2KGWA

Solution structure of the carboxy-terminal domain of ompatb, a pore forming protein from mycobacterium tuberculosis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
129
structure length
129
Chain Sequence
b'APPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein A
publication title Structure of the Mycobacterium tuberculosis OmpATb protein: A model of an oligomeric channel in the mycobacterial cell wall.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
total genus 38
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2kgwA00
3S06A 4G4VA 2LCAA 4G4XA 4R40B 2LBTA 4ZHVA 2L26A 5EB1B 3S0HA 4B62A 5EB0A 4G88A 4PWTA 3S03A 4ZHWA 3LDTA 2ZVYA 2W8BC 4G4ZA 2KGWA 3S02A 3WPWA 3OONA 1R1MA 2K1SA 2MQEA 3CYPB 3TD3A 2ZVZA 3TD5A 3CYQA 3S0WA 5EAZA 2N48A 4B5CA 3WPXA 4RHAA 3S0YA 3TD4A 4ERHA 2AIZP 2HQSC 4G4WA 2ZOVA 3IMPA 1OAPA 4G4YA 4ZHYB 2ZF8A 3KHNA
chains in the Genus database with same CATH superfamily
2HRUA 1T0KB 2P6YA 3QHDA 4NWOB 2LBTA 3WGKA 4EI9A 1W57A 3E20B 2OTJF 2B33A 3CCMF 5HY4A 3CYPB 4EI7A 1QVFF 4BT5A 1SA0A 4DRXA 4X3MA 1N8RH 4X1YA 5GINC 3OBWA 3S0YA 3NVKE 4O4IB 1H47A 3GYQA 1OAPA 2RHHA 3VIUA 2ALEA 1UI9A 3RYIB 5JH7A 3RYFA 1TVKA 3M84A 4ZOLA 5KMGB 4LNUA 3V3TA 1PF5A 5EIBD 4C4WC 1GX1A 4YJ3B 1YGYA 2Z1TA 4TUYA 3N2GA 3CCLF 3KE1A 4ZHQA 4C8EA 3C9RA 5IJ0B 3JATB 3E22A 5EYPA 2UYJA 2BO1A 1DT9A 3VOBA 5LP6C 4F6RA 2FGYA 5ITZA 2DYYA 3CCRF 4M8IA 5FLXM 2G9IA 4TV8A 4EI8A 1XBIA 1M90H 1H7MA 2VGNA 4O4HB 5EB0A 1XRGA 2Z1EA 3LWRC 5EZYA 4I4TA 3F6MA 5LXTB 4X20A 1YJWF 3P10A 3NMUC 2I6RA 3IR9A 3E1YA 1W42A 1FNKA 1JN1A 3Q8HA 4U39A 3N2KA 3CMAF 2KG4A 3HKEA 4BVRA 1W5AA 4ZI7A 5MN5A 3JAMM 1TUBA 2H6LA 1ONIA 2UYKA 4G4YA 3KHNA 1RLUA 1NMUB 3JALA 2AMTA 3JAWB 1FFXB 3IKEA 1COMA 1CK2A 2OTMA 4WBNA 5GANK 2HX0A 4EB6A 5CB4B 4O2BB 3LWOC 4IHJB 3OW2F 2UZHA 3N4ZA 3D54A 1W581 3CYQA 5GIOC 2WALA 4I55A 3HWUA 4X3LA 3HKCA 1VQ6F 1X7OA 5BMVB 5JQGB 4BW0B 1KD1H 3V4DA 1Z5VA 3B6NA 2Z1UA 4B45A 5EO3A 1VK3A 1JFFA 4HNAA 4TV9A 4G88A 3I55F 1U43A 5GONB 1W59A 3J81M 3P4EA 3LWVC 2RB9A 4YJ2A 1IV2A 2PMPA 2QI2A 1YJ9F 5HP7A 5A2QM 3O85A 5EWRA 2AIZP 2BTOA 3LMEA 1NJIH 2ZF8A 5HWEA 2OHWA 1VQ8F 1XV2A 4O4IA 4DXDA 2QA4F 1VQ5F 4O4JB 3OBYA 1DBFA 5FNVB 3N4YA 3K2XA 4LCKA 3QTYA 3HKDB 3VCZA 2ZVZA 3RYIA 5KMGA 1K8AH 3VYUC 3CC2F 3JARB 5EAZA 3CB2A 2HP0B 3MBMA 3VMFB 1RA4A 4C82A 4NUTA 1SZQA 1U3LA 4YJ3A 3U0OA 5IT9M 1YITF 1X25A 1X52A 5LP6B 3JATA 5EIBC 3ESJA 3M4SA 4C81A 4O4LB 3S0HA 1VQNF 4X1KB 1H48A 2QTPA 3LDTA 4BVQA 1W41A 2OZBA 3AGKA 2K1SA 3HKBB 3BYQA 4FFBB 2CW4A 3K0TA 3CC4F 1E7KA 4O4HA 1YI2F 3ZOPA 1VHAA 4X1IB 4TZZA 5LXTA 4BY9D 2ZOVA 3GHZA 3MQWA 1GZ0A 1FSZA 3KJJA 4IIJB 5J2UB 1SA0B 4BT4A 1JD1A 2UYPA 1T0AA 3CCSF 2HRYA 4G4ZA 3S02A 1W5FA 5J2TB 1W55A 3G4SF 1VQMF 2HS0A 3G6EF 3JAWA 1FFXA 5AVMA 5IJ9B 3LWPC 3SIVA 1GO0A 3EORA 3C9SA 3CMEF 2VAMA 3WPXA 3JAKB 2UYNB 4RHAA 4BT6A 5CB4A 3DDNA 4O2BA 2HS4A 2HQSC 5G4UC 1VQOF 4IHJA 2VAWA 4O2AB 1CN7A 5CA0B 5KX5B 3V7QA 3RYCB 1VQ4F 1Q86H 1OFUA 2HS3A 4ZHVA 3CD6F 2RHLA 5BMVA 4ZHWA 3CPWF 5JQGA 1FNJA 5JCOA 2W8BC 1W40A 3TD3A 1KC8H 1IPAA 3FFMA 4U3JB 5DCVA 2RHOA 5GONA 4ERHA 2PHNA 3CXCF 5LYJB 3PLAC 4X20B 2CHSA 2V9YA 3G71F 3M1XA 1Q7YH 3RYHB 1PXWA 5GAPK 3IKFA 1U40A 1VQLF 3R0PA 1QD9A 3UT5B 1VQKF 2VAPA 3VOAA 3CCEF 1W5BA 5HY0A 1TUBB 1R1MA 2H8CA 1S72F 2Q1YA 1K73H 3K14A 1ZWZA 1JY8A 4B5CA 3CC7F 5B8FA 3MDOA 4O4JA 3K12A 3T80A 5FNVA 5IYZB 3VI6A 4G4WA 2I6DA 1Q81H 3IMPA 3HKDA 2BTQB 1YHQF 3WXMB 3JCMM 5MN6A 3JARA 1ODEA 2CZWA 2HP0A 5CA1B 3FD5A 5EB1B 1YJNF 4B62A 3HKCB 3MCAB 2R751 1W2BF 3F0EA 3HTNA 5LA6B 5LP6A 3GTZA 3WGJA 3JVHA 4RQOA 1GO1A 5MN4A 3HJWC 4O4LA 3S0WA 1QVGF 3FBAA 4X1KA 3LWQC 2CHTA 1W3EX 2NMUA 2H8EA 1CLIA 3JASB 3C9TA 2VXYA 3HKBA 4I50B 5HP8A 1XHOA 4FFBA 2HP3A 2FC3A 2R6R1 3ERNA 4G4VA 3S06A 5IJ0A 5LOVB 4X1IA 1U3PA 3MCQA 3L7QA 2IQQA 3SIUA 5JVDB 5C8YB 2Z1FA 3VO8A 3P0ZA 3C9UA 4IIJA 5J2UA 2VGMA 3NVIB 4BT7A 1Z5WA 3VTIC 2CWJA 2IAFA 2KTUA 2HVYD 2JNBA 3ELCA 4B46A 5HY2A 3I56F 5J2TA 3LFOA 5IJ9A 3D00A 1Q8RA 4NQ3A 4BVSA 4C8IA 4DRXB 4R40B 3JAKA 2UYNA 4X1YB 3F0FA 1KQSF 2Z01A 3WJPA 4O2AA 3VYTC 1VQPF 1Q82H 5CA0A 5KX5A 3RYCA 2EWCA 4KWEA 4ZK7A 3NK7A 1YIJF 5JH7B 3RYFB 1TVKB 2YXZA 4ZOLB 3CCVF 4BT3A 2RHJA 3KJKA 4LNUB 3IEQA 2GZLA 3FPIA 2LBWA 1KNJA 4BVTA 1RQ7A 1JJ2F 2QEXF 3CCQF 3J7AR 4TUYB 