;  2MYS A;  1N27 A;  2IG0 A;  3OYI A;  4PJO F;  3VYG A;  1ZUU A;  1UGP B;  2DTI A;  8AT1 B;  1VQ7 A;  3CCM A;  4IIM A;  1VQ9 Q;  4RUG A;  1YIJ T;  1HD3 A;  2JTM A;  3ER0 A;  1KK7 A;  4C8Q F;  4WTO B;  4OB3 B;  1VQN T;  1ZUY A;  2NYS A;  2E65 A;  4E6R A;  3LX7 A;  3A8L B;  3UAT A;  4A54 A;  1YJW Q;  4R0K A;  4M7D B;  1QCN A;  3EG9 A;  3GOX A;  4M78 F;  1AWX A;  1VQ7 T;  2MPX C;  1IHW A;  2KRO A;  4NL2 A;  2EQK A;  1QWF A;  2L5Q A;  1C0M A;  1U3O A;  1NEG A;  3OYJ A;  1I81 A;  4ZGJ B;  4FW2 A;  2KQW A;  2E4H A;  2HBW A;  5I22 A;  1XQH A;  3PIO A;  4AT1 B;  4A53 A;  1IRX A;  2DET A;  4BE1 A;  3RUX A;  3LYI A;  3JCM X;  4DBR A;  3NTI A;  2E12 A;  1QKW A;  3QG1 A;  1JBM A;  1YI2 Q;  2ZPE B;  2COZ A;  3JCM h;  4JJC A;  5A0L A;  1QVF P;  1M3B A;  4PKC C;  1Z9Q A;  2F69 A;  1K9M R;  3CME T;  4N4I A;  1V29 B;  2M02 A;  1I07 A;  2O88 A;  2F2V A;  2BE7 D;  1RAC B;  2EPD A;  1OUL A;  3CCV A;  2F2W A;  1K9M C;  2PUO B;  4AFU C;  1G8X A;  1YIT T;  4LDY A;  1AOJ A;  2CZ1 B;  2MAM A;  2LNH B;  2WSC E;  2KGT A;  3I56 A;  3S3M A;  3EHR A;  1ZA1 B;  1UE9 A;  4Z88 A;  4RG8 A;  3ZL7 C;  1X69 A;  1IHV A;  4RCB A;  4CC7 A;  3VS2 A;  2C0O A;  5GJV B;  1TU0 B;  5IH2 A;  3EG9 B;  1IGQ A;  3G4S T;  4MML A;  3CCE A;  1ZUK A;  1UHC A;  3MHX A;  5LL6 S;  2CDT A;  2OAW A;  3CCQ T;  2DIL A;  2Y90 A;  3GBQ A;  3JCM c;  4Z89 A;  1RAA B;  2DM1 A;  3MP6 A;  3I56 T;  3OA6 A;  2QXF A;  3M4Y A;  3M0S A;  1VUB A;  5D6Y A;  3JCM f;  3LWH A;  2IVW A;  1M2V A;  1ACM B;  2BZ8 A;  4OMF B;  4L5G A;  4BUG A;  2DJQ A;  1RAH B;  5EC7 A;  1BCO A;  3FRN A;  3CCU A;  2L3R A;  1FX7 A;  2A3L A;  2H3E B;  1PSF A;  2O01 E;  3ME9 A;  3MP1 A;  3S3O A;  2CZ0 B;  2EKO A;  3CD6 Q;  2XD0 A;  4RG2 A;  1M1K R;  2LQN A;  3TRE A;  2E41 A;  1RAG B;  5FRO A;  5I2M A;  4M77 G;  3J81 E;  3FC3 A;  3JCM d;  2RHI A;  2OX7 A;  1WXB A;  1YJ9 A;  1LOJ A;  1M1K C;  2LNV A;  2O9S A;  3E2U A;  1WHH A;  3BE3 A;  4HVW A;  5IHN A;  4M75 F;  1GBQ A;  5KYW A;  3QDR B;  2RI2 A;  4D8D A;  4DBQ A;  2CP6 A;  2QEX A;  3CCU T;  2GQV A;  3TEE A;  4EMK C;  5GAN h;  1V1C A;  2KY9 A;  1ZSZ C;  1UHF A;  1K9A A;  4QVZ A;  2K3B A;  1UGS B;  2K2V A;  2PVO B;  4JLI A;  1ZA2 B;  4XAX B;  1H3H A;  3MPU B;  3VUZ A;  4RTZ A;  4FYX B;  3REA B;  2XG8 D;  2HQE A;  1M2O A;  2BUD A;  1YJ9 T;  4C5I A;  3QUI A;  3CCJ Q;  4LUD A;  2XDB A;  2EAY A;  2QG9 B;  1YHQ Q;  1IXD A;  2FPE A;  2MI6 A;  3G6E A;  1ZHI A;  5L23 A;  2DBK A;  2J6K A;  3LLR A;  3I35 A;  3OYL A;  2DL3 A;  1M2V B;  3OW2 S;  2MWO A;  1NYF A;  5CKB A;  1M30 A;  5GJW B;  2KNB B;  3JB9 G;  1Q7Y U;  1YWP A;  2F5T X;  2RJD A;  1WJR A;  1Y96 A;  3QZ5 B;  1I0C A;  2JOY A;  4OP0 A;  4M77 C;  2DZC A;  3OQ5 A;  1UDL A;  1SF9 A;  1S72 Q;  2J06 A;  3VV0 A;  4EMK A;  2JZ2 A;  1LVK A;  1PHT A;  2DJZ A;  2M1H A;  1AWW A;  3IQL A;  1M1G A;  4OGE A;  1X01 A;  2MOX A;  4DEX A;  2FG0 A;  3G6E T;  2E6N A;  1LPL A;  3I5S A;  2XIC A;  3GNF B;  3M53 A;  3FIF A;  4DBF A;  3HRS A;  1DJ7 B;  3CEY A;  2ZAE A;  2GTJ A;  1XNI A;  1OU8 A;  1RI9 A;  2LJ3 A;  1OX8 A;  3C94 A;  3PVQ A;  3SEM A;  2C0I A;  2DO3 A;  2XK0 A;  2XMF A;  3QDF A;  5IT9 E;  1WHJ A;  3QII A;  1Q7Y R;  1NLO C;  3M58 A;  2KT8 A;  2MMP A;  2V26 A;  2K3Y A;  4JJB A;  5GAM j;  1MV3 A;  2RA2 A;  2LQ8 A;  3EHQ A;  8ATC B;  4C8Q D;  1W2B P;  2OTL Q;  4J9F A;  1NG2 A;  2QYZ A;  1C1A A;  4ELZ C;  4J83 A;  3DKM A;  2FRY A;  2FYK A;  2L8D A;  1WHK A;  2R5M A;  3DLL A;  4XTU A;  2VYT A;  2RM4 A;  2JTE A;  1MMD A;  1UJ0 A;  1VQ8 A;  3FLG A;  2CS7 A;  3M0T A;  5CIU A;  3M55 A;  1F1B B;  5IN1 A;  4M78 D;  2K6D A;  1JEG A;  2DEQ A;  2DTO A;  4C5H A;  1OPL A;  2DL8 A;  3JB9 J;  4M7D G;  5CR2 A;  1LNX A;  4CC4 B;  5GAO r;  4N4G A;  1NJI U;  2DX1 A;  2J6O A;  4JS5 A;  4CC3 A;  1QP2 A;  9ATC B;  1Y96 B;  4KGV B;  3CPW P;  1B34 A;  2HD0 A;  2YXY A;  2PU9 B;  2DEU A;  1WA7 A;  1OZ2 A;  5GAM f;  3CC4 Q;  4M7A C;  2LX9 A;  2K5I A;  2KRN A;  4VUB A;  