2KGWA

Solution structure of the carboxy-terminal domain of ompatb, a pore forming protein from mycobacterium tuberculosis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
129
structure length
129
Chain Sequence
APPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein A
publication title Structure of the Mycobacterium tuberculosis OmpATb protein: A model of an oligomeric channel in the mycobacterial cell wall.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
total genus 38
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2kgwA00
3S06A 4G4WA 2K1SA 2ZOVA 3KHNA 5EAZA 4B5CA 4G4ZA 4ZHVA 2AIZP 2LCAA 3CYQA 3S03A 2ZVZA 4RHAA 4R40B 3TD4A 2W8BC 2L26A 3LDTA 2MQEA 3OONA 4G4XA 3TD5A 3WPXA 4ERHA 3S02A 3IMPA 3CYPB 5EB0A 3S0YA 3S0WA 2ZF8A 4G88A 2N48A 1OAPA 2KGWA 2ZVYA 1R1MA 3S0HA 4B62A 3TD3A 4G4VA 4G4YA 2LBTA 4ZHYB 4PWTA 2HQSC 4ZHWA 5EB1B 3WPWA
chains in the Genus database with same CATH superfamily
2HS0A 3MDOA 2ZOVA 2B33A 4F6RA 2R6R1 4O4JB 1NMUB 2ZVZA 5GINC 5BMVA 5LOVB 5AVMA 2L26A 1GZ0A 3CC4F 5HP7A 2Q1XA 3CYPB 3J7AR 4BVRA 1NQ3A 1FFXB 3K0TA 1GX1A 1Z5WA 3V4DA 4EI7A 1XV2A 3CCQF 5EO3A 4BVTA 3CCJF 2HP0B 2VXYA 2ZODA 5HP8A 4ZI7A 2QEXF 4O2BA 3QHDA 4O4HB 3E22A 3JATA 4FFBB 1VQOF 3GTZA 3N2KA 3HJWC 3T80A 1H7MA 1Q81H 2OZBA 5EB0A 5JQGB 3CXCF 4G88A 5KMGA 5CB4A 5LXTB 4I50A 1FNJA 1U3PA 3HKCB 3M4SA 5IJ0A 4YJ2A 1IV2A 4TV8B 3F6MA 3G4SF 4YJ3B 1U40A 2Z1EA 3KHNA 1VQ7F 3FFMA 2BTUA 1TUBA 4O2AA 1IPAA 2PMPA 3L7QA 1VQ5F 5MN5A 3HTNA 2KG4A 3FD5A 3RYIB 3V7QA 3ZP7A 1VQKF 2P6YA 1JFFB 3P4EA 3K14A 1SDSA 4BT2A 2QI2A 2HRYA 5EZYA 3KIZA 1JD1A 4O4IB 3LWPC 5GONB 5FNVA 3GYQA 4BT6A 5C8YB 5IYZB 5DCVA 1Q8RA 2AIZP 4I4TB 3WGMA 2LBWA 3FBAA 1GO1A 1VQLF 2FC3A 3KE1A 2GLZA 2H6LA 3ESJA 5ITZB 4U39A 3WXMB 1E7KA 1JN1A 1VQNF 2N48A 5GIPC 3HKBB 2KGWA 3WJPA 4TUYB 3CCMF 3RYCA 1W42A 3DDNA 4G4VA 5GAPK 3LMEA 3WJRA 5EIBC 3VIUA 2NMUA 1IV3A 4IIJB 1VQMF 1YJNF 3C9UA 2VAMA 3S06A 1X25A 1VQPF 1H48A 5IJ9A 1W2BF 1XRGA 2BTQB 3LWOC 1VHAA 4RHAA 1TVKB 3HKEA 1QU9A 2Z1UA 3I7TA 3LDTA 3OONA 5FJ4C 3S02A 3PLAC 3JALA 1S72F 1CN7A 4DXDA 3NK6A 3J81M 2ZF8A 1SA0B 1OAPA 3JVHA 5EYPA 