3N2GB 4U3JA 4ZHQB 1KNKA 2GLZA 1YQNA 1SDSA 1RQ2A 2ZAUA 3E22B 3KIZA 4PWTA 5EYPB 4C8GA 5LYJA 3ZP7A 3S03A 3FD6A 5HY1A 4F6RB 3RYHA 5ITZB 2ZODA 2AIFA 3C8LA 3V7EA 4TV8B 5HXZA 1M1KH 2CVLA 4E6EA 3UT5A 3HAXD 3I3FA 3ZO8A 5EZYB 5FJ4C 4I4TB 3ON1A 3WJRA 1NQ3A 2BTUA 4ZHYB 3WGNA 1IV4A 1QU9A 3CCUF 3I7TA 2L26A 5IYZA 1K9MH 3N2KB 3WGLA 1VQ9F 3HKEB 3CPQA 4ZI7B 2OTLF 2IG8A 3TD5A 3F0GA 3NK6A 5CA1A 1VQ7F 1UFYA 3JALB 2N48A 3RA6A 2YYEA 1IV1A 1X7PA 3ZP4A 4WBNB 3QUWA 2LBXA 4EB6B 5LA6A 1RLGA 2DT4A 4BT2A 3RA5A 2CSLA 2GVIA 2LCAA 4G4XA 4I55B 2Q1XA 3D01A 1VH8A 3F0DA 3WGMA 3LYBA 3JASA 2ZVYA 3IEWA 5HXUA 3CCJF 5GIPC 4I50A 2KGWA 2F9ZC 3WPWA 1IV3A 3OONA 3VYSC 2MQEA 5LOVA 3DC2A 1J7HA 1W5EA 1JFFB 5JVDA 5C8YA 4HNAB 2KTVA 5JCOC 3TD4A 3PAFA 4TV9B 1QAHA 3CG6A 3WJQA 1VQVA 5G4VC 4XCQA 3J80M 3RE3A 4YJ2B
chains in the Genus database with same CATH topology
3S06A 4G4VA 2LCAA 4G4XA 4R40B 2LBTA 4ZHVA 2L26A 5EB1B 3S0HA 4B62A 5EB0A 4G88A 4PWTA 3S03A 4ZHWA 3LDTA 2ZVYA 2W8BC 4G4ZA 2KGWA 3S02A 3WPWA 3OONA 1R1MA 2K1SA 2MQEA 3CYPB 3TD3A 2ZVZA 3TD5A 3CYQA 3S0WA 5EAZA 2N48A 4B5CA 3WPXA 4RHAA 3S0YA 3TD4A 4ERHA 2AIZP 2HQSC 4G4WA 2ZOVA 3IMPA 1OAPA 4G4YA 4ZHYB 2ZF8A 3KHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S06 A;  4G4V A;  2LCA A;  4G4X A;  4R40 B;  2LBT A;  4ZHV A;  2L26 A;  5EB1 B;  3S0H A;  4B62 A;  5EB0 A;  4G88 A;  4PWT A;  3S03 A;  4ZHW A;  3LDT A;  2ZVY A;  2W8B C;  4G4Z A;  2KGW A;  3S02 A;  3WPW A;  3OON A;  1R1M A;  2K1S A;  2MQE A;  3CYP B;  3TD3 A;  2ZVZ A;  3TD5 A;  3CYQ A;  3S0W A;  5EAZ A;  2N48 A;  4B5C A;  3WPX A;  4RHA A;  3S0Y A;  3TD4 A;  4ERH A;  2AIZ P;  2HQS C;  4G4W A;  2ZOV A;  3IMP A;  1OAP A;  4G4Y A;  4ZHY B;  2ZF8 A;  3KHN A; 
#chains in the Genus database with same CATH topology
 2HRU A;  1T0K B;  2P6Y A;  3QHD A;  4NWO B;  2LBT A;  3WGK A;  4EI9 A;  1W57 A;  3E20 B;  2OTJ F;  2B33 A;  3CCM F;  5HY4 A;  3CYP B;  4EI7 A;  1QVF F;  4BT5 A;  1SA0 A;  4DRX A;  4X3M A;  1N8R H;  4X1Y A;  5GIN C;  3OBW A;  3S0Y A;  3NVK E;  4O4I B;  1H47 A;  3GYQ A;  1OAP A;  2RHH A;  3VIU A;  2ALE A;  1UI9 A;  3RYI B;  5JH7 A;  3RYF A;  