5HY6 A;  1WYX A;  1RUW A;  2PQW A;  3H0F A;  4ME7 A;  2ZPB B;  4QQG A;  1VQ8 T;  3J80 E;  3NGP A;  1YNZ A;  3OYF A;  3CXC P;  1GRI A;  2EWN A;  5GAN 8;  2A08 A;  1NPR A;  2QTV A;  1YI2 T;  2O31 A;  5GAM d;  2EYQ A;  1U06 A;  2DIQ A;  2WSE E;  2F5K A;  4PJM A;  3QHS A;  5LJ3 j;  2EYX A;  3JSC A;  4HXJ A;  5D7U A;  5GAM e;  4KT0 E;  2EYY A;  1JJ2 P;  5CQY A;  5CKH A;  4J5Y A;  3JCM g;  1VQ4 Q;  2XDP A;  1JB0 E;  2D9T A;  3A8H B;  4YTL A;  1VQM A;  1X75 C;  1TXQ A;  3H6Z A;  3MEW A;  5DLO A;  4M7D C;  4AG1 C;  1MMN A;  3ULR B;  5KCO A;  4RKU E;  4J6W A;  1LJO A;  3MET A;  3H8Z A;  2QQR A;  4JJD A;  2V1Q A;  3TVT A;  1WQW A;  3OS5 A;  2G3R A;  3ASK A;  1TUC A;  1FYN A;  2VAS A;  3UT1 A;  1RI0 A;  2CP2 A;  1KQ1 A;  1Q95 G;  3C4S A;  4IUP A;  2X4Y A;  4X1V A;  5LJ3 f;  4C92 C;  1OPK A;  4XTZ A;  3URG A;  2NUP A;  1U1S A;  2LT1 A;  4XU0 A;  2E6Z A;  2ZPH B;  2F2X A;  4HCB A;  4BDZ A;  4F7U G;  4M75 B;  3MEV A;  4BI4 A;  4C0D B;  3HPW A;  1VQO Q;  4EPC A;  2CSQ A;  4C5G A;  5FU6 B;  2JT4 A;  3H0H A;  3CD6 T;  3OSV A;  1TUG B;  5LJ3 d;  3HFN A;  4BDY A;  5GAO l;  1E6H A;  3I55 Q;  3VS4 A;  2RMO A;  1IGU A;  4FCY A;  3TSW A;  5LJ3 e;  3SHW A;  1VQ6 Q;  4A4H A;  2RHY A;  2E3H A;  2HKN A;  2JM9 A;  1UEB A;  4PLI A;  3CPW A;  2EIF A;  2RNA A;  2JN0 A;  2DL7 A;  1NZ9 A;  1N5Z A;  2PZ1 A;  2J7I A;  4FT2 A;  3M0R A;  1B3Q A;  1X43 A;  2E70 A;  2OTJ Q;  3V7S A;  3JAM E;  2MF2 A;  2EJ9 A;  2YT6 A;  5HK0 A;  2K5L A;  4CI0 C;  3CCS Q;  4V2S A;  3CXC A;  1ABO A;  1M3C A;  3BW1 A;  4F7U E;  3A5Z B;  3A8O B;  4Y92 A;  2SRC A;  4JZ3 A;  4KGZ B;  5L8R E;  1BKB A;  1OOT A;  2RK2 A;  5DM7 R;  1JQQ A;  5HK3 A;  5GMK l;  1VQN A;  3M0P A;  3KUF A;  2NLU A;  2FEI A;  3HRU A;  2MWP A;  1E7O A;  3L2Z A;  1YHQ T;  4BY6 B;  4RTW A;  2D0N A;  4P5N A;  4JRQ A;  4NL3 A;  1TG0 A;  4LNP A;  2DPP B;  3GP8 A;  2CP0 A;  3MO8 A;  4ZGD B;  1I4K 1;  2DXC A;  3CCR Q;  2WSF E;  4BAC A;  3V7R A;  3QO3 A;  2X4J A;  