2KGWA

Solution structure of the carboxy-terminal domain of ompatb, a pore forming protein from mycobacterium tuberculosis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
129
structure length
129
Chain Sequence
APPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Mycobacterium tuberculosis OmpATb protein: A model of an oligomeric channel in the mycobacterial cell wall.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
molecule keywords Outer membrane protein A
total genus 38
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2kgwA00
2K1SA 2ZVYA 4G4XA 5EB1B 3S06A 4B5CA 2MQEA 4G88A 2LCAA 2N48A 2ZVZA 3TD3A 4B62A 2LBTA 3S0HA 3OONA 4G4YA 3WPWA 2ZF8A 3IMPA 3TD5A 3WPXA 4ZHVA 4G4WA 1OAPA 3LDTA 4PWTA 4ERHA 4G4VA 4G4ZA 3S0YA 2W8BC 3S03A 3S0WA 4ZHWA 3TD4A 3S02A 4ZHYB 3KHNA 5EB0A 2HQSC 2AIZP 3CYQA 2KGWA 2ZOVA 4R40B 1R1MA 4RHAA 5EAZA 2L26A 3CYPB
chains in the Genus database with same CATH superfamily
2ZVYA 4IHJB 3JAKA 3JAWB 3R0PA 3N2GB 5KX5A 5GINC 2QTPA 2UYKA 3CCMF 4G88A 2N48A 3WXMB 5CA0A 5HXZA 1VK3A 3TD3A 3JASB 1Z5WA 4X1KB 3G4SF 3WPWA 1PXWA 4EI9A 5LA6B 3WGLA 5J2UB 3KIZA 2H8EA 1N8RH 2RB9A 2HQSC 2PHNA 3SIVA 3CG6A 1QAHA 5EIBD 1YGYA 3TD4A 5LOVA 3RYCB 1RA4A 3WJPA 1VQMF 3CCSF 2LBXA 3IR9A 3MCAB 3RE3A 3F0DA 4EI7A 5KMGA 2EWCA 3I56F 5A2QM 3G6EF 1H7MA 1KQSF 2IQQA 3WPXA 1H48A 5MN5A 1YITF 4U3JA 3NK6A 1ZWZA 3RYFB 2R751 2ZOVA 5EAZA 4O4JA 2I6RA 5FLXM 2IG8A 4HNAA 3PLAC 3RA5A 2GZLA 2BO1A 5EB1B 1VH8A 2I6DA 3GHZA 3JAMM 3LWQC 4TZZA 5AVMA 3OONA 4IHJA 3UT5B 5IT9M 3K14A 1U40A 5GONB 3TD5A 4IIJB 5MN4A 3LFOA 1W5EA 5IJ9A 1IV4A 3HKBB 1CLIA 3ZP4A 1W5FA 5KX5B 1NQ3A 1ODEA 3CPWF 2Z01A 5BMVB 5JVDA 2AIZP 4X1YA 3WJRA 1YIJF 4O4LB 4WBNA 5JQGA 1XBIA 3K2XA 3HKEA 1GX1A 3KE1A 5GAPK 3CCQF 3JATA 2UYNA 2BTUA 3LMEA 3WJQA 2Z1UA 5JVDB 4X1IB 1VHAA 3CCLF 1QVFF 1SZQA 2QEXF 2HP3A 4X1YB 2VGNA 4KWEA 3DDNA 5LYJA 4G4XA 5IJ0B 3PAFA 5HP8A 4C8EA 4BVQA 2YYEA 4I50B 1JFFA 4ZI7B 3WGKA 2CWJA 3T80A 4BVRA 5J2UA 3VMFB 1YQNA 3CC7F 2QI2A 4I55B 2HS4A 3B6NA 2LBTA 3LYBA 2H6LA 3CCJF 4I55A 4BT7A 1VQNF 3CCUF 1ONIA 2KG4A 3MQWA 4ZOLA 3E1YA 1GZ0A 3C9TA 1YI2F 2HS0A 1TVKA 