1TVK A;  3M84 A;  4ZOL A;  5KMG B;  4LNU A;  3V3T A;  1PF5 A;  5EIB D;  4C4W C;  1GX1 A;  4YJ3 B;  1YGY A;  2Z1T A;  4TUY A;  3N2G A;  3CCL F;  3KE1 A;  4ZHQ A;  4C8E A;  3C9R A;  5IJ0 B;  3JAT B;  3E22 A;  5EYP A;  2UYJ A;  2BO1 A;  1DT9 A;  3VOB A;  5LP6 C;  4F6R A;  2FGY A;  5ITZ A;  2DYY A;  3CCR F;  4M8I A;  5FLX M;  2G9I A;  4TV8 A;  4EI8 A;  1XBI A;  1M90 H;  1H7M A;  2VGN A;  4O4H B;  5EB0 A;  1XRG A;  2Z1E A;  3LWR C;  5EZY A;  4I4T A;  3F6M A;  5LXT B;  4X20 A;  1YJW F;  3P10 A;  3NMU C;  2I6R A;  3IR9 A;  3E1Y A;  1W42 A;  1FNK A;  1JN1 A;  3Q8H A;  4U39 A;  3N2K A;  3CMA F;  2KG4 A;  3HKE A;  4BVR A;  1W5A A;  4ZI7 A;  5MN5 A;  3JAM M;  1TUB A;  2H6L A;  1ONI A;  2UYK A;  4G4Y A;  3KHN A;  1RLU A;  1NMU B;  3JAL A;  2AMT A;  3JAW B;  1FFX B;  3IKE A;  1COM A;  1CK2 A;  2OTM A;  4WBN A;  5GAN K;  2HX0 A;  4EB6 A;  5CB4 B;  4O2B B;  3LWO C;  4IHJ B;  3OW2 F;  2UZH A;  3N4Z A;  3D54 A;  1W58 1;  3CYQ A;  5GIO C;  2WAL A;  4I55 A;  3HWU A;  4X3L A;  3HKC A;  1VQ6 F;  1X7O A;  5BMV B;  5JQG B;  4BW0 B;  1KD1 H;  3V4D A;  1Z5V A;  3B6N A;  2Z1U A;  4B45 A;  5EO3 A;  1VK3 A;  1JFF A;  4HNA A;  4TV9 A;  4G88 A;  3I55 F;  1U43 A;  5GON B;  1W59 A;  3J81 M;  3P4E A;  3LWV C;  2RB9 A;  4YJ2 A;  1IV2 A;  2PMP A;  2QI2 A;  1YJ9 F;  5HP7 A;  5A2Q M;  3O85 A;  5EWR A;  2AIZ P;  2BTO A;  3LME A;  1NJI H;  2ZF8 A;  5HWE A;  2OHW A;  1VQ8 F;  1XV2 A;  4O4I A;  4DXD A;  2QA4 F;  1VQ5 F;  4O4J B;  3OBY A;  1DBF A;  5FNV B;  3N4Y A;  3K2X A;  4LCK A;  3QTY A;  3HKD B;  3VCZ A;  2ZVZ A;  3RYI A;  5KMG A;  1K8A H;  3VYU C;  3CC2 F;  3JAR B;  5EAZ A;  3CB2 A;  2HP0 B;  3MBM A;  3VMF B;  1RA4 A;  4C82 A;  4NUT A;  1SZQ A;  1U3L A;  4YJ3 A;  3U0O A;  5IT9 M;  1YIT F;  1X25 A;  1X52 A;  5LP6 B;  3JAT A;  5EIB C;  3ESJ A;  3M4S A;  4C81 A;  4O4L B;  3S0H A;  1VQN F;  4X1K B;  1H48 A;  2QTP A;  3LDT A;  4BVQ A;  1W41 A;  2OZB A;  3AGK A;  2K1S A;  3HKB B;  3BYQ A;  4FFB B;  2CW4 A;  3K0T A;  3CC4 F;  1E7K A;  4O4H A;  1YI2 F;  3ZOP A;  1VHA A;  4X1I B;  4TZZ A;  5LXT A;  4BY9 D;  2ZOV A;  3GHZ A;  3MQW A;  