3CPQA 3N4ZA 3NVKE 5LA6B 2VGNA 4TV9A 1RQ2A 4ZHQB 3LWQC 3E1YA 4G4YA 5HY4A 1IV1A 1K73H 2CW4A 5LYJA 3IKFA 4BY9D 2Q1YA 1YGYA 2UYJA 2QA4F 4NUTA 3ERNA 5A2QM 4EB6A 2F9ZC 3S03A 4B45A 3J80M 3WJQA 3EORA 5JH7B 4WBNB 2QTPA 2RHLA 3RA6A 3JARA 1UFYA 3CG6A 4RQOA 3WGLA 4HNAA 3Q8HA 2EWCA 4B62A 4C82A 4X1IB 2UYNB 2IQQA 4X1KA 2HQSC 1N8RH 3JCMM 4EI8A 3NK7A 1K8AH 5J2TA 3CB2A 4BT4A 3N2GB 2K1SA 5CA0B 4DRXA 1VH8A 4BT5A 3IEWA 3I56F 2GZLA 4X20A 4LCKA 3HKCA 2MQEA 4LNUB 5J2UB 3DC2A 4X1YB 3C9TA 3VOBA 4EI9A 3CMEF 2YYEA 4F6RB 1U3LA 3BYQA 4ZOLA 2HVYD 3K2XA 3ZO8A 1W581 3D01A 5BMVB 3FD6A 1YITF 5LP6A 1RLGA 3WGNA 3E20B 3JASA 3FPIA 5KX5A 3JAKA 2CHSA 4U3JA 4X3LA 2KTUA 4G4ZA 2FGYA 1CK2A 3RYFA 2UZHA 5B8FA 1VQ9F 4ZI7B 3VTIC 2HP3A 4O2BB 3E22B 3JATB 1ODEA 3N4YA 4KWEA 4C4WC 3N2KB 1YIJF 5GIOC 3HKDA 1Q7YH 1PF5A 3B6NA 1W5AA 4ZHWA 4O4LA 3IKEA 3ZOPA 3UT5A 4C8EA 1W3EX 1DBFA 1W57A 1VK3A 1W59A 3CCRF 5KMGB 5CB4B 3VYUC 3MCQA 4B5CA 1COMA 3QUWA 2ALEA 4I50B 4M8IA 3WGKA 4C8IA 1ONIA 4YJ2B 5HWEA 5IJ0B 3RYHA 2DT4A 1YI2F 1FNKA 3TD5A 5CA1A 3QTYA 3IMPA 5JVDA 3O85A 1K9MH 3LFOA 1Z5VA 5G4UC 1TUBB 4I55A 4O2AB 3M1XA 3RA5A 4ZHYB 2DYYA 4PWTA 5IT9M 1X7OA 1GO0A 1Q86H 1RLUA 3CCVF 3M84A 3ZP4A 2JNBA 2BO1A 3V7EA 3PAFA 1YQNA 3JAWA 5EZYB 2OTJF 1CLIA 2I6DA 2VAWA 5FNVB 3SIVA 4IHJA 2RHJA 1X52A 1T0AA 4C81A 1KNKA 1H47A 2Z1TA 4BW0B 1QVGF 4O4JA 1XBIA 1JY8A 3D00A 1SZQA 3C8LA 5LOVA 3KJJA 1X7PA 1W5FA 3CC2F 1RA4A 3GHZA 3CCUF 3RYCB 3F0EA 5EAZA 1FFXA 5HY0A 3CD6F 2YXZA 4NQ3A 3CCEF 2HP0A 1YJWF 4ERHA 3VCZA 3D54A 5IJ9B 4O4HA 1R1MA 4FFBA 1YHQF 3HKEB 3I55F 3AGKA 1KNJA 2IAFA 1ZWZA 3OW2F 3JALB 5EB1B 3K12A 4XCQA 5EYPB 5JQGA 1OFUA 5FLXM 4TV9B 3VO8A 2HX0A 3ON1A 5LXTA 5MN4A 2V9YA 3SIUA 2Z1FA 5LYJB 3CMAF 1W40A 5LP6C 3VYTC 5HY1A 4TV8A 1IV4A 3CC7F 1T0KB 3R0PA 1PXWA 3P0ZA 3HAXD 4YJ3A 4EB6B 4C8GA 3CPWF 3LWRC 2I6RA 1YJ9F 4B46A 1W5BA 3JARB 3U0OA 3F0GA 4HNAB 1J7HA 4BT3A 3CYQA 5G4VC 3P10A 4X1KB 3RYIA 1QVFF 3VYSC 2AIFA 1JFFA 2BTOA 3ELCA 3NVIB 4G4XA 3C9SA 4NWOB 5J2TB 3S0WA 4O4IA 4DRXB 2UYPA 5GONA 5HXZA 3OBWA 5C8YA 2KTVA 4X20B 3S0HA 5IYZA 4I4TA 3C9RA 1VQ4F 5GANK 4BT7A 1QD9A 5ITZA 3G6EF 4ZOLB 2UYKA 1QAHA 1FSZA 