3S0WA 4ZHWA 1VQ7F 1IV1A 5HP7A 1T0AA 3QHDA 5LYJB 5EYPB 2VAMA 4BT6A 1VQ8F 1RLGA 3C8LA 3N4ZA 3J81M 1DBFA 5IYZB 2Z1TA 3BYQA 3NVKE 1XHOA 4O2AA 1W40A 2ZVZA 1VQ9F 3OW2F 1VQOF 1QVGF 1W55A 3C9UA 4YJ3B 2CSLA 3FD5A 3ON1A 2UYNB 3VOAA 5LOVB 1OAPA 3MCQA 3CPQA 1NJIH 2LBWA 5JQGB 3C9SA 2BTOA 4G4ZA 4ZOLB 4X3LA 4ZHQA 2VAWA 2IAFA 3M4SA 3MDOA 4F6RB 3RYCA 3FPIA 3JARB 2KTVA 3FFMA 4LCKA 1YHQF 2BTQB 1VQPF 1KC8H 5GANK 1RLUA 1GO1A 5FNVB 3UT5A 1QU9A 3N2KA 3CCEF 3JASA 4X20A 1J7HA 2UZHA 2FC3A 2OTJF 5CB4A 4ZK7A 2RHHA 2HRYA 4FFBB 3V3TA 2OTLF 2DYYA 2PMPA 4NUTA 2VAPA 4HNAB 4DXDA 5FJ4C 5CA1A 1JY8A 1TUBB 5LP6C 1RQ2A 2RHJA 5LP6B 4EI8A 2DT4A 1VQ4F 4BVSA 3OBYA 1FNJA 2NMUA 3MBMA 3QTYA 4O2AB 3SIUA 4O4LA 2ZODA 3KJKA 1X7PA 1W5AA 2ZF8A 3IMPA 1UI9A 3CC4F 3RA6A 3LDTA 3LWRC 4DRXB 4G4VA 3N4YA 3HKCA 5EWRA 2G9IA 1GO0A 2HS3A 1SA0A 3V7EA 4O4HB 5J2TB 3JVHA 3KHNA 5LA6A 1YJNF 3VCZA 3V4DA 1TVKB 1IPAA 1COMA 3VTIC 3M84A 2CZWA 2MQEA 2UYPA 1YJWF 1K73H 1W2BF 4BY9D 4EB6A 5EZYA 4B62A 3JAKB 3N2KB 1JD1A 1FSZA 2CW4A 5MN6A 1JN1A 2AMTA 2W8BC 5JH7B 1Q82H 4U3JB 4BT4A 3VI6A 1XV2A 1VQ5F 3CYQA 5HY0A 1M1KH 1JJ2F 1K9MH 1VQLF 4M8IA 3AGKA 4TV8A 1CN7A 1KNKA 5EO3A 3ZP7A 5G4UC 3RYFA 3WGMA 4B5CA 3VIUA 1IV2A 3DC2A 3P0ZA 4O4IB 4TUYA 1Q7YH 4U39A 5LP6A 1X7OA 4RQOA 1FFXB 2V9YA 4ZHVA 4B45A 4G4WA 3VYUC 2F9ZC 4TV9B 4PWTA 4C8GA 4ERHA 4I4TB 2JNBA 3IKEA 3GYQA 3JALA 4LNUB 1Z5VA 1M90H 5EB0A 5LXTB 5CB4B 1W57A 1TUBA 1Q86H 5EYPA 3FD6A 1VQKF 5G4VC 3OBWA 2Q1XA 3I55F 5CA0B 1YJ9F 3EORA 4FFBA 5ITZB 2HP0B 1JFFB 3WGJA 4ZI7A 2OHWA 2ZAUA 2ALEA 4IIJA 1X25A 3J7AR 3ELCA 5EZYB 3J80M 5LXTA 3L7QA 1W581 3IEWA 4I4TA 3ZOPA 2OTMA 2CVLA 4C82A 2Z1FA 4R40B 2FGYA 4RHAA 3CYPB 3JATB 3VOBA 1Q81H 3F0FA 2GLZA 1K8AH 3S06A 3HKEB 2RHOA 4BVTA 4YJ2A 3Q8HA 4C8IA 3NVIB 5HXUA 2YXZA 3HKCB 4O4IA 4TUYB 3RYHA 2HX0A 4BW0B 3JCMM 1FNKA 3CXCF 3P4EA 3CMAF 5C8YA 1XRGA 1FFXA 3O85A 4YJ3A 5GIOC 1Q8RA 2UYJA 1W59A 3RYHB 4B46A 3S03A 4BT2A 3CC2F 2H8CA 5DCVA 1R1MA 1U43A 4X20B 3I7TA 3HAXD 1W41A 4O2BA 4C81A 1OFUA 5IJ9B 5HY1A 5ITZA 2HRUA 3V7QA 2CHTA 3N2GA 5GIPC 3F0GA 1KD1H 1RQ7A 3S0HA 2R6R1 4X1KA 2GVIA 4O4JB 5FNVA 3VO8A 1U3PA 4O4HA 3NMUC 3K0TA 