2KGTA

Solution structure of sh3 domain of ptk6
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
72
structure length
72
Chain Sequence
MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAERET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of SH3 domain of PTK6
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase 6
total genus 3
structure length 72
sequence length 72
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kgtA00
2W0ZA 2GBQA 1U06A 4AFSC 2DVJA 2EVRA 2JW4A 4J9FA 3M0TA 1WXUA 1ARKA 2CUDA 2GQIA 2KNBB 2HCKA 1BU1A 4J9DA 2JMCA 3PE0A 1IO6A 5I11A 1NEGA 5GJVB 1WXBA 1M3BA 1GCQC 2AK5A 1BBZA 1HD3A 1RI9A 2DL8A 4J9BA 4JZ4A 1WFWA 2KROA 2E5KA 1X69A 2M51A 1OV3A 2V1RA 4HVVA 3TSWA 3KFVA 1FMKA 1WYXA 1SRMA 1AWJA 5IXBA 2AKKA 2DF6A 2I0NA 1X2QA 1RLPC 2KBTA 2MOXA 3RNJA 2GTOA 1M3AA 2EKHA 2PTKA 2SRCA 5IHIA 2ED1A 1UHCA 4J9GA 1GL5A 2D8HA 4A63B 2EGAA 3NHNA 3U23A 3I35A 4CC4B 2J6FA 2X3XD 1PWTA 4HVWA 2RQWA 1GFCA 2AZVA 4GLMA 1PKTA 1NYGA 1SRLA 3H0HA 2CSQA 1TUDA 2DE0X 2JTEA 1BK2A 1WI7A 2YSQA 4R0KA 2RQRA 1E7OA 1JO8A 1WIEA 2DYBA 2CT3A 1UTIA 4WCIA 1WA7A 2EYXA 1HSQA 2L3SA 3CQTA 2B86A 1K4US 2EGEA 1B3QA 2AKLA 1AZGB 1GCQA 1YP5A 2L3QA 4RTWA 1PKSA 2DMOA 2MCNA 4AFZC 2RQUA 3QWYA 3VS6A 1ZLMA 1Z9QA 1K9AA 2CREA 2KRSA 4J9IA 1OPKA 4JJCA 1UFFA 2LNHB 1LCKA 3SEMA 2YDLA 2ECZA 2NUZA 2CDTA 1WDXA 1H3HA 1NYFA 4LUDA 4F16A 2JMAA 1SEMA 4OMMA 3H0FA 3QWXX 2HSPA 2L3PA 2A37A 1E6GA 2AZSA 1M3CA 1KJWA 2D8JA 4HVUA 1GFDA 4ORZA 3EGUA 2KXCA 4ESRA 2A08A 2KYBA 2V1QA 2L2PA 4Z89A 1PRLC 2KR3A 4J9EA 2J06A 2KGTA 1MV3A 1W70A 3GBQA 1U3OA 2EW3A 1UJ0A 2J7IA 2O2OA 1KIKA 5ECAA 4Z8AA 1ZBJA 2BZYA 1VYVA 2CT4A 1I0CA 1A0NB 1QWEA 3VRZA 2ED0A 1VA7A 2KT8A 2M0YA 1B07A 2FRYA 2KRMA 3UA7A 2CH4A 4RUGA 3C0CA 1OEBA 2JS2A 1KSWA 2RQVA 2YUPA 1M30A 1PHTA 1SHGA 2P4RA 1ZSGA 2OJ2A 4OMLA 2L0AA 1AEYA 1W1FA 2G6FX 2DNUA 1NLOC 3PVLA 2A36A 2RPNA 3PVQA 1Y0MA 1KFZA 2SEMA 2ABLA 3VS3A 3A98A 2K2MA 2LMJA 1AD5A 2OI3A 1T3LA 3TVTA 3H41A 1G2BA 3IQLA 2DL4A 2HBWA 2KEAA 1K76A 5IHNA 1NEBA 4OMOA 2A28A 1JQQA 2LJ0A 1T3SA 3EG1A 5I22A 1QKXA 3REAB 2F2WA 4J9HA 5IXFA 1I07A 4JPBW 2CH4W 3EG3A 1UE9A 1CSKA 2EPDA 4J9CA 5EC7A 1OPLA 4M4ZA 3FJ5A 5FWBA 1Y57A 1UUEA 2RF0A 1AZEA 2ESWA 4Y92A 3H0IA 2XMFA 1E6HA 2O9SA 2HDAA 2DRMA 3NGPA 2OAWA 1TUCA 4AFUC 1UDLA 3M0SA 4CC7A 2C0IA 2BZ8A 2VWFA 2FPEA 1PRMC 2VVKA 1J3TA 2K7AA 1OOTA 4ZNXA 2K9GA 2PZ1A 3SHWA 2LJ1A 4AFQC 2O31A 2GNCA 3I9QA 4FSSA 4EIKA 2RNAA 2LCSA 1K1ZA 2IIMA 1ABQA 2LQNA 2RQTA 2X3WD 4IIOA 1U5SA 1UHFA 1BB9A 3R6NA 2KXDA 3JV3A 4JJDA 2H8HA 1AVZC 1ZX6A 4RTVA 1SSHA 2O88A 2J6KA 1VYUA 2F2XA 4JJBA 1JXOA 2DLPA 4Z88A 3THKA 4D8DA 2KE9A 1EFNA 1ZUKA 2DA9A 1SHFA 5GJWB 2KRNA 4JZ3A 1H92A 1AWXA 2BTTA 2DX1A 2JM9A 3VRYA 1X2KA 4HXJA 2LQWA 1UJYA 2DL5A 1X27A 3NMZC 4DEYA 1YCSB 1AWWA 2ROLA 4DEXA 1PNJA 1QWFA 1K0XA 1QCFA 2JM8A 2MIOA 4RTTA 1XOVA 4LN2A 1N5ZA 2EGCA 1RUWA 3EG0A 3M0UA 2PNIA 4HCKA 3VS7A 2FPFA 4F17A 1WX6A 1M8MA 2F2VA 2KYMA 4GBQA 2DRKA 4RTZA 1MV0B 3M0QA 2O9VA 1TG0A 2VKNA 1X6BA 1UGVA 1NG2A 4OMPA 2YUNA 3REBB 1UECA 2K6DA 2YUQA 4CC2A 2YT6A 1UG1A 1FYNA 2DL7A 1T0JA 3VS2A 2LJ3A 1JU5C 2RMOA 1YNZA 2DL3A 1AWOA 5IHKA 3M0PA 3VS5A 5L23A 2FPDA 1QKWA 5FWCA 2DBKA 2C0TA 4OMNA 2EYYA 4D8KA 1GBRA 4K11A 1VYTA 1CKAA 3UATA 2CUBA 1GRIA 1H8KA 1MUZA 3EHRA 4RTXA 2EBPA 2HEQA 2EYZA 3I5RA 3TSZA 3VS1A 1YWOA 1QLYA 4X1VA 2JT4A 2NWMA 1YN8A 4LUEA 1G83A 1NM7A 1X43A 3VS0A 4RTYA 4E6RA 3EHQA 2FG0A 1GCPA 2D0NA 1AOJA 2ENMA 2DM1A 2DBMA 1SPKA 4CC3A 2FO0A 2J05A 2GTJA 1WLPB 3O5ZA 4F14A 1YWPA 3I5SA 2BZXA 2FRWA 1Z9ZA 2YUOA 1HJDA 3UF4A 4KRTA 1T0HA 3NPFA 4OMQA 2GGRA 4LNPA 1RLQC 5IH2A 3EG2A 4IIMA 2JXBA 3VS4A 2EYWA 2LP5A 3ULRB 1NLPC 3UA6A 2QDLA 2DJQA 2FEIA 5HCKA 2C0OA 4AG2C 2JS0A 1I1JA 1S1NA 2J6OA 2EQIA 2LX7A 1JXMA 2DILA 1K0SA 4QT7A 2RN8A 3M0RA 1WXTA 1M27C 2K79A 2D1XA 4LE9A 2LZ6B 2W10A 1X6GA 2K3BA 1ZUYA 1ABOA 1ZUUA 1V1CA 2ROTA 1W6XA 1CKBA 3LH5A 1GBQA 2KT1A 4AG1C 1JEGA 4RTUA 3ZL7C 5FW9A 2CSIA 3RBBB
chains in the Genus database with same CATH superfamily
1D3BB 2W0ZA 2EJGA 2RM4A 3OW2S 1YFNA 4AFSC 1KQSS 2DVJA 3G4SA 1M9SA 1VQPT 1QVPA 3OYCA 2FZCB 2JW4A 4F7UG 2EQMA 2V26A 1MHNA 2HCKA 1BU1A 4ELYC 5I11A 4M7DA 4OB1B 2CKKA 4OB2B 5D6WA 3CCMT 1M3BA 4JRPA 1GCQC 1ZSZB 5KYNA 4PFZA 1FX7A 1MGQA 2DL8A 3TEEA 3OYYA 4A4GA 4LD9K 2RA2A 1ACMB 2E5KA 2V1RA 3TSWA 1OU8A 4NOYA 4XU1A 1FMKA 3OYEA 5IXBA 2I0NA 5GMKm 2KBTA 3RNJA 1M3AA 2EKHA 2SRCA 5GAN7 5IHIA 2O4XA 3CC7Q 1N9RA 4A63B 2LCLA 3I35A 3LYIA 2J6FA 3SD4A 1IXDA 1VQ5A 3X20B 1M2VA 4ZN3A 1KQSA 1PKTA 1YITT 1SRLA 3H0HA 2CSQA 1VQKQ 3JB9F 1JO8A 1GXIE 1VQMT 3KXTA 2CT3A 3CCET 4XTYA 4BB7A 3DLMA 2EYXA 2DXCA 2EGEA 1IGQA 1B3QA 2AKLA 3G6ET 2LC4A 2RK1A 1M4ZA 5CQXA 1PKSA 4OMFB 2MCNA 4AFZC 3QWYA 1WNLA 3HRSA 3VS6A 1VOMA 1VQNQ 4FYWB 1Z9QA 2CREA 4JJCA 3A8MB 2RHIA 2R57A 3JB9H 8AT1B 1TSFA 3SEMA 2QEXT 2YDLA 4B9WA 3BDLA 2CP7A 3BDUA 1QW1A 1YI2A 1DJ7B 1WJSA 3MP1A 5KH6A 1KC8R 4F16A 2RHXA 2NYSA 1SEMA 3V7CA 2L3PA 3M4YA 2AZSA 4ATOA 3EG9B 4HVUA 5LJ3f 2MWOA 2JN0A 5A0DA 1K9MR 2KXCA 4CI0C 2A08A 4QVZA 2QI2A 4MMKA 3G6EQ 4Z02A 5KYXA 2KR3A 5AYFA 4EMKC 4QQ6A 5DLQE 4M75F 4L6V5 4LXCA 1QVFA 5ECAA 4Z8AA 1S72Q 3S3NA 1QWEA 1Q81U 1VA7A 2M0YA 3CPFA 4N0AA 1OEBA 4ME7A 1KSWA 2XK0A 4ZGJB 1VQOA 1NBEB 4M7AA 1BI2A 2OJ2A 1AEYA 3TU4K 4E7HA 1Y0MA 3L42A 1Y7XA 2ABLA 3VS3A 4M7AB 2K2MA 4JDSA 1AD5A 1I5OB 1VQ6A 1TU0B 2HBWA 5IHNA 1K76A 4ZTJA 1NEBA 4OMOA 2OTJQ 4J6WA 1JQQA 5C6SA 5HY6A 4DOWA 5I22A 3QIIA 4J9HA 1PSFA 3QDRB 5GAMe 5GAMf 1M1KR 1WHHA 4FW2A 2EPDA 1QVFS 3ASKA 1OPLA 3CCUT 4M4ZA 1N6AA 1PCXA 3TQ7P 3FJ5A 1Y57A 5A0GA 2QQRA 2RF0A 1AZEA 3VYHB 3H0IA 5CKDA 2O9SA 2HDAA 2HBPA 2OAWA 3JCMV 1TUCA 4AFUC 2BZ8A 2XI9A 3CC7T 2FYKA 2VVKA 4M75E 2K7AA 2WSCE 1OOTA 4PJOF 5LJ5j 5J39A 2PUKB 2PZ1A 2LCCA 2QQSA 3QJYA 1UGPB 4FSSA 1C6VX 2YRDA 2LCSA 1K1ZA 1ABQA 1UEBA 1VQ4T 3CCRQ 4C92G 3CMAA 1ZSZA 1KD1U 2PU9B 2KXDA 1XQHA 2K5IA 2H8HA 2J6KA 2JZ2A 4C92E 2VGNA 3ZEHA 7AT1B 3LW5E 5J26A 1S72T 4Z88A 3PTAA 1EFNA 3PIOA 3X25B 3PGGA 2DA9A 3CPWS 5GJWB 4J7FA 2EYQA 2P84A 4JZ3A 1AWXA 1H3ZA 2XIDA 3EH2A 3HRTA 3MEUA 3VRYA 1X2KA 1M8VA 4GY5A 4M7DF 2DO3A 2JVVA 1VQ8A 2NUPA 2YRVA 1VQ4A 4BACA 2VXFA 4M7AE 2DIGA 1VQ9T 3SWNA 3I55T 