1GZ0 A;  1FSZ A;  3KJJ A;  4IIJ B;  5J2U B;  1SA0 B;  4BT4 A;  1JD1 A;  2UYP A;  1T0A A;  3CCS F;  2HRY A;  4G4Z A;  3S02 A;  1W5F A;  5J2T B;  1W55 A;  3G4S F;  1VQM F;  2HS0 A;  3G6E F;  3JAW A;  1FFX A;  5AVM A;  5IJ9 B;  3LWP C;  3SIV A;  1GO0 A;  3EOR A;  3C9S A;  3CME F;  2VAM A;  3WPX A;  3JAK B;  2UYN B;  4RHA A;  4BT6 A;  5CB4 A;  3DDN A;  4O2B A;  2HS4 A;  2HQS C;  5G4U C;  1VQO F;  4IHJ A;  2VAW A;  4O2A B;  1CN7 A;  5CA0 B;  5KX5 B;  3V7Q A;  3RYC B;  1VQ4 F;  1Q86 H;  1OFU A;  2HS3 A;  4ZHV A;  3CD6 F;  2RHL A;  5BMV A;  4ZHW A;  3CPW F;  5JQG A;  1FNJ A;  5JCO A;  2W8B C;  1W40 A;  3TD3 A;  1KC8 H;  1IPA A;  3FFM A;  4U3J B;  5DCV A;  2RHO A;  5GON A;  4ERH A;  2PHN A;  3CXC F;  5LYJ B;  3PLA C;  4X20 B;  2CHS A;  2V9Y A;  3G71 F;  3M1X A;  1Q7Y H;  3RYH B;  1PXW A;  5GAP K;  3IKF A;  1U40 A;  1VQL F;  3R0P A;  1QD9 A;  3UT5 B;  1VQK F;  2VAP A;  3VOA A;  3CCE F;  1W5B A;  5HY0 A;  1TUB B;  1R1M A;  2H8C A;  1S72 F;  2Q1Y A;  1K73 H;  3K14 A;  1ZWZ A;  1JY8 A;  4B5C A;  3CC7 F;  5B8F A;  3MDO A;  4O4J A;  3K12 A;  3T80 A;  5FNV A;  5IYZ B;  3VI6 A;  4G4W A;  2I6D A;  1Q81 H;  3IMP A;  3HKD A;  2BTQ B;  1YHQ F;  3WXM B;  3JCM M;  5MN6 A;  3JAR A;  1ODE A;  2CZW A;  2HP0 A;  5CA1 B;  3FD5 A;  5EB1 B;  1YJN F;  4B62 A;  3HKC B;  3MCA B;  2R75 1;  1W2B F;  3F0E A;  3HTN A;  5LA6 B;  5LP6 A;  3GTZ A;  3WGJ A;  3JVH A;  4RQO A;  1GO1 A;  5MN4 A;  3HJW C;  4O4L A;  3S0W A;  1QVG F;  3FBA A;  4X1K A;  3LWQ C;  2CHT A;  1W3E X;  2NMU A;  2H8E A;  1CLI A;  3JAS B;  3C9T A;  2VXY A;  3HKB A;  4I50 B;  5HP8 A;  1XHO A;  4FFB A;  2HP3 A;  2FC3 A;  2R6R 1;  3ERN A;  4G4V A;  3S06 A;  5IJ0 A;  5LOV B;  4X1I A;  1U3P A;  3MCQ A;  3L7Q A;  2IQQ A;  3SIU A;  5JVD B;  5C8Y B;  2Z1F A;  3VO8 A;  3P0Z A;  3C9U A;  4IIJ A;  5J2U A;  2VGM A;  3NVI B;  4BT7 A;  1Z5W A;  3VTI C;  2CWJ A;  2IAF A;  2KTU A;  2HVY D;  2JNB A;  3ELC A;  4B46 A;  5HY2 A;  3I56 F;  5J2T A;  3LFO A;  5IJ9 A;  3D00 A;  1Q8R A;  4NQ3 A;  4BVS A;  4C8I A;  4DRX B;  4R40 B;  3JAK A;  2UYN A;  4X1Y B;  3F0F A;  1KQS F;  2Z01 A;  3WJP