1PF5A 5EIBC 3HTNA 3S0YA 4ZHYB 3CD6F 1VQVA 2CHSA 1CK2A 3U0OA 3C9RA 1DT9A 4F6RA 5C8YB 5J2TA 3JALB 4LNUA 3RYIB 2HVYD 5HY2A 1W5BA 1W3EX 3CCVF 4WBNB 3KJJA 4C4WC 4BT5A 2AIFA 3ERNA 4G4YA 5CA1B 1VQ6F 1IV3A 2KTUA 5KMGB 3VYSC 1W42A 3E22A 3LWVC 1QD9A 3HKBA 3HKDB 4BT3A 5IYZA 2VGMA 3QUWA 3F6MA 1S72F 3GTZA 5GONA 2L26A 5JCOC 2K1SA 5BMVA 1H47A 3D54A 3F0EA 4XCQA 2Z1EA 3D01A 2HP0A 2LCAA 3IKFA 3K12A 3ESJA 5JCOA 1SDSA 5IJ0A 2RHLA 1T0KB 3CCRF 4EB6B 3LWOC 2Q1YA 5HWEA 3HKDA 2QA4F 4I50A 3M1XA 3CMEF 4ZHQB 3CB2A 4O2BB 4DRXA 3E22B 4X1IA 3S02A 4TV9A 3JAWA 3JARA 2P6YA 2KGWA 3D00A 3WGNA 3G71F 1X52A 2VXYA 1NMUB 3NK7A 3FBAA 2B33A 1SA0B 5B8FA 4NQ3A 3HJWC 4NWOB 3HWUA 4E6EA 3RYIA 1E7KA 1U3LA 3P10A 3LWPC 3I3FA 5HY4A 4X3MA 2OZBA 3VYTC 3E20B 3IEQA 1KNJA 5JH7A 4YJ2B 4TV8B 3ZO8A 1UFYA 2WALA
chains in the Genus database with same CATH topology
2K1SA 2ZVYA 4G4XA 5EB1B 3S06A 4B5CA 2MQEA 4G88A 2LCAA 2N48A 2ZVZA 3TD3A 4B62A 2LBTA 3S0HA 3OONA 4G4YA 3WPWA 2ZF8A 3IMPA 3TD5A 3WPXA 4ZHVA 4G4WA 1OAPA 3LDTA 4PWTA 4ERHA 4G4VA 4G4ZA 3S0YA 2W8BC 3S03A 3S0WA 4ZHWA 3TD4A 3S02A 4ZHYB 3KHNA 5EB0A 2HQSC 2AIZP 3CYQA 2KGWA 2ZOVA 4R40B 1R1MA 4RHAA 5EAZA 2L26A 3CYPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1S A;  2ZVY A;  4G4X A;  5EB1 B;  3S06 A;  4B5C A;  2MQE A;  4G88 A;  2LCA A;  2N48 A;  2ZVZ A;  3TD3 A;  4B62 A;  2LBT A;  3S0H A;  3OON A;  4G4Y A;  3WPW A;  2ZF8 A;  3IMP A;  3TD5 A;  3WPX A;  4ZHV A;  4G4W A;  1OAP A;  3LDT A;  4PWT A;  4ERH A;  4G4V A;  4G4Z A;  3S0Y A;  2W8B C;  3S03 A;  3S0W A;  4ZHW A;  3TD4 A;  3S02 A;  4ZHY B;  3KHN A;  5EB0 A;  2HQS C;  2AIZ P;  3CYQ A;  2KGW A;  2ZOV A;  4R40 B;  1R1M A;  4RHA A;  5EAZ A;  2L26 A;  3CYP B; 
#chains in the Genus database with same CATH topology
 2ZVY A;  4IHJ B;  3JAK A;  3JAW B;  3R0P A;  3N2G B;  5KX5 A;  5GIN C;  2QTP A;  2UYK A;  3CCM F;  4G88 A;  2N48 A;  3WXM B;  5CA0 A;  5HXZ A;  1VK3 A;  3TD3 A;  3JAS B;  1Z5W A;  4X1K B;  3G4S F;  3WPW A;  1PXW A;  4EI9 A;  5LA6 B;  3WGL A;  5J2U B;  3KIZ A;  2H8E A;  1N8R H;  2RB9 A;  2HQS C;  2PHN A;  3SIV A;  3CG6 A;  1QAH A;  5EIB D;  