3NTHA 1WGSA 1XOVA 5GAMh 1EZZB 3VKIA 1RUWA 4FU6A 3M0UA 2PNIA 2E64A 2VUBA 3CBOA 1WX6A 2DIQA 4EMKA 2F2VA 2QAZA 4RTZA 4C92D 1ZHIA 2MWPA 1M90R 1TG0A 4PJNA 2WACA 1FWZA 3MP8A 4NS5A 1X6BA 3H9NA 1UGVA 1AHJB 2QQBA 2YUQA 4FW1A 3OSSC 1UG1A 1VQ9Q 3I55Q 3HFOA 3F70A 3VS2A 1JU5C 1YNZA 1PSEA 2V8KA 1RAIB 2JTMA 2IG0A 3CD6A 3OA6A 1F1BB 3E19A 5FWCA 2R5AA 2K2VA 4D8KA 1JB0E 2K5FA 2KQWA 3A8GB 1YJWA 4RTXA 1GRIA 1H8KA 2VYTA 2HEQA 3MJXA 4PK4A 1YWOA 1YJWQ 2C06A 2F5KA 4E7JA 1O75A 2JT4A 2M0OA 2YLCA 1IHWA 1X43A 1OI1A 3VS0A 4RTYA 1M1KU 1GCPA 2OAUA 1Q81C 4M77D 3S6WA 1MMNA 4MZTA 4OF1A 3NTIA 2FO0A 3G4ST 2CS7A 4EMGA 1VQPA 3PFSA 1YWPA 2FB7A 3H8ZA 3M59A 1Z9ZA 2YUOA 4HCCA 4OMQA 1VQOQ 1JJ2P 1YJWT 2GGRA 5LJ3j 1RLQC 4IIMA 3RKXA 2EYWA 2LP5A 3G7ZA 4M77G 5GANj 2HD0A 1RAHB 2DAQA 2J6OA 2EQIA 2ZAEA 3CC7A 2DILA 2H3EB 5GAOm 2ZPBB 4FT2A 3M0RA 4NL3A 3MCAB 3CCJT 2K79A 3JCMW 4M7DE 2K3BA 5GANe 4FL6A 1YHQQ 3CBMA 1ABOA 5LL6S 2ROTA 5FU6C 1Q7YC 3JCMd 3L2VA 1Q95G 3RERA 3EAEA 4RTUA 2MF2A 4MDWA 2E3IA 2HKQB 2GBQA 4OVAA 3CCQQ 2DXUA 1VQ6T 4BY6B 1M2VB 5KCHA 3I56Q 4L59A 1K9MU 2QTXA 1K73C 5FU7B 2KNBB 4PJMA 4J9DA 2JMCA 3PE0A 4OGCA 5KYWB 1XJWB 4OP0A 1G3WA 5GAMg 2HAXA 1MMDA 4KGZB 1LVKA 2CZ6B 1JRIA 1RI9A 2DD5A 5HK3A 2YRCA 2RD1A 3RR6A 5GAOr 4TVRA 4O6JA 2HQEA 1SRMA 2B8AA 1VQMA 4A4FA 2AKKA 4FIBA 4XK8E 3SFMA 3C95A 1X2QA 1VQMQ 2CYZB 2PTKA 1TXQA 3CD6Q 2ED1A 4J9GA 2BKDN 3PIPA 4JLIA 2PVDB 3OYFA 2EIFA 2X3XD 2RQWA 4HT8A 2DFUA 4C8QG 1FMVA 3MEWA 4E7ZA 2OTLT 1KQSP 2E6NA 1TUDA 4R0KA 3A8HB 2X4XA 5KCOA 2E4HA 5CK9A 3EGXA 3LWHA 4ZGEB 3G4SQ 4PJOC 1WIEA 2HL5C 4KGXB 3DLLA 2EQJA 2DKGA 3G71T 3CQTA 1RI0A 4XQ3A 4PJOG 3RKYA 4KULA 2XHCA 3QG1A 3UT1A 1D1AA 2DMOA 2DYIA 2LT4A 2Y4YA 3QBYA 5KE3A 2RQUA 5GAMj 3FC3A 4C92B 1ZLMA 4RKUE 1K9AA 4J9IA 2QK0A 4QKUA 3AHUA 3R6OA 3GOXA 1QP2A 4C5IA 3OQ5A 4C5HA 5KYUB 2RB6A 2ECZA 2RI5A 5CIUA 4M75B 4C8QA 1U8RA 2JMAA 3H0FA 1WQ7A 1TS9A 1Q86R 2A37A 5M9OA 1M3CA 3JCMP 3CC2A 2D8JA 1GFDA 5HK0A 4ORZA 1JJ2A 3S3OA 4ESRA 3EGXB 3OW2P 2F69A 2M02A 3J80E 3GBQA 1U3OA 3P8DA 2CGHA 1IZ6A 3FDRA 1Q82R 3CBPA 3A1PA 4ZN1A 2A7YA 1ZBJA 2BZYA 4M78G 2CT4A 3M5AA 1BCOA 3UA7A 3V7RA 1PD1A 2JS2A 4J5YA 4C8QC 2EJFA 1PHTA 2EQKA 2P4RA 1NLOC 3OYNA 3OYJA 3PVLA 4C0GA 1IGUA 1WJQA 4QQGA 4M75G 3CXCP 4XTUA 4JJNK 3RMQA 3M4GA 1SSFA 3TVTA 4KH0B 3L2RA 1JJ2S 3IQLA 1KK7A 4FYVB 5CKBA 4QQDA 2CP0A 2HL3A 4PFOA 1QKXA 3HHTB 4XU2A 3G1JA 2CH4W 2QG9B 4F7UB 4X9CA 3OYAA 2PVOB 1VQ7Q 1UE9A 1OX8A 1SKUB 5EC7A 4ZGDB 2MK5A 4J6XA 1VQ5T 4BD3A 3V8JA 3JCMc 2PVGB 4RG2A 2CP5A 1WHGA 1X01A 4WF2A 3NGPA 4HKEA 5I21A 2P0KA 4PLLA 3M0SA 4OB0B 2FPEA 2OTLQ 3OYDA 3M58A 2GFAA 3OB9A 5CVIA 2LJ1A 4AFQC 2GNCA 2RO0A 1NPPA 3M56A 1YITA 3I9QA 4RG8A 2E70A 1YITQ 5IT9E 1VQ8T 5CO7A 4LDWA 2JOYA 4OGEA 3CEYA 1UHFA 1BB9A 5KYYA 3CCJA 4JJDA 4KUDK 1WJRA 2O88A 1SSHA 1R0CB 2D0QB 1VYUA 2F2XA 2LX9A 1QVFP 2DLPA 2ZPGB 5LJ3g 3Q1JA 2KE9A 1WQWA 1ZUKA 3LGFA 4PLIA 1SHFA 2KY9A 1OZ2A 2HSEB 2KRNA 9ATCB 3MHXA 2X4WA 4XU0A 4KBMB 3QUIA 1BIAA 2LQWA 4C5EA 2DL5A 3JRZA 4DEYA 1YCSB 4Y28E 2X9HA 1QWFA 1K0XA 1QCFA 2CP6A 1HYOA 2MIOA 4RTTA 2L3RA 3GP8A 2P0QA 1N5ZA 3TCJA 1VQNA 2NUPB 3VV0A 4HCKA 4C0FA 2FPFA 4F17A 3OMGA 4RCCA 2XDBA 2DRKA 1TWBA 4CRIA 1M5Q1 1VIFA 5CQYA 2K3XA 2VKNA 1RL2A 1NG2A 1Y96A 4OMPA 3MPUB 2YUNA 4CC2A 2K6DA 3SB2A 3M55A 2LTOA 4XTVA 3JCMQ 5GAN2 2RMOA 4FYXB 1VIEA 2NLUA 1AWOA 5GAN6 1LPLA 3V7SA 1D3BA 5GANf 2RK2A 3CCRT 2AIRB 3VS5A 1VQOT 2LVMA 2FPDA 1Y07A 3RMSA 2C0TA 4OMNA 3QDFA 1BI0A 3PT9A 2AHJB 2YHTA 3TSZA 4X9DA 1N8RU 4X1VA 2NWMA 1K8AR 1KHCA 1NM7A 5KYXB 3A8OB 5IN1A 3CCJQ 3MO8A 4E6RA 3EHQA 2FG0A 2ZCFB 4C92A 2HNIA 2DM1A 1B34A 1U1SA 5C0MA 1SPKA 3CD6T 1BKBA 2GTJA 2DERA 4ELZC 2XDDA 4FCYA 3GLXA 3L2WA 3JCMJ 4M77A 1HJDA 4J8OA 3UF4A 4KRTA 3HFNA 1YIJQ 1VQPQ 2E41A 4LNPA 1YJ9A 3ULRB 4BE2A 2HQXA 3OYGA 3RKWA 4PKCC 1Q7YU 2QDLA 1RAFB 2DJQA 5HCKA 6AT1B 3RDVA 1I1JA 2LX7A 3KBGA 1M90C 4AMCA 1NJIR 4UC4A 3E9GA 4C0ZA 4IKFA 4M7AG 1QCNA 1M27C 4LE9A 2W10A 1PC0A 3BE3A 4E7LA 1ZUYA 2GF7A 1K9MC 1V1CA 2EWNA 2ZPIB 1W6XA 4BUGA 3JCMf 1GBQA 4LD6A 5FROA 4AG1C 4EPCA 5GANg 5FW9A 3RBBB 3HSBA 3OS0A 2K3YA 4A53A 4LDXA 2EVRA 4J9FA 3M0TA 1WXUA 1ARKA 1IO6A 2QGFB 1FXXA 5GJVB 1NZ9A 3HKSA 2XDPA 4N4GA 2AK5A 3CMAQ 2L5QA 1HD3A 2QXFA 4J9BA 4JZ4A 4C92C 4BE1A 1B7TA 4LDYA 3A8LB 1TUGB 2R58A 3V8LA 4A4HA 2QA4Q 3OSVA 5CKFA 3RESA 1KD1C 2MOXA 5GMKi 1ZBXA 5DLOA 1UGSB 2GTOA 2VC8A 5LJ3e 4N0AC 1GL5A 3G71Q 2D8HA 2OTJA 1VQNT 2EGAA 2E6ZA 3NHNA 5I2SA 3I56T 2L89A 4CC4B 2ATCB 1PWTA 4HVWA 1GFCA 2AZVA 4KUIA 2DZCA 1OU9A 4GLMA 4PFPA 1YIJA 5GAN4 3X26B 4C92F 2DE0X 2QEXA 3CCMQ 1WI7A 1OX9A 2RQRA 3WVEB 1E7OA 1V76A 3EFRA 3GIBA 2DYBA 3L2QA 1UTIA 3EFOA 1HSQA 1QMCA 1MMAA 3CCRA 3QZ9B 1OULA 3LGLA 2KAFA 2I2LA 2L3QA 5LJ5h 4JRIA 2HKNA 3M9QA 1BI1A 3EGDB 5GAOn 2E10A 5KE2A 2KK4A 1YJ9Q 2KRSA 2LNHB 2COYA 4IURA 3CMEA 4ANJA 2NUZA 2YXYA 1OQKA 3OYHA 3J7AF 5GAN8 1VQ6Q 4LUDA 3JAME 4KGVB 4PJOD 1D0YA 1D09B 3QWXX 1YJ9T 2FZGB 1KJWA 4N4HA 1YIJT 3NFCA 3EGUA 2MMPA 2FVUA 2Y90A 1Q82U 4N4IA 2KYBA 1KD1R 2VV5A 4Z89A 2KDSA 1PRLC 3VJPA 3LX7A 3CPWA 4J9EA 2ZPHB 2KGTA 1MV3A 3INZA 2CZ1B 5L8RE 3OW2A 2EKOA 4FYYB 4C0DC 1Y71A 1H641 1ZSZC 1UB4A 3CCST 1X6OA 3BW1A 2J7IA 1KIKA 3CCUA 4BI8B 1XNIA 1I0CA 1A0NB 2ED0A 2KVQG 3D7SB 2FRYA 1Q86U 4RUGA 4J83A 1G3TA 1WHLA 1M30A 2VASA 4IUVA 2G6FX 1G3YA 2E3HA 2A36A 1OZ3A 3PVQA 5GAOl 3META 2EAYA 1WZOA 1W2BS 5D6YA 5FRMA 3A98A 4BI4A 2XG8D 2LMJA 2OI3A 1T3LA 1N8RR 3CC2T 2RJEA 1G2BA 3HPWA 2DL4A 5FLXE 2KEAA 2A28A 1T3SA 5J3BA 3CMAT 1HXDA 3REAB 2LQ8A 1I07A 1UGQB 4JPBW 4IUQA 3EFSA 4PL6A 1VQ8Q 2DEUA 4J9CA 4M78C 2CP2A 3SWNB 4Y92A 3CCLQ 3QJ6A 3NTKA 2DRMA 3QZ5B 4EDUA 4IUUA 4WTOB 2RHUA 3LLRA 5IAYA 1K73U 4C5GA 4CC7A 2JJ9A 2C0IA 1PRMC 4JRQA 3VUBA 1NE8A 1J3TA 1W2BA 1NJIC 3N5BB 3X28B 4J7IA 3CCQA 2X51A 4Y91A 3QPHA 4XTZA 3VYGA 3SHWA 1KC8C 2O31A 2E5QA 3PMIA 1Q86C 3JCMg 4EIKA 3CC4Q 2GFUA 5EG2A 2RNAA 2LQNA 2RQTA 8ATCB 2X35A 1U5SA 3R6NA 2HMAA 1ZQ1A 3JV3A 3A5ZB 4M7DC 1AVZC 1ZX6A 1QVGP 4R55A 1JXOA 4C0DB 3THKA 4D8DA 2A3LA 2JTFA 5D7UA 1IHVA 1RAEB 4EMHA 3CCEQ 1M1KC 3UDCA 2DJZA 2DXTA 1H92A 3CCVA 4VUBA 3URGA 1PD0A 2JM9A 3JB9J 1K8AC 3H6ZA 2RHYA 1UJYA 3NMZC 1KG1A 2P4TA 2MYSA 1AWWA 4F7UE 1B34B 2RI3A 4FM4B 2JM8A 