2K7A A;  3ZEH A;  2DF6 A;  4A63 B;  1S72 T;  1VQK A;  4PJO G;  1UFF A;  3I5R A;  1ZBX A;  5GMK j;  4HT9 A;  1N6A A;  3EGX A;  3JCM Q;  4Q5W A;  2LCC A;  2E3I A;  5A0G A;  2VVK A;  2Z0W A;  3F70 A;  2VWF A;  1K9M U;  3X24 B;  2RH2 A;  2OI3 A;  1I5L A;  1Z9Z A;  4PFP A;  2RHZ A;  3G7Z A;  4IUR A;  1QP3 A;  3QPH A;  3RMS A;  2K5F A;  4BD3 A;  4DQ2 A;  3CME A;  3H41 A;  1PG5 B;  4BE2 A;  2P0Q A;  5GAO p;  2DA9 A;  1VQK T;  2HEQ A;  3RDV A;  2JM8 A;  4J9E A;  4M78 G;  5GAM g;  2EQM A;  2NUT B;  2QDL A;  4J7F A;  4F7U A;  4QT7 A;  1O9S A;  2X9H A;  1YIT A;  3P8H A;  4LDU A;  3V7C A;  4C0F A;  3VS7 A;  2HSE B;  4PJO E;  5KYX B;  2AK5 A;  3QSU A;  1VQL Q;  3PVL A;  4B9X A;  2KBT A;  3MCA B;  3GNG A;  2CZ7 B;  3E9F A;  3C0C A;  1TWB A;  4QQD A;  2MCN A;  4ESR A;  4C8Q E;  1TTH B;  3G4S A;  2RI5 A;  1D1A A;  2VGM A;  2GF7 A;  2JXB A;  3PIP A;  2AIR B;  4PFO A;  2Y4Y A;  1G3T A;  2QA4 Q;  2LZ6 B;  3CMA Q;  3EG1 A;  3CCQ A;  4RCC A;  1WHG A;  1QCF A;  3CC4 T;  2LJ1 A;  3RKX A;  2KYB A;  4C92 D;  1N8R U;  5GAN 3;  2LCS A;  4M78 E;  4J6X A;  5GMK e;  2YUO A;  4XK8 E;  1VQ5 A;  1WZO A;  3EGX B;  5CAI A;  3CCL Q;  2K3X A;  3VU3 C;  1M1K U;  3HHT B;  3E9G A;  1N9R A;  2CT4 A;  2E10 A;  2JJ9 A;  1ZLM A;  2EW3 A;  1D0Y A;  1AZG B;  1K0S A;  3A8G B;  1KHI A;  5KH6 A;  2GCX A;  3ZFJ A;  1BB9 A;  1SRM A;  1BI2 A;  4ANJ A;  2DBM A;  3L2Q A;  1K8A R;  3KFV A;  1AWJ A;  4Y91 A;  2ATC B;  1YJN Q;  5HCK A;  2EBP A;  4NOY A;  2LDM A;  5LJ3 g;  2JMC A;  1U1T A;  5GAO q;  2XKO C;  4DA4 A;  1YN8 A;  3JCM P;  2CH4 A;  2M0Y A;  3QZ9 B;  4F7U B;  5GAN 4;  1N8R R;  3LGL A;  1VQ4 T;  1VQ5 T;  4XU1 A;  1K8A C;  5D6X A;  1AD5 A;  1WQ7 A;  1D0Z A;  1NPP A;  1M9S A;  1Q82 R;  1MMG A;  2KMT A;  5KE3 A;  4PJO A;  1YP5 A;  1CSK A;  1AT1 B;  3PTA A;  1N8R C;  1MMA A;  2AT1 B;  3OBW A;  4HCK A;  1QVF S;  2RHX A;  1RAI B;  4M77 F;  1KSW A;  1VIF A;  1UGR B;  4HVU A;  4N4H A;  3PE0 A;  3LGF A;  4DBH A;  4E7I