1YGY A;  3TD4 A;  5LOV A;  3RYC B;  1RA4 A;  3WJP A;  1VQM F;  3CCS F;  2LBX A;  3IR9 A;  3MCA B;  3RE3 A;  3F0D A;  4EI7 A;  5KMG A;  2EWC A;  3I56 F;  5A2Q M;  3G6E F;  1H7M A;  1KQS F;  2IQQ A;  3WPX A;  1H48 A;  5MN5 A;  1YIT F;  4U3J A;  3NK6 A;  1ZWZ A;  3RYF B;  2R75 1;  2ZOV A;  5EAZ A;  4O4J A;  2I6R A;  5FLX M;  2IG8 A;  4HNA A;  3PLA C;  3RA5 A;  2GZL A;  2BO1 A;  5EB1 B;  1VH8 A;  2I6D A;  3GHZ A;  3JAM M;  3LWQ C;  4TZZ A;  5AVM A;  3OON A;  4IHJ A;  3UT5 B;  5IT9 M;  3K14 A;  1U40 A;  5GON B;  3TD5 A;  4IIJ B;  5MN4 A;  3LFO A;  1W5E A;  5IJ9 A;  1IV4 A;  3HKB B;  1CLI A;  3ZP4 A;  1W5F A;  5KX5 B;  1NQ3 A;  1ODE A;  3CPW F;  2Z01 A;  5BMV B;  5JVD A;  2AIZ P;  4X1Y A;  3WJR A;  1YIJ F;  4O4L B;  4WBN A;  5JQG A;  1XBI A;  3K2X A;  3HKE A;  1GX1 A;  3KE1 A;  5GAP K;  3CCQ F;  3JAT A;  2UYN A;  2BTU A;  3LME A;  3WJQ A;  2Z1U A;  5JVD B;  4X1I B;  1VHA A;  3CCL F;  1QVF F;  1SZQ A;  2QEX F;  2HP3 A;  4X1Y B;  2VGN A;  4KWE A;  3DDN A;  5LYJ A;  4G4X A;  5IJ0 B;  3PAF A;  5HP8 A;  4C8E A;  4BVQ A;  2YYE A;  4I50 B;  1JFF A;  4ZI7 B;  3WGK A;  2CWJ A;  3T80 A;  4BVR A;  5J2U A;  3VMF B;  1YQN A;  3CC7 F;  2QI2 A;  4I55 B;  2HS4 A;  3B6N A;  2LBT A;  3LYB A;  2H6L A;  3CCJ F;  4I55 A;  4BT7 A;  1VQN F;  3CCU F;  1ONI A;  2KG4 A;  3MQW A;  4ZOL A;  3E1Y A;  1GZ0 A;  3C9T A;  1YI2 F;  2HS0 A;  1TVK A;  3S0W A;  4ZHW A;  1VQ7 F;  1IV1 A;  5HP7 A;  1T0A A;  3QHD A;  5LYJ B;  5EYP B;  2VAM A;  4BT6 A;  1VQ8 F;  1RLG A;  3C8L A;  3N4Z A;  3J81 M;  1DBF A;  5IYZ B;  2Z1T A;  3BYQ A;  3NVK E;  1XHO A;  4O2A A;  1W40 A;  2ZVZ A;  1VQ9 F;  3OW2 F;  1VQO F;  1QVG F;  1W55 A;  3C9U A;  4YJ3 B;  2CSL A;  3FD5 A;  3ON1 A;  2UYN B;  3VOA A;  5LOV B;  1OAP A;  3MCQ A;  3CPQ A;  1NJI H;  2LBW A;  5JQG B;  3C9S A;  2BTO A;  4G4Z A;  4ZOL B;  4X3L A;  4ZHQ A;  2VAW A;  2IAF A;  3M4S A;  3MDO A;  4F6R B;  3RYC A;  3FPI A;  3JAR B;  2KTV A;  3FFM A;  4LCK A;  1YHQ F;  2BTQ B;  1VQP F;  1KC8 H;  5GAN K;  1RLU A;  1GO1 A;  5FNV B;  3UT5 A;  1QU9 A;  3N2K A;  3CCE F;  3JAS A;  4X20 A;  1J7H A;  2UZH A;  