4M7DD 3C12A 1D0XA 2O01E 2EGCA 5FU6B 4LDUA 2KSSA 3EG0A 1QCOA 3FB9A 3CC4A 2DEQA 4JLGA 1BIBA 1M8MA 5KYYB 1YHQA 2KYMA 1SF9A 4MDXA 2O9VA 1R0BG 2DTOA 3REBB 3MKDA 1UECA 2AT1B 2YT6A 4F7UA 4RCBA 2DPPB 1FYNA 2DL7A 2LJ3A 1MNEA 3I55A 5IHKA 1R8OB 4M75C 4RMOA 4BY6C 4BE0A 5LJ5d 1JBMA 5GMKj 2PQWA 2DBKA 4PJJA 3UWNA 3OYIA 4M78D 2EYYA 1GBRA 4K11A 4M77F 3UATA 2BIVA 2CUBA 3EG9A 4JS5A 3ZFJA 2K4YA 3T9NA 3I5RA 2V8JA 3VS1A 4BDZA 2WSFE 4DBQA 3G6EA 2ZPEB 4DQ2A 1WPYA 4EMKB 1M1GA 3OS1A 1AOJA 5AT1B 2ENMA 4V2SA 1OYXA 4CC3A 2J05A 1WLPB 3P8HA 4F14A 3MEAA 4M7AC 1QP3A 2RI2A 1IREB 3CMET 3OYMA 1VQLQ 4J6YA 5GMKl 1VQ7T 1YI2T 1T0HA 4NL2A 2K5LA 4P5NA 3FJPA 1C0MA 2JXBA 3VS4A 1BYMA 2DZ9A 1EIFA 2GCXA 2FEIA 4HCBA 1BCMA 2QQAA 2XKOC 3HRUA 4DOVA 1G3SA 3L1AA 3P8BB 1AT1B 4Q5WA 4QT7A 5LJ5f 5LJ5e 1ZA2B 2MI6A 4QVDA 3PMTA 2QASA 3FLGA 1VUBA 3EFOB 1M1FA 4DA4A 1P92A 2HQHA 2LT1A 4BDYA 2OTJT 2RJCA 1CKBA 3LH5A 2KT1A 3CCVQ 3ZL7C 2FZKB 3OYKA 2E12A 2CSIA 5A0LA 1KC8U 4LDVA 1VQLT 1U06A 1I5LA 1G5VA 2GQVA 5CKEA 4C8QD 2WSEE 1VQ4Q 5FU7C 1TOVA 3M54A 2CUDA 2GQIA 1RAGB 1M2OA 2XD0A 1NEGA 1PM3A 1WXBA 1WHJA 1BBZA 1SG5A 3CCVT 1WFWA 2KROA 2V8IA 1X69A 2M51A 1OV3A 4HVVA 3RIRA 3KFVA 1WHMA 2VB6A 4PJOA 1WYXA 1QVGA 3OMCA 1AWJA 2DF6A 2R5MA 1U1TA 1RLPC 4D6WA 3CXCS 2QA4A 3CCSQ 5GMKe 2DETA 2JUFA 3E2UA 3KUFA 1UHCA 2VGMA 3DB3A 3FRNA 3U23A 2K57A 3HTRA 2LNVA 1LOJA 1V29B 4HA8A 1VQLA 2NUTB 3CCLA 1Q81R 4E7KA 2LQKA 1Q7YR 2YWWA 3CC2Q 1FMWA 1NYGA 2QDYB 4GLKA 2JTEA 1BK2A 1TH7A 2YSQA 3QYGB 2A0FB 2E1HA 1HK9A 1KQ2A 4FT4A 3JCMh 1XTDA 5GANd 1G8XA 3L2ZA 4WCIA 3EH1A 1WA7A 2L3SA 1IRXA 2QA4T 2B86A 1K4US 4XAXB 2DTHA 4XU3A 1AZGB 3HL8A 4ZTFA 1GCQA 3JCMb 1YP5A 4RTWA 2BE9B 1IB8A 4JRKA 1ZA1B 1QVGS 5FRNA 3CCLT 4M78F 3CXCA 1OPKA 1UFFA 2RH2A 1I4K1 3FIFA 1I81A 4O5VA 1LCKA 2CZ7B 3E9FA 3ZBDA 3VUZA 5CKHA 2CDTA 3TREA 2FL7A 3I56A 1WDXA 3JB9I 1H3HA 5GAMd 1YJNA 1NYFA 2VXEA 2G3RA 4OMMA 4B6MA 2HSPA 1E6GA 5GMKh 2E65A 4AT1B 1YJNQ 1YI2Q 5CR2A 4M75A 2M16A 2RJDA 1VQ5Q 3GNFB 2V1QA 2L2PA 4M78B 2RHZA 2D9TA 5LJ3d 5HKCA 3JCMX 2J06A 4KT0E 5DM7R 1W70A 3QHSA 2EW3A 4IUPA 3C94A 1UJ0A 3JSCA 1I8FA 2O2OA 3CC4T 1R77A 1BI3A 1VYVA 2QGGA 1YJNT 3VRZA 2KT8A 4M77B 1B07A 5GAN5 2KRMA 2CH4A 3C0CA 1Y96B 1X75C 2RQVA 2QYZA 2YUPA 2YLBA 1SHGA 3HP9A 1UGRB 1N27A 1ZSGA 4OMLA 2L0AA 5DY9A 1W1FA 4DBFA 1KQ1A 2DNUA 1MMGA 2RPNA 3QSUA 2F1LA 1KFZA 1D0ZA 2SEMA 3QO3A 4JS4A 1D1BA 3EGDA 1O9SA 3OBYA 4JUVA 3H41A 3WVDB 3CCSA 2CP3A 3GPLA 2KMTA 1VQKT 2COWA 2M1HA 3MEVA 3CCUQ 3JB9D 4C8QF 2LJ0A 2HZYA 2FHDA 2COZA 3EG1A 3JCMe 2F2WA 3M57A 5IXFA 3UPUA 2RJFA 3DB4A 2D6FA 1LJOA 5A2QE 3EG3A 1CSKA 3ME9A 3ER0A 5FWBA 1UUEA 1YBYA 4DBRA 1NPRA 5GAN3 3OBWA 2ESWA 2F5TX 4MMLA 4DBHA 3V8KA 1WHKA 2XMFA 1E6HA 4E7SA 5KYWA 5LJ3h 4A4EA 4M77E 2P0PA 1VQKA 1UDLA 3OY9A 2KI7A 5KYUA 4M78E 2VWFA 3J81E 5LJ5g 1PG5B 1K73R 3SWNC 1VQ9A 2IPOB 3CCEA 4ZNXA 2K9GA 1D1CA 2X4YA 2MAMA 4HT9A 4F7UF 4M7DB 3JB9G 2IIMA 2X3WD 3GNGA 4IIOA 2OX7A 4II1A 2X4JA 2JNGA 4FSXA 4A54A 4RTVA 2IVWA 3M53A 4JJBA 1K8AU 2ZZDA 2M9UA 4IUTA 1N8RC 3SDZA 4M7AF 2QEXQ 3CCMA 3QXEB 3CPWP 1TTHB 3PNWC 2BTTA 3WXMB 3O8VA 2LRQA 5GAOq 2DX1A 2BUDA 3RUXA 3X24B 4HXJA 3BFMA 5D6XA 1X27A 2DTIA 5GAOp 3OS5A 2ROLA 4DEXA 1PNJA 4XTXA 4QVCA 4PJOE 3QYHB 5I2MA 3FEOA 1MNDA 4LN2A 2ZPFB 1S72A 2DVEA 2CZ0B 3VS7A 4PJLA 2EFIA 4L5GA 4GBQA 4F04B 3OS2A 1MV0B 3GF5A 3M0QA 3E1SA 1N9SA 4E2FB 3LWIA 2O4XB 4C8QE 2H3JA 4X34A 2OTLA 2QTVA 3C4SA 4A4KA 5GANh 2EJ9A 4OB3B 3VU3C 4R56A 1T0JA 1C1AA 2MPXC 4M75D 4YTLA 4PJOB 3QKJA 2DL3A 4QW2A 4M78A 3BY7A 2PUOB 3G71A 3M0PA 5CAIA 5L23A 2LDMA 4E7IA 2XICA 2XU8A 1QKWA 3LH0A 4M77C 3OYBA 4PNOA 1VQ7A 2DD4A 1VYTA 1CKAA 1MUZA 3EHRA 1QQJA 2EBPA 5CCAA 2EYZA 1RADB 3OYLA 1QLYA 1YN8A 4LUEA 1G83A 2QQ9A 2Z0WA 2DXBA 2Y4XA 2D0NA 1RAAB 1RABB 1YHQT 1Q82C 2ZGWA 2DBMA 1KHIA 1W2BP 4E47A 3O5ZA 4BI3A 1NJIU 1W4SA 1YCYA 3I5SA 2BZXA 3AT1B 2FRWA 2DK3A 4MZMA 4C8QB 1RACB 2L8DA 1M90U 3DKMA 3NPFA 4M7AD 4KH1B 5IH2A 3EG2A 4M7DG 1LNXA 4B9XA 1NLPC 4HCZA 3UA6A 3MP6A 2BE7D 2C0OA 4AG2C 3CMEQ 2JS0A 1S1NA 1JXMA 1EX4A 3S3MA 1K0SA 2EQUA 3L2UA 2RN8A 1WXTA 2NUTA 3CCQT 2D1XA 2LZ6B 1X6GA 4XTWA 1ZUUA 4MZPA 1JEGA
chains in the Genus database with same CATH topology
2W0ZA 2GBQA 1U06A 4AFSC 2DVJA 2EVRA 2JW4A 4J9FA 3M0TA 1WXUA 1ARKA 2CUDA 2GQIA 2KNBB 2HCKA 1BU1A 4J9DA 2JMCA 3PE0A 1IO6A 5I11A 1NEGA 5GJVB 1WXBA 1M3BA 1GCQC 2AK5A 1BBZA 1HD3A 1RI9A 2DL8A 4J9BA 4JZ4A 1WFWA 2KROA 2E5KA 1X69A 2M51A 1OV3A 2V1RA 4HVVA 3TSWA 3KFVA 1FMKA 1WYXA 1SRMA 1AWJA 5IXBA 2AKKA 2DF6A 2I0NA 1X2QA 1RLPC 2KBTA 2MOXA 3RNJA 2GTOA 1M3AA 2EKHA 2PTKA 2SRCA 5IHIA 2ED1A 1UHCA 4J9GA 1GL5A 2D8HA 4A63B 2EGAA 3NHNA 3U23A 3I35A 4CC4B 2J6FA 2X3XD 1PWTA 4HVWA 2RQWA 1GFCA 2AZVA 4GLMA 1PKTA 1NYGA 1SRLA 3H0HA 2CSQA 1TUDA 2DE0X 2JTEA 1BK2A 1WI7A 2YSQA 4R0KA 2RQRA 1E7OA 1JO8A 1WIEA 2DYBA 2CT3A 1UTIA 4WCIA 1WA7A 2EYXA 1HSQA 2L3SA 3CQTA 2B86A 1K4US 2EGEA 1B3QA 2AKLA 1AZGB 1GCQA 1YP5A 2L3QA 4RTWA 1PKSA 2DMOA 2MCNA 4AFZC 2RQUA 3QWYA 3VS6A 1ZLMA 1Z9QA 1K9AA 2CREA 2KRSA 4J9IA 1OPKA 4JJCA 1UFFA 2LNHB 1LCKA 3SEMA 2YDLA 2ECZA 2NUZA 2CDTA 1WDXA 1H3HA 1NYFA 4LUDA 4F16A 2JMAA 1SEMA 4OMMA 3H0FA 3QWXX 2HSPA 2L3PA 2A37A 1E6GA 2AZSA 1M3CA 1KJWA 2D8JA 4HVUA 1GFDA 4ORZA 3EGUA 2KXCA 4ESRA 2A08A 2KYBA 2V1QA 2L2PA 4Z89A 1PRLC 2KR3A 4J9EA 2J06A 2KGTA 1MV3A 1W70A 3GBQA 1U3OA 2EW3A 1UJ0A 2J7IA 2O2OA 1KIKA 5ECAA 4Z8AA 1ZBJA 2BZYA 1VYVA 2CT4A 1I0CA 1A0NB 1QWEA 3VRZA 2ED0A 1VA7A 2KT8A 2M0YA 1B07A 2FRYA 2KRMA 3UA7A 2CH4A 4RUGA 3C0CA 1OEBA 2JS2A 1KSWA 2RQVA 2YUPA 1M30A 1PHTA 1SHGA 2P4RA 1ZSGA 2OJ2A 4OMLA 2L0AA 1AEYA 1W1FA 2G6FX 2DNUA 1NLOC 3PVLA 2A36A 2RPNA 3PVQA 1Y0MA 1KFZA 2SEMA 2ABLA 3VS3A 3A98A 2K2MA 2LMJA 1AD5A 2OI3A 1T3LA 3TVTA 3H41A 1G2BA 3IQLA 2DL4A 2HBWA 2KEAA 1K76A 5IHNA 1NEBA 4OMOA 2A28A 1JQQA 2LJ0A 1T3SA 3EG1A 5I22A 1QKXA 3REAB 2F2WA 4J9HA 5IXFA 1I07A 4JPBW 2CH4W 3EG3A 1UE9A 1CSKA 2EPDA 4J9CA 5EC7A 1OPLA 4M4ZA 3FJ5A 5FWBA 1Y57A 1UUEA 2RF0A 1AZEA 2ESWA 4Y92A 3H0IA 2XMFA 1E6HA 2O9SA 2HDAA 2DRMA 3NGPA 2OAWA 1TUCA 4AFUC 1UDLA 3M0SA 4CC7A 2C0IA 2BZ8A 2VWFA 2FPEA 1PRMC 2VVKA 1J3TA 2K7AA 1OOTA 4ZNXA 2K9GA 2PZ1A 3SHWA 2LJ1A 4AFQC 2O31A 2GNCA 3I9QA 4FSSA 4EIKA 2RNAA 2LCSA 