A;  4BB7 A;  4JPB W;  5HKC A;  3G71 A;  1Q82 C;  5CCA A;  2PUK B;  1JO8 A;  3SB2 A;  2XI9 A;  4C8Q A;  3QYG B;  2FVU A;  2EFI A;  3I55 A;  2IPO B;  1G3W A;  3JCM V;  4E2F B;  4JS4 A;  3R6N A;  2FZG B;  2CH4 W;  3OBY A;  3LH0 A;  4ORZ A;  1NEB A;  2X3X D;  3HSB A;  4XTW A;  4M78 A;  1OV3 A;  2YHT A;  4QVD A;  1VQO T;  4N0A A;  3QWY A;  2OTJ A;  3E19 A;  2DD5 A;  3OMC A;  1OYX A;  3G1J A;  1WNL A;  4M75 G;  1GBR A;  1T0J A;  4LN2 A;  3G71 T;  3S3N A;  1Q86 R;  3L1A A;  1QVF A;  1OU9 A;  2GFA A;  5FLX E;  3VS3 A;  3I55 T;  2RQU A;  1KD1 C;  1TS9 A;  2JTF A;  1NLP C;  2PNI A;  2D0Q B;  1VQ6 T;  2LJ0 A;  1Q86 C;  4KUD K;  1PKT A;  3UPU A;  2LQK A;  1HK9 A;  3DB4 A;  3CC2 Q;  4ATO A;  2OTJ T;  4DOW A;  3EFS A;  1UJY A;  3JB9 F;  1CKB A;  4FU6 A;  2DK3 A;  5J26 A;  1KJW A;  2LRQ A;  3PNW C;  4PJO B;  3LWI A;  2KVQ G;  3CCS T;  1M27 C;  2LX7 A;  1VQ9 A;  1H3Z A;  2VXE A;  1R0C B;  2CGH A;  2HMA A;  2JMA A;  4M75 E;  4E7Z A;  4M7A F;  2P4T A;  4EMG A;  2DE0 X;  2HKQ B;  4J9B A;  4JLG A;  2K57 A;  4C8Q B;  3OYE A;  1YIJ Q;  2FPD A;  4A4E A;  1D3B A;  5GAM h;  4ZNX A;  5CKF A;  4JRP A;  4WF2 A;  4HT8 A;  2PTK A;  4IIO A;  2QI2 A;  1M90 R;  5J3B A;  1YJW A;  4JDS A;  2HZY A;  1M5Q 1;  2ROT A;  3P8D A;  2HCK A;  5I2S A;  1JXO A;  1KHC A;  3M5A A;  4UC4 A;  4E7J A;  4M78 B;  4C0D C;  4TVR A;  2B86 A;  1VQ9 T;  1UEC A;  5FU6 C;  4E47 A;  1M90 C;  5IXB A;  1ZX6 A;  4FIB A;  3CBO A;  3UA7 A;  1VQ7 Q;  4FT4 A;  2J6F A;  3CCM Q;  2K9G A;  4PNO A;  3UWN A;  1FMV A;  1KC8 R;  4LUE A;  4D8K A;  3GIB A;  1UG1 A;  3EFR A;  1Q81 R;  2CUB A;  1J3T A;  3HKS A;  1YJW T;  2CT3 A;  1KC8 C;  2A0F B;  1BI1 A;  1WXT A;  1A0N B;  1SSH A;  3QJ6 A;  4M7D F;  1SRL A;  1Q81 C;  3QKJ A;  1YI2 A;  4AMC A;  2LTO A;  2P84 A;  1BIA A;  3PGG A;  1Y7X A;  4MDW A;  4LD9 K;  2RD1 A;  4C92 F;  2RK1 A;  3OYM A;  1VA7 A;  2RPN A;  1QVG P;  2CP7 A;  4M75 A;  2JS0 A;  4J9I A;  5LJ3 h;  2L89 A;  1XTD A;  1D3B B;  2O9V