1W5EA 3G71F 3OBYA 3HKBA 1XHOA 2HRUA 2IG8A 4TUYA 5LP6B 1W41A 1KD1H 3JASB 2RHHA 2GVIA 2OHWA 5KX5B 3S0YA 3MCAB 3JAKB 4U3JB 2CZWA 1U43A 4IIJA 2H8CA 2RHOA 3MQWA 3RYFB 1TVKA 2CWJA 3IEQA 3WPWA 4ZK7A 3I3FA 2AMTA 4G4WA 1SA0A 1VQ8F 4ZHVA 3HKDB 5LA6A 2HS3A 2LCAA 3LWVC 1KC8H 1JJ2F 4O4LB 4ZHQA 2VGMA 3UT5B 3HWUA 2HS4A 2H8EA 3MBMA 3V3TA 3WGJA 5HY2A 2ZAUA 3RE3A 2VAPA 2WALA 5EIBD 1DT9A 1M90H 2LBTA 3RYHB 4BVQA 2RB9A 4X3MA 5CA1B 2G9IA 3CCSF 5JVDB 1M1KH 5JH7A 3VMFB 3JAMM 3LYBA 3VOAA 1Q82H 4WBNA 1RQ7A 1VQVA 1KQSF 4I55B 5JCOC 2PHNA 1VQ6F 3KJKA 2CVLA 2OTMA 2LBXA 3F0FA 3IR9A 4R40B 3TD4A 4TZZA 2W8BC 1NJIH 4X1IA 2UYNA 3WPXA 4E6EA 3NMUC 1UI9A 5JCOA 2ZVYA 2Z01A 2CHTA 3N2GA 5EWRA 5CA0A 3TD3A 3VI6A 3JAWB 2OTLF 5HXUA 3CCLF 4BVSA 5MN6A 3F0DA 2CSLA 4IHJB 4LNUA 5J2UA 1W55A 2R751 4X1YA
chains in the Genus database with same CATH topology
3S06A 4G4WA 2K1SA 2ZOVA 3KHNA 5EAZA 4B5CA 4G4ZA 4ZHVA 2AIZP 2LCAA 3CYQA 3S03A 2ZVZA 4RHAA 4R40B 3TD4A 2W8BC 2L26A 3LDTA 2MQEA 3OONA 4G4XA 3TD5A 3WPXA 4ERHA 3S02A 3IMPA 3CYPB 5EB0A 3S0YA 3S0WA 2ZF8A 4G88A 2N48A 1OAPA 2KGWA 2ZVYA 1R1MA 3S0HA 4B62A 3TD3A 4G4VA 4G4YA 2LBTA 4ZHYB 4PWTA 2HQSC 4ZHWA 5EB1B 3WPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S06 A;  4G4W A;  2K1S A;  2ZOV A;  3KHN A;  5EAZ A;  4B5C A;  4G4Z A;  4ZHV A;  2AIZ P;  2LCA A;  3CYQ A;  3S03 A;  2ZVZ A;  4RHA A;  4R40 B;  3TD4 A;  2W8B C;  2L26 A;  3LDT A;  2MQE A;  3OON A;  4G4X A;  3TD5 A;  3WPX A;  4ERH A;  3S02 A;  3IMP A;  3CYP B;  5EB0 A;  3S0Y A;  3S0W A;  2ZF8 A;  4G88 A;  2N48 A;  1OAP A;  2KGW A;  2ZVY A;  1R1M A;  3S0H A;  4B62 A;  3TD3 A;  4G4V A;  4G4Y A;  2LBT A;  4ZHY B;  4PWT A;  2HQS C;  4ZHW A;  5EB1 B;  3WPW A; 
#chains in the Genus database with same CATH topology
 2HS0 A;  3MDO A;  2ZOV A;  2B33 A;  4F6R A;  2R6R 1;  4O4J B;  1NMU B;  2ZVZ A;  5GIN C;  5BMV A;  5LOV B;  5AVM A;  2L26 A;  1GZ0 A;  3CC4 F;  5HP7 A;  2Q1X A;  3CYP B;  3J7A R;  4BVR A;  1NQ3 A;  1FFX B;  3K0T A;  1GX1 A;  1Z5W A;  3V4D A;  4EI7 A;  1XV2 A;  3CCQ F;  5EO3 A;  4BVT A;  3CCJ F;  2HP0 B;  2VXY A;  2ZOD A;  5HP8 A;  4ZI7 A;  