1K1ZA 2IIMA 1ABQA 2LQNA 2RQTA 2X3WD 4IIOA 1U5SA 1UHFA 1BB9A 3R6NA 2KXDA 3JV3A 4JJDA 2H8HA 1AVZC 1ZX6A 4RTVA 1SSHA 2O88A 2J6KA 1VYUA 2F2XA 4JJBA 1JXOA 2DLPA 4Z88A 3THKA 4D8DA 2KE9A 1EFNA 1ZUKA 2DA9A 1SHFA 5GJWB 2KRNA 4JZ3A 1H92A 1AWXA 2BTTA 2DX1A 2JM9A 3VRYA 1X2KA 4HXJA 2LQWA 1UJYA 2DL5A 1X27A 3NMZC 4DEYA 1YCSB 1AWWA 2ROLA 4DEXA 1PNJA 1QWFA 1K0XA 1QCFA 2JM8A 2MIOA 4RTTA 1XOVA 4LN2A 1N5ZA 2EGCA 1RUWA 3EG0A 3M0UA 2PNIA 4HCKA 3VS7A 2FPFA 4F17A 1WX6A 1M8MA 2F2VA 2KYMA 4GBQA 2DRKA 4RTZA 1MV0B 3M0QA 2O9VA 1TG0A 2VKNA 1X6BA 1UGVA 1NG2A 4OMPA 2YUNA 3REBB 1UECA 2K6DA 2YUQA 4CC2A 2YT6A 1UG1A 1FYNA 2DL7A 1T0JA 3VS2A 2LJ3A 1JU5C 2RMOA 1YNZA 2DL3A 1AWOA 5IHKA 3M0PA 3VS5A 5L23A 2FPDA 1QKWA 5FWCA 2DBKA 2C0TA 4OMNA 2EYYA 4D8KA 1GBRA 4K11A 1VYTA 1CKAA 3UATA 2CUBA 1GRIA 1H8KA 1MUZA 3EHRA 4RTXA 2EBPA 2HEQA 2EYZA 3I5RA 3TSZA 3VS1A 1YWOA 1QLYA 4X1VA 2JT4A 2NWMA 1YN8A 4LUEA 1G83A 1NM7A 1X43A 3VS0A 4RTYA 4E6RA 3EHQA 2FG0A 1GCPA 2D0NA 1AOJA 2ENMA 2DM1A 2DBMA 1SPKA 4CC3A 2FO0A 2J05A 2GTJA 1WLPB 3O5ZA 4F14A 1YWPA 3I5SA 2BZXA 2FRWA 1Z9ZA 2YUOA 1HJDA 3UF4A 4KRTA 1T0HA 3NPFA 4OMQA 2GGRA 4LNPA 1RLQC 5IH2A 3EG2A 4IIMA 2JXBA 3VS4A 2EYWA 2LP5A 3ULRB 1NLPC 3UA6A 2QDLA 2DJQA 2FEIA 5HCKA 2C0OA 4AG2C 2JS0A 1I1JA 1S1NA 2J6OA 2EQIA 2LX7A 1JXMA 2DILA 1K0SA 4QT7A 2RN8A 3M0RA 1WXTA 1M27C 2K79A 2D1XA 4LE9A 2LZ6B 2W10A 1X6GA 2K3BA 1ZUYA 1ABOA 1ZUUA 1V1CA 2ROTA 1W6XA 1CKBA 3LH5A 1GBQA 2KT1A 4AG1C 1JEGA 4RTUA 3ZL7C 5FW9A 2CSIA 3RBBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0Z A;  2GBQ A;  1U06 A;  4AFS C;  2DVJ A;  2EVR A;  2JW4 A;  4J9F A;  3M0T A;  1WXU A;  1ARK A;  2CUD A;  2GQI A;  2KNB B;  2HCK A;  1BU1 A;  4J9D A;  2JMC A;  3PE0 A;  1IO6 A;  5I11 A;  1NEG A;  5GJV B;  1WXB A;  1M3B A;  1GCQ C;  2AK5 A;  1BBZ A;  1HD3 A;  1RI9 A;  2DL8 A;  4J9B A;  4JZ4 A;  1WFW A;  2KRO A;  2E5K A;  1X69 A;  2M51 A;  1OV3 A;  2V1R A;  4HVV A;  3TSW A;  3KFV A;  1FMK A;  1WYX A;  1SRM A;  1AWJ A;  5IXB A;  2AKK A;  2DF6 A;  2I0N A;  1X2Q A;  1RLP C;  2KBT A;  2MOX A;  3RNJ A;  2GTO A;  1M3A A;  2EKH A;  2PTK A;  2SRC A;  5IHI A;  2ED1 A;  1UHC A;  4J9G A;  1GL5 A;  2D8H A;  4A63 B;  2EGA A;  3NHN A;  3U23 A;  3I35 A;  4CC4 B;  2J6F A;  2X3X D;  1PWT A;  4HVW A;  2RQW A;  1GFC A;  2AZV A;  4GLM A;  1PKT A;  1NYG A;  1SRL A;  3H0H A;  2CSQ A;  1TUD A;  2DE0 X;  2JTE A;  1BK2 A;  1WI7 A;  2YSQ A;  4R0K A;  2RQR A;  1E7O A;  1JO8 A;  1WIE A;  2DYB A;  2CT3 A;  1UTI A;  4WCI A;  1WA7 A;  2EYX A;  1HSQ A;  2L3S A;  3CQT A;  2B86 A;  1K4U S;  2EGE A;  1B3Q A;  2AKL A;  1AZG B;  1GCQ A;  1YP5 A;  2L3Q A;  4RTW A;  1PKS A;  2DMO A;  2MCN A;  4AFZ C;  2RQU A;  3QWY A;  3VS6 A;  1ZLM A;  1Z9Q A;  1K9A A;  2CRE A;  2KRS A;  4J9I A;  1OPK A;  4JJC A;  1UFF A;  2LNH B;  1LCK A;  3SEM A;  2YDL A;  2ECZ A;  2NUZ A;  2CDT A;  1WDX A;  1H3H A;  1NYF A;  4LUD A;  4F16 A;  2JMA A;  1SEM A;  4OMM A;  3H0F A;  3QWX X;  2HSP A;  2L3P A;  2A37 A;  1E6G A;  2AZS A;  1M3C A;  1KJW A;  2D8J A;  4HVU A;  1GFD A;  4ORZ A;  3EGU A;  2KXC A;  4ESR A;  2A08 A;  2KYB A;  2V1Q A;  2L2P A;  4Z89 A;  1PRL C;  2KR3 A;  4J9E A;  2J06 A;  2KGT A;  1MV3 A;  1W70 A;  3GBQ A;  1U3O A;  2EW3 A;  1UJ0 A;  2J7I A;  2O2O A;  1KIK A;  5ECA A;  4Z8A A;  1ZBJ A;  2BZY A;  1VYV A;  2CT4 A;  1I0C A;  1A0N B;  1QWE A;  3VRZ A;  2ED0 A;  1VA7 A;  2KT8 A;  2M0Y A;  1B07 A;  2FRY A;  2KRM A;  3UA7 A;  2CH4 A;  4RUG A;  3C0C A;  1OEB A;  2JS2 A;  1KSW A;  2RQV A;  2YUP A;  1M30 A;  1PHT A;  1SHG A;  2P4R A;  1ZSG A;  2OJ2 A;  4OML A;  2L0A A;  1AEY A;  1W1F A;  2G6F X;  2DNU A;  1NLO C;  3PVL A;  2A36 A;  2RPN A;  3PVQ A;  1Y0M A;  1KFZ A;  2SEM A;  2ABL A;  3VS3 A;  3A98 A;  2K2M A;  2LMJ A;  1AD5 A;  2OI3 A;  1T3L A;  3TVT A;  3H41 A;  1G2B A;  3IQL A;  2DL4 A;  2HBW A;  2KEA A;  1K76 A;  5IHN A;  1NEB A;  4OMO A;  2A28 A;  1JQQ A;  2LJ0 A;  1T3S A;  3EG1 A;  5I22 A;  1QKX A;  3REA B;  2F2W A;  4J9H A;  5IXF A;  1I07 A;  4JPB W;  2CH4 W;  3EG3 A;  1UE9 A;  1CSK A;  2EPD A;  4J9C A;  5EC7 A;  1OPL A;  4M4Z A;  3FJ5 A;  5FWB A;  1Y57 A;  1UUE A;  2RF0 A;  1AZE A;  2ESW A;  4Y92 A;  3H0I A;  2XMF A;  1E6H A;  2O9S A;  2HDA A;  2DRM A;  3NGP A;  2OAW A;  1TUC A;  4AFU C;  1UDL A;  3M0S A;  4CC7 A;  2C0I A;  2BZ8 A;  2VWF A;  2FPE A;  1PRM C;  2VVK A;  1J3T A;  2K7A A;  1OOT A;  4ZNX A;  2K9G A;  2PZ1 A;  3SHW A;  2LJ1 A;  4AFQ C;  2O31 A;  2GNC A;  3I9Q A;  4FSS A;  4EIK A;  2RNA A;  2LCS A;  1K1Z A;  2IIM A;  1ABQ A;  2LQN A;  2RQT A;  2X3W D;  4IIO A;  1U5S A;  1UHF A;  1BB9 A;  3R6N A;  2KXD A;  3JV3 A;  4JJD A;  2H8H A;  1AVZ C;  1ZX6 A;  4RTV A;  1SSH A;  2O88 A;  2J6K A;  1VYU A;  2F2X A;  4JJB A;  1JXO A;  2DLP A;  4Z88 A;  3THK A;  4D8D A;  2KE9 A;  1EFN A;  1ZUK A;  2DA9 A;  1SHF A;  5GJW B;  2KRN A;  4JZ3 A;  1H92 A;  1AWX A;  2BTT A;  2DX1 A;  2JM9 A;  3VRY A;  1X2K A;  4HXJ A;  2LQW A;  1UJY A;  2DL5 A;  1X27 A;  3NMZ C;  4DEY A;  1YCS B;  1AWW A;  2ROL A;  4DEX A;  1PNJ A;  1QWF A;  1K0X A;  1QCF A;  2JM8 A;  2MIO A;  4RTT A;  1XOV A;  4LN2 A;  1N5Z A;  2EGC A;  1RUW A;  3EG0 A;  3M0U A;  2PNI A;  4HCK A;  3VS7 A;  2FPF A;  4F17 A;  1WX6 A;  1M8M A;  2F2V A;  2KYM A;  4GBQ A;  2DRK A;  4RTZ A;  1MV0 B;  3M0Q A;  2O9V A;  1TG0 A;  2VKN A;  1X6B A;  1UGV A;  1NG2 A;  4OMP A;  2YUN A;  3REB B;  1UEC A;  2K6D A;  2YUQ A;  4CC2 A;  2YT6 A;  1UG1 A;  1FYN A;  2DL7 A;  1T0J A;  3VS2 A;  2LJ3 A;  1JU5 C;  2RMO A;  1YNZ A;  2DL3 A;  1AWO A;  5IHK A;  3M0P A;  3VS5 A;  5L23 A;  2FPD A;  1QKW A;  5FWC A;  2DBK A;  2C0T A;  4OMN A;  2EYY A;  4D8K A;  1GBR A;  4K11 A;  1VYT A;  1CKA A;  3UAT A;  2CUB A;  1GRI A;  1H8K A;  1MUZ A;  3EHR A;  4RTX A;  2EBP A;  2HEQ A;  2EYZ A;  3I5R A;  3TSZ A;  3VS1 A;  1YWO A;  1QLY A;  4X1V A;  2JT4 A;  2NWM A;  1YN8 A;  4LUE A;  1G83 A;  1NM7 A;  1X43 A;  3VS0 A;  4RTY A;  4E6R A;  3EHQ A;  2FG0 A;  1GCP A;  2D0N A;  1AOJ A;  2ENM A;  2DM1 A;  2DBM A;  1SPK A;  4CC3 A;  2FO0 A;  2J05 A;  2GTJ A;  1WLP B;  3O5Z A;  4F14 A;  1YWP A;  3I5S A;  2BZX A;  2FRW A;  1Z9Z A;  2YUO A;  1HJD A;  3UF4 A;  4KRT A;  1T0H A;  3NPF A;  4OMQ A;  2GGR A;  4LNP A;  1RLQ C;  5IH2 A;  3EG2 A;  4IIM A;  2JXB A;  3VS4 A;  2EYW A;  2LP5 A;  3ULR B;  1NLP C;  3UA6 A;  2QDL A;  2DJQ A;  2FEI A;  5HCK A;  2C0O A;  4AG2 C;  2JS0 A;  1I1J A;  1S1N A;  2J6O A;  2EQI A;  2LX7 A;  1JXM A;  2DIL A;  1K0S A;  4QT7 A;  2RN8 A;  3M0R A;  1WXT A;  1M27 C;  2K79 A;  2D1X A;  4LE9 A;  2LZ6 B;  2W10 A;  1X6G A;  2K3B A;  1ZUY A;  1ABO A;  1ZUU A;  1V1C A;  2ROT A;  1W6X A;  1CKB A;  3LH5 A;  1GBQ A;  2KT1 A;  4AG1 C;  1JEG A;  4RTU A;  3ZL7 C;  5FW9 A;  2CSI A;  3RBB B; 