A;  2CZ6 B;  2IIM A;  1PRL C;  1I8F A;  1I5O B;  2V8K A;  2EGE A;  3Q1J A;  4GLM A;  1EFN A;  2LVM A;  3EG2 A;  2RHU A;  2A28 A;  1ARK A;  1R77 A;  3VYH B;  3S6W A;  2KR3 A;  1B07 A;  2DKG A;  1X2Q A;  3CMA T;  3KBG A;  3QXE B;  2B8A A;  3MJX A;  3DB3 A;  2SEM A;  4X34 A;  1YCY A;  1FXX A;  2RQW A;  1W2B S;  3JV3 A;  2QK0 A;  3CCV Q;  1RAD B;  3D7S B;  5C0M A;  3RKY A;  3RNJ A;  3LH5 A;  1HXD A;  4QW2 A;  4OF1 A;  4X9D A;  3CCL T;  3NTH A;  3I56 Q;  4R56 A;  3CC7 Q;  3EH1 A;  2L0A A;  1KQS P;  1G3Y A;  3X28 B;  2ZPF B;  4LXC A;  2BIV A;  2ZZD A;  2V1R A;  3CD6 A;  2MIO A;  1M8V A;  2QQ9 A;  2BZX A;  4Z8A A;  2BTT A;  4J9G A;  1JXM A;  5CQX A;  1OEB A; 
#chains in the Genus database with same CATH homology
 1IO6 A;  2BZ8 A;  2DJQ A;  3H0I A;  5EC7 A;  2CUD A;  3VS5 A;  3RBB B;  1KIK A;  2J05 A;  3A98 A;  1Y0M A;  1PWT A;  2VVK A;  2K79 A;  2JS2 A;  1BBZ A;  1T3S A;  2VWF A;  2C0T A;  2LQN A;  1GL5 A;  2RF0 A;  2HSP A;  2LQW A;  2OI3 A;  3TSZ A;  1Z9Z A;  2HDA A;  5IHK A;  1Y57 A;  1QWE A;  2P4R A;  4F16 A;  3H41 A;  2L2P A;  2DA9 A;  3U23 A;  1WXB A;  2GQI A;  1JU5 C;  2HEQ A;  2JM8 A;  2O9S A;  3VRY A;  2DNU A;  4J9E A;  2LP5 A;  1M3A A;  2QDL A;  1CKA A;  4CC2 A;  4HVW A;  1WLP B;  5IHN A;  3UA6 A;  1GBQ A;  4QT7 A;  4D8D A;  1GFD A;  1G83 A;  2G6F X;  1V1C A;  3VS7 A;  1W1F A;  1UHF A;  1K9A A;  2L3S A;  4K11 A;  2AK5 A;  2K3B A;  1SHF A;  3PVL A;  1GCQ A;  2VKN A;  1H3H A;  3VS1 A;  2KBT A;  2A36 A;  2EKH A;  4RTZ A;  4EIK A;  3REA B;  1HSQ A;  1VYT A;  3C0C A;  1UUE A;  3M0Q A;  2MCN A;  4ESR A;  1TUD A;  1K0X A;  4WCI A;  4OMM A;  4RTU A;  2GGR A;  2AZV A;  2JXB A;  4LUD A;  2LZ6 B;  1ABQ A;  3EG1 A;  1BK2 A;  2X3W D;  1QCF A;  2FPE A;  2LJ1 A;  4RTY A;  5L23 A;  2KYB A;  2DBK A;  2J6K A;  2LCS A;  1UTI A;  3I35 A;  2YUO A;  1SPK A;  2DL3 A;  1YCS B;  2EVR A;  1SEM A;  1NYF A;  1WIE A;  1M30 A;  5GJW B;  2KNB B;  2ABL A;  1YWP A;  2CT4 A;  3THK A;  1ZBJ A;  