2FC3 A;  2OTJ F;  5CB4 A;  4ZK7 A;  2RHH A;  2HRY A;  4FFB B;  3V3T A;  2OTL F;  2DYY A;  2PMP A;  4NUT A;  2VAP A;  4HNA B;  4DXD A;  5FJ4 C;  5CA1 A;  1JY8 A;  1TUB B;  5LP6 C;  1RQ2 A;  2RHJ A;  5LP6 B;  4EI8 A;  2DT4 A;  1VQ4 F;  4BVS A;  3OBY A;  1FNJ A;  2NMU A;  3MBM A;  3QTY A;  4O2A B;  3SIU A;  4O4L A;  2ZOD A;  3KJK A;  1X7P A;  1W5A A;  2ZF8 A;  3IMP A;  1UI9 A;  3CC4 F;  3RA6 A;  3LDT A;  3LWR C;  4DRX B;  4G4V A;  3N4Y A;  3HKC A;  5EWR A;  2G9I A;  1GO0 A;  2HS3 A;  1SA0 A;  3V7E A;  4O4H B;  5J2T B;  3JVH A;  3KHN A;  5LA6 A;  1YJN F;  3VCZ A;  3V4D A;  1TVK B;  1IPA A;  1COM A;  3VTI C;  3M84 A;  2CZW A;  2MQE A;  2UYP A;  1YJW F;  1K73 H;  1W2B F;  4BY9 D;  4EB6 A;  5EZY A;  4B62 A;  3JAK B;  3N2K B;  1JD1 A;  1FSZ A;  2CW4 A;  5MN6 A;  1JN1 A;  2AMT A;  2W8B C;  5JH7 B;  1Q82 H;  4U3J B;  4BT4 A;  3VI6 A;  1XV2 A;  1VQ5 F;  3CYQ A;  5HY0 A;  1M1K H;  1JJ2 F;  1K9M H;  1VQL F;  4M8I A;  3AGK A;  4TV8 A;  1CN7 A;  1KNK A;  5EO3 A;  3ZP7 A;  5G4U C;  3RYF A;  3WGM A;  4B5C A;  3VIU A;  1IV2 A;  3DC2 A;  3P0Z A;  4O4I B;  4TUY A;  1Q7Y H;  4U39 A;  5LP6 A;  1X7O A;  4RQO A;  1FFX B;  2V9Y A;  4ZHV A;  4B45 A;  4G4W A;  3VYU C;  2F9Z C;  4TV9 B;  4PWT A;  4C8G A;  4ERH A;  4I4T B;  2JNB A;  3IKE A;  3GYQ A;  3JAL A;  4LNU B;  1Z5V A;  1M90 H;  5EB0 A;  5LXT B;  5CB4 B;  1W57 A;  1TUB A;  1Q86 H;  5EYP A;  3FD6 A;  1VQK F;  5G4V C;  3OBW A;  2Q1X A;  3I55 F;  5CA0 B;  1YJ9 F;  3EOR A;  4FFB A;  5ITZ B;  2HP0 B;  1JFF B;  3WGJ A;  4ZI7 A;  2OHW A;  2ZAU A;  2ALE A;  4IIJ A;  1X25 A;  3J7A R;  3ELC A;  5EZY B;  3J80 M;  5LXT A;  3L7Q A;  1W58 1;  3IEW A;  4I4T A;  3ZOP A;  2OTM A;  2CVL A;  4C82 A;  2Z1F A;  4R40 B;  2FGY A;  4RHA A;  3CYP B;  3JAT B;  3VOB A;  1Q81 H;  3F0F A;  2GLZ A;  1K8A H;  3S06 A;  3HKE B;  2RHO A;  4BVT A;  4YJ2 A;  3Q8H A;  4C8I A;  3NVI B;  5HXU A;  2YXZ A;  3HKC B;  4O4I A;  4TUY B;  3RYH A;  2HX0 A;  4BW0 B;  3JCM M;  1FNK A;  3CXC F;  3P4E A;  3CMA F;  5C8Y A;  1XRG A;  1FFX A;  3O85 A;  4YJ3 A;  5GIO C;  1Q8R A;  2UYJ A;  1W59 A;  3RYH B;  4B46 A;  3S03 