#chains in the Genus database with same CATH topology
 1D3B B;  2W0Z A;  2EJG A;  2RM4 A;  3OW2 S;  1YFN A;  4AFS C;  1KQS S;  2DVJ A;  3G4S A;  1M9S A;  1VQP T;  1QVP A;  3OYC A;  2FZC B;  2JW4 A;  4F7U G;  2EQM A;  2V26 A;  1MHN A;  2HCK A;  1BU1 A;  4ELY C;  5I11 A;  4M7D A;  4OB1 B;  2CKK A;  4OB2 B;  5D6W A;  3CCM T;  1M3B A;  4JRP A;  1GCQ C;  1ZSZ B;  5KYN A;  4PFZ A;  1FX7 A;  1MGQ A;  2DL8 A;  3TEE A;  3OYY A;  4A4G A;  4LD9 K;  2RA2 A;  1ACM B;  2E5K A;  2V1R A;  3TSW A;  1OU8 A;  4NOY A;  4XU1 A;  1FMK A;  3OYE A;  5IXB A;  2I0N A;  5GMK m;  2KBT A;  3RNJ A;  1M3A A;  2EKH A;  2SRC A;  5GAN 7;  5IHI A;  2O4X A;  3CC7 Q;  1N9R A;  4A63 B;  2LCL A;  3I35 A;  3LYI A;  2J6F A;  3SD4 A;  1IXD A;  1VQ5 A;  3X20 B;  1M2V A;  4ZN3 A;  1KQS A;  1PKT A;  1YIT T;  1SRL A;  3H0H A;  2CSQ A;  1VQK Q;  3JB9 F;  1JO8 A;  1GXI E;  1VQM T;  3KXT A;  2CT3 A;  3CCE T;  4XTY A;  4BB7 A;  3DLM A;  2EYX A;  2DXC A;  2EGE A;  1IGQ A;  1B3Q A;  2AKL A;  3G6E T;  2LC4 A;  2RK1 A;  1M4Z A;  5CQX A;  1PKS A;  4OMF B;  2MCN A;  4AFZ C;  3QWY A;  1WNL A;  3HRS A;  3VS6 A;  1VOM A;  1VQN Q;  4FYW B;  1Z9Q A;  2CRE A;  4JJC A;  3A8M B;  2RHI A;  2R57 A;  3JB9 H;  8AT1 B;  1TSF A;  3SEM A;  2QEX T;  2YDL A;  4B9W A;  3BDL A;  2CP7 A;  3BDU A;  1QW1 A;  1YI2 A;  1DJ7 B;  1WJS A;  3MP1 A;  5KH6 A;  1KC8 R;  4F16 A;  2RHX A;  2NYS A;  1SEM A;  3V7C A;  2L3P A;  3M4Y A;  2AZS A;  4ATO A;  3EG9 B;  4HVU A;  5LJ3 f;  2MWO A;  2JN0 A;  5A0D A;  1K9M R;  2KXC A;  4CI0 C;  2A08 A;  4QVZ A;  2QI2 A;  4MMK A;  3G6E Q;  4Z02 A;  5KYX A;  2KR3 A;  5AYF A;  4EMK C;  4QQ6 A;  5DLQ E;  4M75 F;  4L6V 5;  4LXC A;  1QVF A;  5ECA A;  4Z8A A;  1S72 Q;  3S3N A;  1QWE A;  1Q81 U;  1VA7 A;  2M0Y A;  3CPF A;  4N0A A;  1OEB A;  4ME7 A;  1KSW A;  2XK0 A;  4ZGJ B;  1VQO A;  1NBE B;  4M7A A;  1BI2 A;  2OJ2 A;  1AEY A;  3TU4 K;  4E7H A;  1Y0M A;  3L42 A;  1Y7X A;  2ABL A;  3VS3 A;  4M7A B;  2K2M A;  4JDS A;  1AD5 A;  1I5O B;  1VQ6 A;  1TU0 B;  2HBW A;  5IHN A;  1K76 A;  4ZTJ A;  1NEB A;  4OMO A;  2OTJ Q;  4J6W A;  1JQQ A;  5C6S A;  5HY6 A;  4DOW A;  5I22 A;  3QII A;  4J9H A;  1PSF A;  3QDR B;  5GAM e;  5GAM f;  1M1K R;  1WHH A;  4FW2 A;  2EPD A;  1QVF S;  3ASK A;  1OPL A;  3CCU T;  4M4Z A;  1N6A A;  1PCX A;  3TQ7 P;  3FJ5 A;  1Y57 A;  5A0G A;  2QQR A;  2RF0 A;  1AZE A;  3VYH B;  3H0I A;  5CKD A;  2O9S A;  2HDA A;  2HBP A;  2OAW A;  3JCM V;  1TUC A;  4AFU C;  2BZ8 A;  2XI9 A;  3CC7 T;  2FYK A;  2VVK A;  4M75 E;  2K7A A;  2WSC E;  1OOT A;  4PJO F;  5LJ5 j;  5J39 A;  2PUK B;  2PZ1 A;  2LCC A;  2QQS A;  3QJY A;  1UGP B;  4FSS A;  1C6V X;  2YRD A;  2LCS A;  1K1Z A;  1ABQ A;  1UEB A;  1VQ4 T;  3CCR Q;  4C92 G;  3CMA A;  1ZSZ A;  1KD1 U;  2PU9 B;  2KXD A;  1XQH A;  2K5I A;  2H8H A;  2J6K A;  2JZ2 A;  4C92 E;  2VGN A;  3ZEH A;  7AT1 B;  3LW5 E;  5J26 A;  1S72 T;  4Z88 A;  3PTA A;  1EFN A;  3PIO A;  3X25 B;  3PGG A;  2DA9 A;  3CPW S;  5GJW B;  4J7F A;  2EYQ A;  2P84 A;  4JZ3 A;  1AWX A;  1H3Z A;  2XID A;  3EH2 A;  3HRT A;  3MEU A;  3VRY A;  1X2K A;  1M8V A;  4GY5 A;  4M7D F;  2DO3 A;  2JVV A;  1VQ8 A;  2NUP A;  2YRV A;  1VQ4 A;  4BAC A;  2VXF A;  4M7A E;  2DIG A;  1VQ9 T;  3SWN A;  3I55 T;  3NTH A;  1WGS A;  1XOV A;  5GAM h;  1EZZ B;  3VKI A;  1RUW A;  4FU6 A;  3M0U A;  2PNI A;  2E64 A;  2VUB A;  3CBO A;  1WX6 A;  2DIQ A;  4EMK A;  2F2V A;  2QAZ A;  4RTZ A;  4C92 D;  1ZHI A;  2MWP A;  1M90 R;  1TG0 A;  4PJN A;  2WAC A;  1FWZ A;  3MP8 A;  4NS5 A;  1X6B A;  3H9N A;  1UGV A;  1AHJ B;  2QQB A;  2YUQ A;  4FW1 A;  3OSS C;  1UG1 A;  1VQ9 Q;  3I55 Q;  3HFO A;  3F70 A;  3VS2 A;  1JU5 C;  1YNZ A;  1PSE A;  2V8K A;  1RAI B;  2JTM A;  2IG0 A;  3CD6 A;  3OA6 A;  1F1B B;  3E19 A;  5FWC A;  2R5A A;  2K2V A;  4D8K A;  1JB0 E;  2K5F A;  2KQW A;  3A8G B;  1YJW A;  4RTX A;  1GRI A;  1H8K A;  2VYT A;  2HEQ A;  3MJX A;  4PK4 A;  1YWO A;  1YJW Q;  2C06 A;  2F5K A;  4E7J A;  1O75 A;  2JT4 A;  2M0O A;  2YLC A;  1IHW A;  1X43 A;  1OI1 A;  3VS0 A;  4RTY A;  1M1K U;  1GCP A;  2OAU A;  1Q81 C;  4M77 D;  3S6W A;  1MMN A;  4MZT A;  4OF1 A;  3NTI A;  2FO0 A;  3G4S T;  2CS7 A;  4EMG A;  1VQP A;  3PFS A;  1YWP A;  2FB7 A;  3H8Z A;  3M59 A;  1Z9Z A;  2YUO A;  4HCC A;  4OMQ A;  1VQO Q;  1JJ2 P;  1YJW T;  2GGR A;  5LJ3 j;  1RLQ C;  4IIM A;  3RKX A;  2EYW A;  2LP5 A;  3G7Z A;  4M77 G;  5GAN j;  2HD0 A;  1RAH B;  2DAQ A;  2J6O A;  2EQI A;  2ZAE A;  3CC7 A;  2DIL A;  2H3E B;  5GAO m;  2ZPB B;  4FT2 A;  3M0R A;  4NL3 A;  3MCA B;  3CCJ T;  2K79 A;  3JCM W;  4M7D E;  2K3B A;  5GAN e;  4FL6 A;  1YHQ Q;  3CBM A;  1ABO A;  5LL6 S;  2ROT A;  5FU6 C;  1Q7Y C;  3JCM d;  3L2V A;  1Q95 G;  3RER A;  3EAE A;  4RTU A;  2MF2 A;  4MDW A;  2E3I A;  2HKQ B;  2GBQ A;  4OVA A;  3CCQ Q;  2DXU A;  1VQ6 T;  4BY6 B;  1M2V B;  5KCH A;  3I56 Q;  4L59 A;  1K9M U;  2QTX A;  1K73 C;  5FU7 B;  2KNB B;  4PJM A;  4J9D A;  2JMC A;  3PE0 A;  4OGC A;  5KYW B;  1XJW B;  4OP0 A;  1G3W A;  5GAM g;  2HAX A;  1MMD A;  4KGZ B;  1LVK A;  2CZ6 B;  1JRI A;  1RI9 A;  2DD5 A;  5HK3 A;  2YRC A;  2RD1 A;  3RR6 A;  5GAO r;  4TVR A;  4O6J A;  2HQE A;  1SRM A;  2B8A A;  1VQM A;  4A4F A;  2AKK A;  4FIB A;  4XK8 E;  3SFM A;  3C95 A;  1X2Q A;  1VQM Q;  2CYZ B;  2PTK A;  1TXQ A;  3CD6 Q;  2ED1 A;  4J9G A;  2BKD N;  3PIP A;  4JLI A;  2PVD B;  3OYF A;  2EIF A;  2X3X D;  2RQW A;  4HT8 A;  2DFU A;  4C8Q G;  1FMV A;  3MEW A;  4E7Z A;  2OTL T;  1KQS P;  2E6N A;  1TUD A;  4R0K A;  3A8H B;  