1I0C A;  1ZLM A;  2EW3 A;  1AZG B;  1NM7 A;  1UDL A;  1K76 A;  1K0S A;  1MUZ A;  1KFZ A;  2J06 A;  1PRM C;  1PHT A;  1BB9 A;  1SRM A;  2L3P A;  1AWW A;  2E5K A;  3IQL A;  2DBM A;  2AZS A;  2MOX A;  4DEX A;  3KFV A;  4OMQ A;  1AWJ A;  2FG0 A;  1H92 A;  5HCK A;  2EBP A;  1GCQ C;  3I5S A;  1H8K A;  2JMC A;  1YN8 A;  2CH4 A;  2M0Y A;  2KE9 A;  2YSQ A;  1GFC A;  1MV0 B;  3NPF A;  2GTJ A;  1PNJ A;  1RI9 A;  2LJ3 A;  1AD5 A;  2KEA A;  4OML A;  3PVQ A;  3VS6 A;  3SEM A;  2C0I A;  2KRS A;  2XMF A;  1AVZ C;  1YP5 A;  1VYV A;  2FPF A;  1CSK A;  1LCK A;  1NLO C;  2BZY A;  5ECA A;  2D8H A;  2K2M A;  2ESW A;  2KT8 A;  4JJB A;  1WDX A;  1MV3 A;  4OMO A;  2EGA A;  4HCK A;  1KSW A;  2DL4 A;  3EHQ A;  2GNC A;  4HVU A;  3PE0 A;  2DLP A;  4JPB W;  1QKX A;  2CRE A;  1JO8 A;  4J9D A;  4J9F A;  1K1Z A;  4GBQ A;  1NG2 A;  4AFS C;  1AEY A;  2FRY A;  3FJ5 A;  2YUP A;  2JTE A;  1UJ0 A;  3M0T A;  3R6N A;  1T3L A;  2CH4 W;  2K6D A;  1E6G A;  4ORZ A;  1JEG A;  1NEB A;  2DVJ A;  1OPL A;  2DL8 A;  2X3X D;  2RQT A;  4J9H A;  1OV3 A;  3EGU A;  4CC4 B;  2W0Z A;  2DX1 A;  3QWY A;  2H8H A;  2O2O A;  2J6O A;  4CC3 A;  1GBR A;  1T0J A;  1X6G A;  4LN2 A;  3UF4 A;  4AFZ C;  3EG3 A;  1WA7 A;  5I11 A;  4LE9 A;  1W70 A;  3VS3 A;  2JW4 A;  2RQU A;  2KRN A;  1WYX A;  1RUW A;  3H0F A;  2KRM A;  1NLP C;  2PNI A;  1AZE A;  3NGP A;  2LJ0 A;  1YNZ A;  3M0U A;  4FSS A;  3EG0 A;  2OJ2 A;  1GRI A;  1PKT A;  2LMJ A;  2A37 A;  2A08 A;  1NYG A;  1XOV A;  1K4U S;  3QWX X;  4AFQ C;  2FO0 A;  2O31 A;  1BU1 A;  1UJY A;  2CSI A;  1U06 A;  1CKB A;  1KJW A;  1WXU A;  1RLP C;  1WX6 A;  2YDL A;  1I1J A;  2D1X A;  1M27 C;  1X27 A;  2EYX A;  4HXJ A;  2DRM A;  2EYY A;  2LX7 A;  4F14 A;  2KXC A;  1RLQ C;  1HJD A;  2JMA A;  1YWO A;  4RTV A;  4J9C A;  2DE0 X;  4J9B A;  2KT1 A;  2FPD A;  2ENM A;  2EYZ A;  2AKL A;  4ZNX A;  1ZUU A;  1SHG A;  1G2B A;  2ED0 A;  2PTK A;  4IIO A;  4IIM A;  4AG1 C;  3ULR B;  3VS0 A;  4RUG A;  1HD3 A;  2ROT A;  