A;  4BT2 A;  3CC2 F;  2H8C A;  5DCV A;  1R1M A;  1U43 A;  4X20 B;  3I7T A;  3HAX D;  1W41 A;  4O2B A;  4C81 A;  1OFU A;  5IJ9 B;  5HY1 A;  5ITZ A;  2HRU A;  3V7Q A;  2CHT A;  3N2G A;  5GIP C;  3F0G A;  1KD1 H;  1RQ7 A;  3S0H A;  2R6R 1;  4X1K A;  2GVI A;  4O4J B;  5FNV A;  3VO8 A;  1U3P A;  4O4H A;  3NMU C;  3K0T A;  1PF5 A;  5EIB C;  3HTN A;  3S0Y A;  4ZHY B;  3CD6 F;  1VQV A;  2CHS A;  1CK2 A;  3U0O A;  3C9R A;  1DT9 A;  4F6R A;  5C8Y B;  5J2T A;  3JAL B;  4LNU A;  3RYI B;  2HVY D;  5HY2 A;  1W5B A;  1W3E X;  3CCV F;  4WBN B;  3KJJ A;  4C4W C;  4BT5 A;  2AIF A;  3ERN A;  4G4Y A;  5CA1 B;  1VQ6 F;  1IV3 A;  2KTU A;  5KMG B;  3VYS C;  1W42 A;  3E22 A;  3LWV C;  1QD9 A;  3HKB A;  3HKD B;  4BT3 A;  5IYZ A;  2VGM A;  3QUW A;  3F6M A;  1S72 F;  3GTZ A;  5GON A;  2L26 A;  5JCO C;  2K1S A;  5BMV A;  1H47 A;  3D54 A;  3F0E A;  4XCQ A;  2Z1E A;  3D01 A;  2HP0 A;  2LCA A;  3IKF A;  3K12 A;  3ESJ A;  5JCO A;  1SDS A;  5IJ0 A;  2RHL A;  1T0K B;  3CCR F;  4EB6 B;  3LWO C;  2Q1Y A;  5HWE A;  3HKD A;  2QA4 F;  4I50 A;  3M1X A;  3CME F;  4ZHQ B;  3CB2 A;  4O2B B;  4DRX A;  3E22 B;  4X1I A;  3S02 A;  4TV9 A;  3JAW A;  3JAR A;  2P6Y A;  2KGW A;  3D00 A;  3WGN A;  3G71 F;  1X52 A;  2VXY A;  1NMU B;  3NK7 A;  3FBA A;  2B33 A;  1SA0 B;  5B8F A;  4NQ3 A;  3HJW C;  4NWO B;  3HWU A;  4E6E A;  3RYI A;  1E7K A;  1U3L A;  3P10 A;  3LWP C;  3I3F A;  5HY4 A;  4X3M A;  2OZB A;  3VYT C;  3E20 B;  3IEQ A;  1KNJ A;  5JH7 A;  4YJ2 B;  4TV8 B;  3ZO8 A;  1UFY A;  2WAL A; 
#chains in the Genus database with same CATH homology
 2K1S A;  2ZVY A;  4G4X A;  5EB1 B;  3S06 A;  4B5C A;  2MQE A;  4G88 A;  2LCA A;  2N48 A;  2ZVZ A;  3TD3 A;  4B62 A;  2LBT A;  3S0H A;  3OON A;  4G4Y A;  3WPW A;  2ZF8 A;  3IMP A;  3TD5 A;  3WPX A;  4ZHV A;  4G4W A;  1OAP A;  3LDT A;  4PWT A;  4ERH A;  4G4V A;  4G4Z A;  3S0Y A;  2W8B C;  3S03 A;  3S0W A;  4ZHW A;  3TD4 A;  3S02 A;  4ZHY B;  3KHN A;  5EB0 A;  2HQS C;  2AIZ P;  3CYQ A;  2KGW A;  2ZOV A;  4R40 B;  1R1M A;  4RHA A;  5EAZ A;  2L26 A;  3CYP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...