2X4X A;  5KCO A;  2E4H A;  5CK9 A;  3EGX A;  3LWH A;  4ZGE B;  3G4S Q;  4PJO C;  1WIE A;  2HL5 C;  4KGX B;  3DLL A;  2EQJ A;  2DKG A;  3G71 T;  3CQT A;  1RI0 A;  4XQ3 A;  4PJO G;  3RKY A;  4KUL A;  2XHC A;  3QG1 A;  3UT1 A;  1D1A A;  2DMO A;  2DYI A;  2LT4 A;  2Y4Y A;  3QBY A;  5KE3 A;  2RQU A;  5GAM j;  3FC3 A;  4C92 B;  1ZLM A;  4RKU E;  1K9A A;  4J9I A;  2QK0 A;  4QKU A;  3AHU A;  3R6O A;  3GOX A;  1QP2 A;  4C5I A;  3OQ5 A;  4C5H A;  5KYU B;  2RB6 A;  2ECZ A;  2RI5 A;  5CIU A;  4M75 B;  4C8Q A;  1U8R A;  2JMA A;  3H0F A;  1WQ7 A;  1TS9 A;  1Q86 R;  2A37 A;  5M9O A;  1M3C A;  3JCM P;  3CC2 A;  2D8J A;  1GFD A;  5HK0 A;  4ORZ A;  1JJ2 A;  3S3O A;  4ESR A;  3EGX B;  3OW2 P;  2F69 A;  2M02 A;  3J80 E;  3GBQ A;  1U3O A;  3P8D A;  2CGH A;  1IZ6 A;  3FDR A;  1Q82 R;  3CBP A;  3A1P A;  4ZN1 A;  2A7Y A;  1ZBJ A;  2BZY A;  4M78 G;  2CT4 A;  3M5A A;  1BCO A;  3UA7 A;  3V7R A;  1PD1 A;  2JS2 A;  4J5Y A;  4C8Q C;  2EJF A;  1PHT A;  2EQK A;  2P4R A;  1NLO C;  3OYN A;  3OYJ A;  3PVL A;  4C0G A;  1IGU A;  1WJQ A;  4QQG A;  4M75 G;  3CXC P;  4XTU A;  4JJN K;  3RMQ A;  3M4G A;  1SSF A;  3TVT A;  4KH0 B;  3L2R A;  1JJ2 S;  3IQL A;  1KK7 A;  4FYV B;  5CKB A;  4QQD A;  2CP0 A;  2HL3 A;  4PFO A;  1QKX A;  3HHT B;  4XU2 A;  3G1J A;  2CH4 W;  2QG9 B;  4F7U B;  4X9C A;  3OYA A;  2PVO B;  1VQ7 Q;  1UE9 A;  1OX8 A;  1SKU B;  5EC7 A;  4ZGD B;  2MK5 A;  4J6X A;  1VQ5 T;  4BD3 A;  3V8J A;  3JCM c;  2PVG B;  4RG2 A;  2CP5 A;  1WHG A;  1X01 A;  4WF2 A;  3NGP A;  4HKE A;  5I21 A;  2P0K A;  4PLL A;  3M0S A;  4OB0 B;  2FPE A;  2OTL Q;  3OYD A;  3M58 A;  2GFA A;  3OB9 A;  5CVI A;  2LJ1 A;  4AFQ C;  2GNC A;  2RO0 A;  1NPP A;  3M56 A;  1YIT A;  3I9Q A;  4RG8 A;  2E70 A;  1YIT Q;  5IT9 E;  1VQ8 T;  5CO7 A;  4LDW A;  2JOY A;  4OGE A;  3CEY A;  1UHF A;  1BB9 A;  5KYY A;  3CCJ A;  4JJD A;  4KUD K;  1WJR A;  2O88 A;  1SSH A;  1R0C B;  2D0Q B;  1VYU A;  2F2X A;  2LX9 A;  1QVF P;  2DLP A;  2ZPG B;  5LJ3 g;  3Q1J A;  2KE9 A;  1WQW A;  1ZUK A;  3LGF A;  4PLI A;  1SHF A;  2KY9 A;  1OZ2 A;  2HSE B;  2KRN A;  9ATC B;  3MHX A;  2X4W A;  4XU0 A;  4KBM B;  3QUI A;  1BIA A;  2LQW A;  4C5E A;  2DL5 A;  3JRZ A;  4DEY A;  1YCS B;  4Y28 E;  2X9H A;  1QWF A;  1K0X A;  1QCF A;  2CP6 A;  1HYO A;  2MIO A;  4RTT A;  2L3R A;  3GP8 A;  2P0Q A;  1N5Z A;  3TCJ A;  1VQN A;  2NUP B;  3VV0 A;  4HCK A;  4C0F A;  2FPF A;  4F17 A;  3OMG A;  4RCC A;  2XDB A;  2DRK A;  1TWB A;  4CRI A;  1M5Q 1;  1VIF A;  5CQY A;  2K3X A;  2VKN A;  1RL2 A;  1NG2 A;  1Y96 A;  4OMP A;  3MPU B;  2YUN A;  4CC2 A;  2K6D A;  3SB2 A;  3M55 A;  2LTO A;  4XTV A;  3JCM Q;  5GAN 2;  2RMO A;  4FYX B;  1VIE A;  2NLU A;  1AWO A;  5GAN 6;  1LPL A;  3V7S A;  1D3B A;  5GAN f;  2RK2 A;  3CCR T;  2AIR B;  3VS5 A;  1VQO T;  2LVM A;  2FPD A;  1Y07 A;  3RMS A;  2C0T A;  4OMN A;  3QDF A;  1BI0 A;  3PT9 A;  2AHJ B;  2YHT A;  3TSZ A;  4X9D A;  1N8R U;  4X1V A;  2NWM A;  1K8A R;  1KHC A;  1NM7 A;  5KYX B;  3A8O B;  5IN1 A;  3CCJ Q;  3MO8 A;  4E6R A;  3EHQ A;  2FG0 A;  2ZCF B;  4C92 A;  2HNI A;  2DM1 A;  1B34 A;  1U1S A;  5C0M A;  1SPK A;  3CD6 T;  1BKB A;  2GTJ A;  2DER A;  4ELZ C;  2XDD A;  4FCY A;  3GLX A;  3L2W A;  3JCM J;  4M77 A;  1HJD A;  4J8O A;  3UF4 A;  4KRT A;  3HFN A;  1YIJ Q;  1VQP Q;  2E41 A;  4LNP A;  1YJ9 A;  3ULR B;  4BE2 A;  2HQX A;  3OYG A;  3RKW A;  4PKC C;  1Q7Y U;  2QDL A;  1RAF B;  2DJQ A;  5HCK A;  6AT1 B;  3RDV A;  1I1J A;  2LX7 A;  3KBG A;  1M90 C;  4AMC A;  1NJI R;  4UC4 A;  3E9G A;  4C0Z A;  4IKF A;  4M7A G;  1QCN A;  1M27 C;  4LE9 A;  2W10 A;  1PC0 A;  3BE3 A;  4E7L A;  1ZUY A;  2GF7 A;  1K9M C;  1V1C A;  2EWN A;  2ZPI B;  1W6X A;  4BUG A;  3JCM f;  1GBQ A;  4LD6 A;  5FRO A;  4AG1 C;  4EPC A;  5GAN g;  5FW9 A;  3RBB B;  3HSB A;  3OS0 A;  2K3Y A;  4A53 A;  4LDX A;  2EVR A;  4J9F A;  3M0T A;  1WXU A;  1ARK A;  1IO6 A;  2QGF B;  1FXX A;  5GJV B;  1NZ9 A;  3HKS A;  2XDP A;  4N4G A;  2AK5 A;  3CMA Q;  2L5Q A;  1HD3 A;  2QXF A;  4J9B A;  4JZ4 A;  4C92 C;  4BE1 A;  1B7T A;  4LDY A;  3A8L B;  1TUG B;  2R58 A;  3V8L A;  4A4H A;  2QA4 Q;  3OSV A;  5CKF A;  3RES A;  1KD1 C;  2MOX A;  5GMK i;  1ZBX A;  5DLO A;  1UGS B;  2GTO A;  2VC8 A;  5LJ3 e;  4N0A C;  1GL5 A;  3G71 Q;  2D8H A;  2OTJ A;  1VQN T;  2EGA A;  2E6Z A;  3NHN A;  5I2S A;  3I56 T;  2L89 A;  4CC4 B;  2ATC B;  1PWT A;  4HVW A;  1GFC A;  2AZV A;  4KUI A;  2DZC A;  1OU9 A;  4GLM A;  4PFP A;  1YIJ A;  5GAN 4;  3X26 B;  4C92 F;  2DE0 X;  2QEX A;  3CCM Q;  1WI7 A;  1OX9 A;  2RQR A;  3WVE B;  1E7O A;  1V76 A;  3EFR A;  3GIB A;  2DYB A;  3L2Q A;  1UTI A;  3EFO A;  1HSQ A;  1QMC A;  1MMA A;  3CCR A;  3QZ9 B;  1OUL A;  3LGL A;  2KAF A;  2I2L A;  2L3Q A;  5LJ5 h;  4JRI A;  2HKN A;  3M9Q A;  1BI1 A;  3EGD B;  5GAO n;  2E10 A;  5KE2 A;  2KK4 A;  1YJ9 Q;  2KRS A;  2LNH B;  2COY A;  4IUR A;  3CME A;  4ANJ A;  2NUZ A;  2YXY A;  1OQK A;  3OYH A;  3J7A F;  5GAN 8;  1VQ6 Q;  4LUD A;  3JAM E;  4KGV B;  4PJO D;  1D0Y A;  1D09 B;  3QWX X;  1YJ9 T;  2FZG B;  1KJW A;  4N4H A;  1YIJ T;  3NFC A;  3EGU A;  2MMP A;  2FVU A;  2Y90 A;  1Q82 U;  4N4I A;  2KYB A;  1KD1 R;  2VV5 A;  4Z89 A;  2KDS A;  1PRL C;  3VJP A;  3LX7 A;  3CPW A;  4J9E A;  2ZPH B;  2KGT A;  1MV3 A;  3INZ A;  2CZ1 B;  5L8R E;  3OW2 A;  2EKO A;  4FYY B;  4C0D C;  1Y71 A;  1H64 1;  1ZSZ C;  1UB4 A;  3CCS T;  1X6O A;  3BW1 A;  2J7I A;  1KIK A;  3CCU A;  4BI8 B;  1XNI A;  1I0C A;  1A0N B;  2ED0 A;  2KVQ G;  3D7S B;  2FRY A;  1Q86 U;  4RUG A;  4J83 A;  1G3T A;  1WHL A;  1M30 A;  2VAS A;  4IUV A;  2G6F X;  1G3Y A;  2E3H A;  2A36 A;  1OZ3 A;  3PVQ A;  5GAO l;  3MET A;  2EAY A;  1WZO A;  1W2B S;  5D6Y A;  5FRM A;  3A98 A;  4BI4 A;  2XG8 D;  2LMJ A;  2OI3 A;  1T3L A;  1N8R R;  3CC2 T;  2RJE A;  1G2B A;  3HPW A;  2DL4 A;  5FLX E;  2KEA A;  2A28 A;  1T3S A;  5J3B A;  3CMA T;  1HXD A;  3REA B;  2LQ8 A;  1I07 A;  1UGQ B;  4JPB W;  4IUQ A;  3EFS A;  4PL6 A;  1VQ8 Q;  2DEU A;  4J9C A;  4M78 C;  2CP2 A;  3SWN B;  4Y92 A;  3CCL Q;  3QJ6 A;  3NTK A;  2DRM A;  3QZ5 B;  4EDU A;  4IUU A;  4WTO B;  2RHU A;  3LLR A;  5IAY