2QEX F;  4O2B A;  3QHD A;  4O4H B;  3E22 A;  3JAT A;  4FFB B;  1VQO F;  3GTZ A;  3N2K A;  3HJW C;  3T80 A;  1H7M A;  1Q81 H;  2OZB A;  5EB0 A;  5JQG B;  3CXC F;  4G88 A;  5KMG A;  5CB4 A;  5LXT B;  4I50 A;  1FNJ A;  1U3P A;  3HKC B;  3M4S A;  5IJ0 A;  4YJ2 A;  1IV2 A;  4TV8 B;  3F6M A;  3G4S F;  4YJ3 B;  1U40 A;  2Z1E A;  3KHN A;  1VQ7 F;  3FFM A;  2BTU A;  1TUB A;  4O2A A;  1IPA A;  2PMP A;  3L7Q A;  1VQ5 F;  5MN5 A;  3HTN A;  2KG4 A;  3FD5 A;  3RYI B;  3V7Q A;  3ZP7 A;  1VQK F;  2P6Y A;  1JFF B;  3P4E A;  3K14 A;  1SDS A;  4BT2 A;  2QI2 A;  2HRY A;  5EZY A;  3KIZ A;  1JD1 A;  4O4I B;  3LWP C;  5GON B;  5FNV A;  3GYQ A;  4BT6 A;  5C8Y B;  5IYZ B;  5DCV A;  1Q8R A;  2AIZ P;  4I4T B;  3WGM A;  2LBW A;  3FBA A;  1GO1 A;  1VQL F;  2FC3 A;  3KE1 A;  2GLZ A;  2H6L A;  3ESJ A;  5ITZ B;  4U39 A;  3WXM B;  1E7K A;  1JN1 A;  1VQN F;  2N48 A;  5GIP C;  3HKB B;  2KGW A;  3WJP A;  4TUY B;  3CCM F;  3RYC A;  1W42 A;  3DDN A;  4G4V A;  5GAP K;  3LME A;  3WJR A;  5EIB C;  3VIU A;  2NMU A;  1IV3 A;  4IIJ B;  1VQM F;  1YJN F;  3C9U A;  2VAM A;  3S06 A;  1X25 A;  1VQP F;  1H48 A;  5IJ9 A;  1W2B F;  1XRG A;  2BTQ B;  3LWO C;  1VHA A;  4RHA A;  1TVK B;  3HKE A;  1QU9 A;  2Z1U A;  3I7T A;  3LDT A;  3OON A;  5FJ4 C;  3S02 A;  3PLA C;  3JAL A;  1S72 F;  1CN7 A;  4DXD A;  3NK6 A;  3J81 M;  2ZF8 A;  1SA0 B;  1OAP A;  3JVH A;  5EYP A;  3CPQ A;  3N4Z A;  3NVK E;  5LA6 B;  2VGN A;  4TV9 A;  1RQ2 A;  4ZHQ B;  3LWQ C;  3E1Y A;  4G4Y A;  5HY4 A;  1IV1 A;  1K73 H;  2CW4 A;  5LYJ A;  3IKF A;  4BY9 D;  2Q1Y A;  1YGY A;  2UYJ A;  2QA4 F;  4NUT A;  3ERN A;  5A2Q M;  4EB6 A;  2F9Z C;  3S03 A;  4B45 A;  3J80 M;  3WJQ A;  3EOR A;  5JH7 B;  4WBN B;  2QTP A;  2RHL A;  3RA6 A;  3JAR A;  1UFY A;  3CG6 A;  4RQO A;  3WGL A;  4HNA A;  3Q8H A;  2EWC A;  4B62 A;  4C82 A;  4X1I B;  2UYN B;  2IQQ A;  4X1K A;  2HQS C;  1N8R H;  3JCM M;  4EI8 A;  3NK7 A;  1K8A H;  5J2T A;  3CB2 A;  4BT4 A;  3N2G B;  2K1S A;  5CA0 B;  4DRX A;  1VH8 A;  4BT5 A;  3IEW A;  3I56 F;  2GZL A;  4X20 A;  4LCK A;  3HKC A;  2MQE A;  4LNU B;  5J2U B;  3DC2 A;  4X1Y B;  