2HCK A;  2NWM A;  5IXF A;  1U5S A;  1JXO A;  2DRK A;  3NHN A;  4OMN A;  2DL5 A;  2YUN A;  4JJD A;  2V1Q A;  3TVT A;  1ZSG A;  4JZ4 A;  1ZUY A;  2B86 A;  2FRW A;  1UEC A;  1TUC A;  1W6X A;  1FYN A;  4DEY A;  5IXB A;  1ZX6 A;  2L3Q A;  4HVV A;  4X1V A;  4E6R A;  3UA7 A;  4RTT A;  1WFW A;  1OPK A;  2J6F A;  3UAT A;  2K9G A;  4LUE A;  4D8K A;  4R0K A;  1GCP A;  5IHI A;  2F2X A;  1X6B A;  4RTX A;  1UG1 A;  1AWX A;  2CUB A;  2ECZ A;  1J3T A;  2KRO A;  1QWF A;  2CSQ A;  1VYU A;  1S1N A;  1T0H A;  2CT3 A;  2DMO A;  2JT4 A;  1U3O A;  1NEG A;  3H0H A;  1WXT A;  4AG2 C;  1A0N B;  1SSH A;  1SRL A;  2ROL A;  2HBW A;  3O5Z A;  5I22 A;  1E6H A;  3VS4 A;  2I0N A;  2RMO A;  5FWC A;  2AKK A;  1PKS A;  3TSW A;  4KRT A;  3SHW A;  2YUQ A;  2M51 A;  2JM9 A;  1VA7 A;  2EYW A;  1UGV A;  2D8J A;  2KXD A;  2RNA A;  2RPN A;  3CQT A;  1QKW A;  2GTO A;  2DL7 A;  1N5Z A;  1WI7 A;  2PZ1 A;  2JS0 A;  4JJC A;  3VRZ A;  2J7I A;  2RN8 A;  3M0R A;  4J9I A;  1X2K A;  1B3Q A;  1X43 A;  1M3B A;  1Z9Q A;  2NUZ A;  2KYM A;  2O9V A;  2YT6 A;  2IIM A;  1I07 A;  2O88 A;  1ABO A;  1FMK A;  2F2V A;  1M3C A;  1PRL C;  2EQI A;  3REB B;  2EGC A;  2EPD A;  2EGE A;  4GLM A;  4Y92 A;  5FW9 A;  2SRC A;  1EFN A;  4JZ3 A;  3EG2 A;  4F17 A;  2F2W A;  4AFU C;  1OOT A;  2A28 A;  1AOJ A;  1ARK A;  2LNH B;  2KGT A;  3NMZ C;  1JQQ A;  1M8M A;  2KR3 A;  3EHR A;  3M0P A;  1B07 A;  2RQR A;  1X2Q A;  5FWB A;  1UE9 A;  2FEI A;  4Z88 A;  1E7O A;  3ZL7 C;  2SEM A;  1X69 A;  2RQW A;  4CC7 A;  3VS2 A;  3I9Q A;  2C0O A;  4RTW A;  3JV3 A;  5GJV B;  4M4Z A;  5IH2 A;  1AWO A;  2D0N A;  2RQV A;  3RNJ A;  1ZUK A;  1TG0 A;  1UHC A;  3LH5 A;  4LNP A;  2W10 A;  4OMP A;  2L0A A;  2CDT A;  2OAW A;  1QLY A;  2ED1 A;  2DIL A;  3GBQ A;  4Z89 A;  2V1R A;  2MIO A;  2DYB A;  2DM1 A;  2BZX A;  4Z8A A;  2BTT A;  2K7A A;  4J9G A;  1JXM A;  2DF6 A;  4A63 B;  1OEB A;  3M0S A;  2GBQ A;  1UFF A;  3I5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...