A;  1K73 U;  4C5G A;  4CC7 A;  2JJ9 A;  2C0I A;  1PRM C;  4JRQ A;  3VUB A;  1NE8 A;  1J3T A;  1W2B A;  1NJI C;  3N5B B;  3X28 B;  4J7I A;  3CCQ A;  2X51 A;  4Y91 A;  3QPH A;  4XTZ A;  3VYG A;  3SHW A;  1KC8 C;  2O31 A;  2E5Q A;  3PMI A;  1Q86 C;  3JCM g;  4EIK A;  3CC4 Q;  2GFU A;  5EG2 A;  2RNA A;  2LQN A;  2RQT A;  8ATC B;  2X35 A;  1U5S A;  3R6N A;  2HMA A;  1ZQ1 A;  3JV3 A;  3A5Z B;  4M7D C;  1AVZ C;  1ZX6 A;  1QVG P;  4R55 A;  1JXO A;  4C0D B;  3THK A;  4D8D A;  2A3L A;  2JTF A;  5D7U A;  1IHV A;  1RAE B;  4EMH A;  3CCE Q;  1M1K C;  3UDC A;  2DJZ A;  2DXT A;  1H92 A;  3CCV A;  4VUB A;  3URG A;  1PD0 A;  2JM9 A;  3JB9 J;  1K8A C;  3H6Z A;  2RHY A;  1UJY A;  3NMZ C;  1KG1 A;  2P4T A;  2MYS A;  1AWW A;  4F7U E;  1B34 B;  2RI3 A;  4FM4 B;  2JM8 A;  4M7D D;  3C12 A;  1D0X A;  2O01 E;  2EGC A;  5FU6 B;  4LDU A;  2KSS A;  3EG0 A;  1QCO A;  3FB9 A;  3CC4 A;  2DEQ A;  4JLG A;  1BIB A;  1M8M A;  5KYY B;  1YHQ A;  2KYM A;  1SF9 A;  4MDX A;  2O9V A;  1R0B G;  2DTO A;  3REB B;  3MKD A;  1UEC A;  2AT1 B;  2YT6 A;  4F7U A;  4RCB A;  2DPP B;  1FYN A;  2DL7 A;  2LJ3 A;  1MNE A;  3I55 A;  5IHK A;  1R8O B;  4M75 C;  4RMO A;  4BY6 C;  4BE0 A;  5LJ5 d;  1JBM A;  5GMK j;  2PQW A;  2DBK A;  4PJJ A;  3UWN A;  3OYI A;  4M78 D;  2EYY A;  1GBR A;  4K11 A;  4M77 F;  3UAT A;  2BIV A;  2CUB A;  3EG9 A;  4JS5 A;  3ZFJ A;  2K4Y A;  3T9N A;  3I5R A;  2V8J A;  3VS1 A;  4BDZ A;  2WSF E;  4DBQ A;  3G6E A;  2ZPE B;  4DQ2 A;  1WPY A;  4EMK B;  1M1G A;  3OS1 A;  1AOJ A;  5AT1 B;  2ENM A;  4V2S A;  1OYX A;  4CC3 A;  2J05 A;  1WLP B;  3P8H A;  4F14 A;  3MEA A;  4M7A C;  1QP3 A;  2RI2 A;  1IRE B;  3CME T;  3OYM A;  1VQL Q;  4J6Y A;  5GMK l;  1VQ7 T;  1YI2 T;  1T0H A;  4NL2 A;  2K5L A;  4P5N A;  3FJP A;  1C0M A;  2JXB A;  3VS4 A;  1BYM A;  2DZ9 A;  1EIF A;  2GCX A;  2FEI A;  4HCB A;  1BCM A;  2QQA A;  2XKO C;  3HRU A;  4DOV A;  1G3S A;  3L1A A;  3P8B B;  1AT1 B;  4Q5W A;  4QT7 A;  5LJ5 f;  5LJ5 e;  1ZA2 B;  2MI6 A;  4QVD A;  3PMT A;  2QAS A;  3FLG A;  1VUB A;  3EFO B;  1M1F A;  4DA4 A;  1P92 A;  2HQH A;  2LT1 A;  4BDY A;  2OTJ T;  2RJC A;  1CKB A;  3LH5 A;  2KT1 A;  3CCV Q;  3ZL7 C;  2FZK B;  3OYK A;  2E12 A;  2CSI A;  5A0L A;  1KC8 U;  4LDV A;  1VQL T;  1U06 A;  1I5L A;  1G5V A;  2GQV A;  5CKE A;  4C8Q D;  2WSE E;  1VQ4 Q;  5FU7 C;  1TOV A;  3M54 A;  2CUD A;  2GQI A;  1RAG B;  1M2O A;  2XD0 A;  1NEG A;  1PM3 A;  1WXB A;  1WHJ A;  1BBZ A;  1SG5 A;  3CCV T;  1WFW A;  2KRO A;  2V8I A;  1X69 A;  2M51 A;  1OV3 A;  4HVV A;  3RIR A;  3KFV A;  1WHM A;  2VB6 A;  4PJO A;  1WYX A;  1QVG A;  3OMC A;  1AWJ A;  2DF6 A;  2R5M A;  1U1T A;  1RLP C;  4D6W A;  3CXC S;  2QA4 A;  3CCS Q;  5GMK e;  2DET A;  2JUF A;  3E2U A;  3KUF A;  1UHC A;  2VGM A;  3DB3 A;  3FRN A;  3U23 A;  2K57 A;  3HTR A;  2LNV A;  1LOJ A;  1V29 B;  4HA8 A;  1VQL A;  2NUT B;  3CCL A;  1Q81 R;  4E7K A;  2LQK A;  1Q7Y R;  2YWW A;  3CC2 Q;  1FMW A;  1NYG A;  2QDY B;  4GLK A;  2JTE A;  1BK2 A;  1TH7 A;  2YSQ A;  3QYG B;  2A0F B;  2E1H A;  1HK9 A;  1KQ2 A;  4FT4 A;  3JCM h;  1XTD A;  5GAN d;  1G8X A;  3L2Z A;  4WCI A;  3EH1 A;  1WA7 A;  2L3S A;  1IRX A;  2QA4 T;  2B86 A;  1K4U S;  4XAX B;  2DTH A;  4XU3 A;  1AZG B;  3HL8 A;  4ZTF A;  1GCQ A;  3JCM b;  1YP5 A;  4RTW A;  2BE9 B;  1IB8 A;  4JRK A;  1ZA1 B;  1QVG S;  5FRN A;  3CCL T;  4M78 F;  3CXC A;  1OPK A;  1UFF A;  2RH2 A;  1I4K 1;  3FIF A;  1I81 A;  4O5V A;  1LCK A;  2CZ7 B;  3E9F A;  3ZBD A;  3VUZ A;  5CKH A;  2CDT A;  3TRE A;  2FL7 A;  3I56 A;  1WDX A;  3JB9 I;  1H3H A;  5GAM d;  1YJN A;  1NYF A;  2VXE A;  2G3R A;  4OMM A;  4B6M A;  2HSP A;  1E6G A;  5GMK h;  2E65 A;  4AT1 B;  1YJN Q;  1YI2 Q;  5CR2 A;  4M75 A;  2M16 A;  2RJD A;  1VQ5 Q;  3GNF B;  2V1Q A;  2L2P A;  4M78 B;  2RHZ A;  2D9T A;  5LJ3 d;  5HKC A;  3JCM X;  2J06 A;  4KT0 E;  5DM7 R;  1W70 A;  3QHS A;  2EW3 A;  4IUP A;  3C94 A;  1UJ0 A;  3JSC A;  1I8F A;  2O2O A;  3CC4 T;  1R77 A;  1BI3 A;  1VYV A;  2QGG A;  1YJN T;  3VRZ A;  2KT8 A;  4M77 B;  1B07 A;  5GAN 5;  2KRM A;  2CH4 A;  3C0C A;  1Y96 B;  1X75 C;  2RQV A;  2QYZ A;  2YUP A;  2YLB A;  1SHG A;  3HP9 A;  1UGR B;  1N27 A;  1ZSG A;  4OML A;  2L0A A;  5DY9 A;  1W1F A;  4DBF A;  1KQ1 A;  2DNU A;  1MMG A;  2RPN A;  3QSU A;  2F1L A;  1KFZ A;  1D0Z A;  2SEM A;  3QO3 A;  4JS4 A;  1D1B A;  3EGD A;  1O9S A;  3OBY A;  4JUV A;  3H41 A;  3WVD B;  3CCS A;  2CP3 A;  3GPL A;  2KMT A;  1VQK T;  2COW A;  2M1H A;  3MEV A;  3CCU Q;  3JB9 D;  4C8Q F;  2LJ0 A;  2HZY A;  2FHD A;  2COZ A;  3EG1 A;  3JCM e;  2F2W A;  3M57 A;  5IXF A;  3UPU A;  2RJF A;  3DB4 A;  2D6F A;  1LJO A;  5A2Q E;  3EG3 A;  1CSK A;  3ME9 A;  3ER0 A;  5FWB A;  1UUE A;  1YBY A;  4DBR A;  1NPR A;  5GAN 3;  3OBW A;  2ESW A;  2F5T X;  4MML A;  4DBH A;  3V8K A;  1WHK A;  2XMF A;  1E6H A;  4E7S A;  5KYW A;  5LJ3 h;  4A4E A;  4M77 E;  2P0P A;  1VQK A;  1UDL A;  3OY9 A;  2KI7 A;  5KYU A;  4M78 E;  2VWF A;  3J81 E;  5LJ5 g;  1PG5 B;  1K73 R;  3SWN C;  1VQ9 A;  2IPO B;  3CCE A;  4ZNX A;  2K9G A;  1D1C A;  2X4Y A;  2MAM A;  4HT9 A;  4F7U F;  4M7D B;  3JB9 G;  2IIM A;  2X3W D;  3GNG A;  4IIO A;  2OX7 A;  4II1 A;  2X4J A;  2JNG A;  4FSX A;  4A54 A;  4RTV A;  2IVW A;  3M53 A;  4JJB A;  1K8A U;  2ZZD A;  2M9U A;  4IUT A;  1N8R C;  3SDZ A;  4M7A F;  2QEX Q;  3CCM A;  3QXE B;  3CPW P;  1TTH B;  3PNW C;  2BTT A;  3WXM B;  3O8V A;  2LRQ A;  5GAO q;  2DX1 A;  2BUD A;  3RUX A;  3X24 B;  4HXJ A;  3BFM A;  5D6X A;  1X27 A;  2DTI A;  5GAO p;  3OS5 A;  2ROL A;  4DEX A;  1PNJ A;  4XTX A;  4QVC A;  4PJO E;  3QYH B;  5I2M A;  3FEO A;  1MND A;  4LN2 A;  2ZPF B;  1S72 A;  2DVE A;  2CZ0 B;  3VS7 A;  4PJL A;  2EFI A;  4L5G A;  4GBQ A;  4F04 B;  3OS2 A;  1MV0 B;  3GF5 A;  3M0Q A;  3E1S A;  1N9S A;  4E2F B;  3LWI A;  2O4X B;  4C8Q E;  2H3J A;  4X34 A;  2OTL A;  2QTV A;  3C4S A;  4A4K A;  5GAN h;  2EJ9 A;  4OB3 B;  3VU3 C;  4R56 A;  1T0J A;  1C1A A;  2MPX C;  4M75 D;  4YTL A;  4PJO B;  3QKJ A;  2DL3 A;  4QW2 A;  4M78 A;  3BY7 A;  2PUO B;  3G71 A;  3M0P A;  5CAI A;  5L23 A;  2LDM A;  4E7I A;  2XIC A;  2XU8 A;  1QKW A;  3LH0 A;  4M77 C;  3OYB A;  4PNO A;  1VQ7 A;  2DD4 A;  1VYT A;  1CKA A;  1MUZ A;  3EHR A;  1QQJ A;  2EBP A;  5CCA A;  2EYZ A;  1RAD B;  3OYL A;  1QLY A;  1YN8 A;  4LUE A;  1G83 A;  2QQ9 A;  2Z0W A;  2DXB A;  2Y4X A;  2D0N A;  1RAA B;  1RAB B;  1YHQ T;  1Q82 C;  2ZGW A;  2DBM A;  1KHI A;  1W2B P;  4E47 A;  3O5Z A;  4BI3 A;  1NJI U;  1W4S A;  1YCY A;  3I5S A;  2BZX A;  3AT1 B;  2FRW A;  2DK3 A;  4MZM A;  4C8Q B;  1RAC B;  2L8D A;  1M90 U;  3DKM A;  3NPF A;  4M7A D;  4KH1 B;  5IH2 A;  3EG2 A;  4M7D G;  1LNX A;  4B9X A;  1NLP C;  4HCZ A;  3UA6 A;  3MP6 A;  2BE7 D;  2C0O A;  4AG2 C;  3CME Q;  2JS0 A;  1S1N A;  1JXM A;  1EX4 A;  3S3M A;  1K0S A;  2EQU A;  3L2U A;  2RN8 A;  1WXT A;  2NUT A;  3CCQ T;  2D1X A;  2LZ6 B;  1X6G A;  4XTW A;  1ZUU A;  4MZP A;  1JEG A; 