A;  4O2A A;  3VYT C;  1VQP F;  1Q82 H;  5CA0 A;  5KX5 A;  3RYC A;  2EWC A;  4KWE A;  4ZK7 A;  3NK7 A;  1YIJ F;  5JH7 B;  3RYF B;  1TVK B;  2YXZ A;  4ZOL B;  3CCV F;  4BT3 A;  2RHJ A;  3KJK A;  4LNU B;  3IEQ A;  2GZL A;  3FPI A;  2LBW A;  1KNJ A;  4BVT A;  1RQ7 A;  1JJ2 F;  2QEX F;  3CCQ F;  3J7A R;  4TUY B;  3N2G B;  4U3J A;  4ZHQ B;  1KNK A;  2GLZ A;  1YQN A;  1SDS A;  1RQ2 A;  2ZAU A;  3E22 B;  3KIZ A;  4PWT A;  5EYP B;  4C8G A;  5LYJ A;  3ZP7 A;  3S03 A;  3FD6 A;  5HY1 A;  4F6R B;  3RYH A;  5ITZ B;  2ZOD A;  2AIF A;  3C8L A;  3V7E A;  4TV8 B;  5HXZ A;  1M1K H;  2CVL A;  4E6E A;  3UT5 A;  3HAX D;  3I3F A;  3ZO8 A;  5EZY B;  5FJ4 C;  4I4T B;  3ON1 A;  3WJR A;  1NQ3 A;  2BTU A;  4ZHY B;  3WGN A;  1IV4 A;  1QU9 A;  3CCU F;  3I7T A;  2L26 A;  5IYZ A;  1K9M H;  3N2K B;  3WGL A;  1VQ9 F;  3HKE B;  3CPQ A;  4ZI7 B;  2OTL F;  2IG8 A;  3TD5 A;  3F0G A;  3NK6 A;  5CA1 A;  1VQ7 F;  1UFY A;  3JAL B;  2N48 A;  3RA6 A;  2YYE A;  1IV1 A;  1X7P A;  3ZP4 A;  4WBN B;  3QUW A;  2LBX A;  4EB6 B;  5LA6 A;  1RLG A;  2DT4 A;  4BT2 A;  3RA5 A;  2CSL A;  2GVI A;  2LCA A;  4G4X A;  4I55 B;  2Q1X A;  3D01 A;  1VH8 A;  3F0D A;  3WGM A;  3LYB A;  3JAS A;  2ZVY A;  3IEW A;  5HXU A;  3CCJ F;  5GIP C;  4I50 A;  2KGW A;  2F9Z C;  3WPW A;  1IV3 A;  3OON A;  3VYS C;  2MQE A;  5LOV A;  3DC2 A;  1J7H A;  1W5E A;  1JFF B;  5JVD A;  5C8Y A;  4HNA B;  2KTV A;  5JCO C;  3TD4 A;  3PAF A;  4TV9 B;  1QAH A;  3CG6 A;  3WJQ A;  1VQV A;  5G4V C;  4XCQ A;  3J80 M;  3RE3 A;  4YJ2 B; 
#chains in the Genus database with same CATH homology
 3S06 A;  4G4V A;  2LCA A;  4G4X A;  4R40 B;  2LBT A;  4ZHV A;  2L26 A;  5EB1 B;  3S0H A;  4B62 A;  5EB0 A;  4G88 A;  4PWT A;  3S03 A;  4ZHW A;  3LDT A;  2ZVY A;  2W8B C;  4G4Z A;  2KGW A;  3S02 A;  3WPW A;  3OON A;  1R1M A;  2K1S A;  2MQE A;  3CYP B;  3TD3 A;  2ZVZ A;  3TD5 A;  3CYQ A;  3S0W A;  5EAZ A;  2N48 A;  4B5C A;  3WPX A;  4RHA A;  3S0Y A;  3TD4 A;  4ERH A;  2AIZ P;  2HQS C;  4G4W A;  2ZOV A;  3IMP A;  1OAP A;  4G4Y A;  4ZHY B;  2ZF8 A;  3KHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...