3C9T A;  3VOB A;  4EI9 A;  3CME F;  2YYE A;  4F6R B;  1U3L A;  3BYQ A;  4ZOL A;  2HVY D;  3K2X A;  3ZO8 A;  1W58 1;  3D01 A;  5BMV B;  3FD6 A;  1YIT F;  5LP6 A;  1RLG A;  3WGN A;  3E20 B;  3JAS A;  3FPI A;  5KX5 A;  3JAK A;  2CHS A;  4U3J A;  4X3L A;  2KTU A;  4G4Z A;  2FGY A;  1CK2 A;  3RYF A;  2UZH A;  5B8F A;  1VQ9 F;  4ZI7 B;  3VTI C;  2HP3 A;  4O2B B;  3E22 B;  3JAT B;  1ODE A;  3N4Y A;  4KWE A;  4C4W C;  3N2K B;  1YIJ F;  5GIO C;  3HKD A;  1Q7Y H;  1PF5 A;  3B6N A;  1W5A A;  4ZHW A;  4O4L A;  3IKE A;  3ZOP A;  3UT5 A;  4C8E A;  1W3E X;  1DBF A;  1W57 A;  1VK3 A;  1W59 A;  3CCR F;  5KMG B;  5CB4 B;  3VYU C;  3MCQ A;  4B5C A;  1COM A;  3QUW A;  2ALE A;  4I50 B;  4M8I A;  3WGK A;  4C8I A;  1ONI A;  4YJ2 B;  5HWE A;  5IJ0 B;  3RYH A;  2DT4 A;  1YI2 F;  1FNK A;  3TD5 A;  5CA1 A;  3QTY A;  3IMP A;  5JVD A;  3O85 A;  1K9M H;  3LFO A;  1Z5V A;  5G4U C;  1TUB B;  4I55 A;  4O2A B;  3M1X A;  3RA5 A;  4ZHY B;  2DYY A;  4PWT A;  5IT9 M;  1X7O A;  1GO0 A;  1Q86 H;  1RLU A;  3CCV F;  3M84 A;  3ZP4 A;  2JNB A;  2BO1 A;  3V7E A;  3PAF A;  1YQN A;  3JAW A;  5EZY B;  2OTJ F;  1CLI A;  2I6D A;  2VAW A;  5FNV B;  3SIV A;  4IHJ A;  2RHJ A;  1X52 A;  1T0A A;  4C81 A;  1KNK A;  1H47 A;  2Z1T A;  4BW0 B;  1QVG F;  4O4J A;  1XBI A;  1JY8 A;  3D00 A;  1SZQ A;  3C8L A;  5LOV A;  3KJJ A;  1X7P A;  1W5F A;  3CC2 F;  1RA4 A;  3GHZ A;  3CCU F;  3RYC B;  3F0E A;  5EAZ A;  1FFX A;  5HY0 A;  3CD6 F;  2YXZ A;  4NQ3 A;  3CCE F;  2HP0 A;  1YJW F;  4ERH A;  3VCZ A;  3D54 A;  5IJ9 B;  4O4H A;  1R1M A;  4FFB A;  1YHQ F;  3HKE B;  3I55 F;  3AGK A;  1KNJ A;  2IAF A;  1ZWZ A;  3OW2 F;  3JAL B;  5EB1 B;  3K12 A;  4XCQ A;  5EYP B;  5JQG A;  1OFU A;  5FLX M;  4TV9 B;  3VO8 A;  2HX0 A;  3ON1 A;  5LXT A;  5MN4 A;  2V9Y A;  3SIU A;  2Z1F A;  5LYJ B;  3CMA F;  1W40 A;  5LP6 C;  3VYT C;  5HY1 A;  4TV8 A;  1IV4 A;  3CC7 F;  1T0K B;  3R0P A;  1PXW A;  3P0Z A;  3HAX D;  4YJ3 A;  4EB6 B;  4C8G A;  3CPW F;  3LWR C;  2I6R A;  1YJ9 F;  4B46 A;  1W5B A;  3JAR B;  3U0O A;  3F0G A;  4HNA B;  1J7H A;  4BT3 A;  3CYQ A;  5G4V C;  3P10 A;  4X1K B;  3RYI