#chains in the Genus database with same CATH homology
 2W0Z A;  2GBQ A;  1U06 A;  4AFS C;  2DVJ A;  2EVR A;  2JW4 A;  4J9F A;  3M0T A;  1WXU A;  1ARK A;  2CUD A;  2GQI A;  2KNB B;  2HCK A;  1BU1 A;  4J9D A;  2JMC A;  3PE0 A;  1IO6 A;  5I11 A;  1NEG A;  5GJV B;  1WXB A;  1M3B A;  1GCQ C;  2AK5 A;  1BBZ A;  1HD3 A;  1RI9 A;  2DL8 A;  4J9B A;  4JZ4 A;  1WFW A;  2KRO A;  2E5K A;  1X69 A;  2M51 A;  1OV3 A;  2V1R A;  4HVV A;  3TSW A;  3KFV A;  1FMK A;  1WYX A;  1SRM A;  1AWJ A;  5IXB A;  2AKK A;  2DF6 A;  2I0N A;  1X2Q A;  1RLP C;  2KBT A;  2MOX A;  3RNJ A;  2GTO A;  1M3A A;  2EKH A;  2PTK A;  2SRC A;  5IHI A;  2ED1 A;  1UHC A;  4J9G A;  1GL5 A;  2D8H A;  4A63 B;  2EGA A;  3NHN A;  3U23 A;  3I35 A;  4CC4 B;  2J6F A;  2X3X D;  1PWT A;  4HVW A;  2RQW A;  1GFC A;  2AZV A;  4GLM A;  1PKT A;  1NYG A;  1SRL A;  3H0H A;  2CSQ A;  1TUD A;  2DE0 X;  2JTE A;  1BK2 A;  1WI7 A;  2YSQ A;  4R0K A;  2RQR A;  1E7O A;  1JO8 A;  1WIE A;  2DYB A;  2CT3 A;  1UTI A;  4WCI A;  1WA7 A;  2EYX A;  1HSQ A;  2L3S A;  3CQT A;  2B86 A;  1K4U S;  2EGE A;  1B3Q A;  2AKL A;  1AZG B;  1GCQ A;  1YP5 A;  2L3Q A;  4RTW A;  1PKS A;  2DMO A;  2MCN A;  4AFZ C;  2RQU A;  3QWY A;  3VS6 A;  1ZLM A;  1Z9Q A;  1K9A A;  2CRE A;  2KRS A;  4J9I A;  1OPK A;  4JJC A;  1UFF A;  2LNH B;  1LCK A;  3SEM A;  2YDL A;  2ECZ A;  2NUZ A;  2CDT A;  1WDX A;  1H3H A;  1NYF A;  4LUD A;  4F16 A;  2JMA A;  1SEM A;  4OMM A;  3H0F A;  3QWX X;  2HSP A;  2L3P A;  2A37 A;  1E6G A;  2AZS A;  1M3C A;  1KJW A;  2D8J A;  4HVU A;  1GFD A;  4ORZ A;  3EGU A;  2KXC A;  4ESR A;  2A08 A;  2KYB A;  2V1Q A;  2L2P A;  4Z89 A;  1PRL C;  2KR3 A;  4J9E A;  2J06 A;  2KGT A;  1MV3 A;  1W70 A;  3GBQ A;  1U3O A;  2EW3 A;  1UJ0 A;  2J7I A;  2O2O A;  1KIK A;  5ECA A;  4Z8A A;  1ZBJ A;  2BZY A;  1VYV A;  2CT4 A;  1I0C A;  1A0N B;  1QWE A;  3VRZ A;  2ED0 A;  1VA7 A;  2KT8 A;  2M0Y A;  1B07 A;  2FRY A;  2KRM A;  3UA7 A;  2CH4 A;  4RUG A;  3C0C A;  1OEB A;  2JS2 A;  1KSW A;  2RQV A;  2YUP A;  1M30 A;  1PHT A;  1SHG A;  2P4R A;  1ZSG A;  2OJ2 A;  4OML A;  2L0A A;  1AEY A;  1W1F A;  2G6F X;  2DNU A;  1NLO C;  3PVL A;  2A36 A;  2RPN A;  3PVQ A;  1Y0M A;  1KFZ A;  2SEM A;  2ABL A;  3VS3 A;  3A98 A;  2K2M A;  2LMJ A;  1AD5 A;  2OI3 A;  1T3L A;  3TVT A;  3H41 A;  1G2B A;  3IQL A;  2DL4 A;  2HBW A;  2KEA A;  1K76 A;  5IHN A;  1NEB A;  4OMO A;  2A28 A;  1JQQ A;  2LJ0 A;  1T3S A;  3EG1 A;  5I22 A;  1QKX A;  3REA B;  2F2W A;  4J9H A;  5IXF A;  1I07 A;  4JPB W;  2CH4 W;  3EG3 A;  1UE9 A;  1CSK A;  2EPD A;  4J9C A;  5EC7 A;  1OPL A;  4M4Z A;  3FJ5 A;  5FWB A;  1Y57 A;  1UUE A;  2RF0 A;  1AZE A;  2ESW A;  4Y92 A;  3H0I A;  2XMF A;  1E6H A;  2O9S A;  2HDA A;  2DRM A;  3NGP A;  2OAW A;  1TUC A;  4AFU C;  1UDL A;  3M0S A;  4CC7 A;  2C0I A;  2BZ8 A;  2VWF A;  2FPE A;  1PRM C;  2VVK A;  1J3T A;  2K7A A;  1OOT A;  4ZNX A;  2K9G A;  2PZ1 A;  3SHW A;  2LJ1 A;  4AFQ C;  2O31 A;  2GNC A;  3I9Q A;  4FSS A;  4EIK A;  2RNA A;  2LCS A;  1K1Z A;  2IIM A;  1ABQ A;  2LQN A;  2RQT A;  2X3W D;  4IIO A;  1U5S A;  1UHF A;  1BB9 A;  3R6N A;  2KXD A;  3JV3 A;  4JJD A;  2H8H A;  1AVZ C;  1ZX6 A;  4RTV A;  1SSH A;  2O88 A;  2J6K A;  1VYU A;  2F2X A;  4JJB A;  1JXO A;  2DLP A;  4Z88 A;  3THK A;  4D8D A;  2KE9 A;  1EFN A;  1ZUK A;  2DA9 A;  1SHF A;  5GJW B;  2KRN A;  4JZ3 A;  1H92 A;  1AWX A;  2BTT A;  2DX1 A;  2JM9 A;  3VRY A;  1X2K A;  4HXJ A;  2LQW A;  1UJY A;  2DL5 A;  1X27 A;  3NMZ C;  4DEY A;  1YCS B;  1AWW A;  2ROL A;  4DEX A;  1PNJ A;  1QWF A;  1K0X A;  1QCF A;  2JM8 A;  2MIO A;  4RTT A;  1XOV A;  4LN2 A;  1N5Z A;  2EGC A;  1RUW A;  3EG0 A;  3M0U A;  2PNI A;  4HCK A;  3VS7 A;  2FPF A;  4F17 A;  1WX6 A;  1M8M A;  2F2V A;  2KYM A;  4GBQ A;  2DRK A;  4RTZ A;  1MV0 B;  3M0Q A;  2O9V A;  1TG0 A;  2VKN A;  1X6B A;  1UGV A;  1NG2 A;  4OMP A;  2YUN A;  3REB B;  1UEC A;  2K6D A;  2YUQ A;  4CC2 A;  2YT6 A;  1UG1 A;  1FYN A;  2DL7 A;  1T0J A;  3VS2 A;  2LJ3 A;  1JU5 C;  2RMO A;  1YNZ A;  2DL3 A;  1AWO A;  5IHK A;  3M0P A;  3VS5 A;  5L23 A;  2FPD A;  1QKW A;  5FWC A;  2DBK A;  2C0T A;  4OMN A;  2EYY A;  4D8K A;  1GBR A;  4K11 A;  1VYT A;  1CKA A;  3UAT A;  2CUB A;  1GRI A;  1H8K A;  1MUZ A;  3EHR A;  4RTX A;  2EBP A;  2HEQ A;  2EYZ A;  3I5R A;  3TSZ A;  3VS1 A;  1YWO A;  1QLY A;  4X1V A;  2JT4 A;  2NWM A;  1YN8 A;  4LUE A;  1G83 A;  1NM7 A;  1X43 A;  3VS0 A;  4RTY A;  4E6R A;  3EHQ A;  2FG0 A;  1GCP A;  2D0N A;  1AOJ A;  2ENM A;  2DM1 A;  2DBM A;  1SPK A;  4CC3 A;  2FO0 A;  2J05 A;  2GTJ A;  1WLP B;  3O5Z A;  4F14 A;  1YWP A;  3I5S A;  2BZX A;  2FRW A;  1Z9Z A;  2YUO A;  1HJD A;  3UF4 A;  4KRT A;  1T0H A;  3NPF A;  4OMQ A;  2GGR A;  4LNP A;  1RLQ C;  5IH2 A;  3EG2 A;  4IIM A;  2JXB A;  3VS4 A;  2EYW A;  2LP5 A;  3ULR B;  1NLP C;  3UA6 A;  2QDL A;  2DJQ A;  2FEI A;  5HCK A;  2C0O A;  4AG2 C;  2JS0 A;  1I1J A;  1S1N A;  2J6O A;  2EQI A;  2LX7 A;  1JXM A;  2DIL A;  1K0S A;  4QT7 A;  2RN8 A;  3M0R A;  1WXT A;  1M27 C;  2K79 A;  2D1X A;  4LE9 A;  2LZ6 B;  2W10 A;  1X6G A;  2K3B A;  1ZUY A;  1ABO A;  1ZUU A;  1V1C A;  2ROT A;  1W6X A;  1CKB A;  3LH5 A;  1GBQ A;  2KT1 A;  4AG1 C;  1JEG A;  4RTU A;  3ZL7 C;  5FW9 A;  2CSI A;  3RBB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...