A;  1QVF F;  3VYS C;  2AIF A;  1JFF A;  2BTO A;  3ELC A;  3NVI B;  4G4X A;  3C9S A;  4NWO B;  5J2T B;  3S0W A;  4O4I A;  4DRX B;  2UYP A;  5GON A;  5HXZ A;  3OBW A;  5C8Y A;  2KTV A;  4X20 B;  3S0H A;  5IYZ A;  4I4T A;  3C9R A;  1VQ4 F;  5GAN K;  4BT7 A;  1QD9 A;  5ITZ A;  3G6E F;  4ZOL B;  2UYK A;  1QAH A;  1FSZ A;  1W5E A;  3G71 F;  3OBY A;  3HKB A;  1XHO A;  2HRU A;  2IG8 A;  4TUY A;  5LP6 B;  1W41 A;  1KD1 H;  3JAS B;  2RHH A;  2GVI A;  2OHW A;  5KX5 B;  3S0Y A;  3MCA B;  3JAK B;  4U3J B;  2CZW A;  1U43 A;  4IIJ A;  2H8C A;  2RHO A;  3MQW A;  3RYF B;  1TVK A;  2CWJ A;  3IEQ A;  3WPW A;  4ZK7 A;  3I3F A;  2AMT A;  4G4W A;  1SA0 A;  1VQ8 F;  4ZHV A;  3HKD B;  5LA6 A;  2HS3 A;  2LCA A;  3LWV C;  1KC8 H;  1JJ2 F;  4O4L B;  4ZHQ A;  2VGM A;  3UT5 B;  3HWU A;  2HS4 A;  2H8E A;  3MBM A;  3V3T A;  3WGJ A;  5HY2 A;  2ZAU A;  3RE3 A;  2VAP A;  2WAL A;  5EIB D;  1DT9 A;  1M90 H;  2LBT A;  3RYH B;  4BVQ A;  2RB9 A;  4X3M A;  5CA1 B;  2G9I A;  3CCS F;  5JVD B;  1M1K H;  5JH7 A;  3VMF B;  3JAM M;  3LYB A;  3VOA A;  1Q82 H;  4WBN A;  1RQ7 A;  1VQV A;  1KQS F;  4I55 B;  5JCO C;  2PHN A;  1VQ6 F;  3KJK A;  2CVL A;  2OTM A;  2LBX A;  3F0F A;  3IR9 A;  4R40 B;  3TD4 A;  4TZZ A;  2W8B C;  1NJI H;  4X1I A;  2UYN A;  3WPX A;  4E6E A;  3NMU C;  1UI9 A;  5JCO A;  2ZVY A;  2Z01 A;  2CHT A;  3N2G A;  5EWR A;  5CA0 A;  3TD3 A;  3VI6 A;  3JAW B;  2OTL F;  5HXU A;  3CCL F;  4BVS A;  5MN6 A;  3F0D A;  2CSL A;  4IHJ B;  4LNU A;  5J2U A;  1W55 A;  2R75 1;  4X1Y A; 
#chains in the Genus database with same CATH homology
 3S06 A;  4G4W A;  2K1S A;  2ZOV A;  3KHN A;  5EAZ A;  4B5C A;  4G4Z A;  4ZHV A;  2AIZ P;  2LCA A;  3CYQ A;  3S03 A;  2ZVZ A;  4RHA A;  4R40 B;  3TD4 A;  2W8B C;  2L26 A;  3LDT A;  2MQE A;  3OON A;  4G4X A;  3TD5 A;  3WPX A;  4ERH A;  3S02 A;  3IMP A;  3CYP B;  5EB0 A;  3S0Y A;  3S0W A;  2ZF8 A;  4G88 A;  2N48 A;  1OAP A;  2KGW A;  2ZVY A;  1R1M A;  3S0H A;  4B62 A;  3TD3 A;  4G4V A;  4G4Y A;  2LBT A;  4ZHY B;  4PWT A;  2HQS C;  4ZHW A;  5EB1 B;  3WPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...