2KGWA

Solution structure of the carboxy-terminal domain of ompatb, a pore forming protein from mycobacterium tuberculosis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
129
structure length
129
Chain Sequence
APPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Mycobacterium tuberculosis OmpATb protein: A model of an oligomeric channel in the mycobacterial cell wall.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
molecule keywords Outer membrane protein A
total genus 38
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2kgwA00
2K1SA 3KHNA 5EAZA 3WPWA 2W8BC 3IMPA 2ZOVA 5EB1B 4G4VA 2HQSC 4B5CA 3S03A 1R1MA 4ZHWA 3S02A 4G4WA 4G4XA 3S06A 2ZF8A 4B62A 3TD3A 2L26A 3OONA 1OAPA 3TD4A 2KGWA 3S0WA 2LCAA 4PWTA 4G88A 2LBTA 3S0HA 4ZHVA 5EB0A 3TD5A 3LDTA 2ZVYA 3WPXA 3S0YA 2N48A 2MQEA 4ZHYB 3CYPB 3CYQA 4G4YA 4R40B 4ERHA 4G4ZA 4RHAA 2ZVZA 2AIZP
chains in the Genus database with same CATH superfamily
1XRGA 1X7OA 3MCQA 5JQGB 1Z5VA 5JQGA 3JASB 3HWUA 1X52A 5G4UC 2I6RA 3MDOA 3ZOPA 5MN6A 4F6RB 4C81A 2GZLA 4BVRA 5GAPK 2UZHA 3FPIA 1T0AA 3RYFA 4X3LA 2LBXA 2OTMA 2RHLA 5J2TB 1YIJF 2G9IA 3Q8HA 3TD5A 3RYHA 3F6MA 2HS0A 1W5AA 4NWOB 5C8YB 2BTUA 5KX5B 3NK7A 5LXTA 1H48A 3GTZA 4O4LB 2VAMA 3IMPA 1K73H 1W5EA 4FFBA 3WGLA 2UYNA 3S06A 1JFFB 1VQPF 3P0ZA 4BVSA 3LWOC 5J2UA 1YHQF 4EB6B 3HKEB 4O2BB 4ZK7A 5JVDA 5FNVA 5J2UB 5CA0B 5GONB 3WPXA 3JCMM 5EZYA 4O4HB 2K1SA 2LBWA 5JCOA 3E20B 5GIOC 2DYYA 4TV9B 3VCZA 5IJ0B 1GX1A 2HP3A 2P6YA 3RYCA 3HKBB 4G4WA 2RHOA 2H8CA 2IG8A 4C4WC 2KGWA 3CCUF 1Q7YH 3MBMA 3VIUA 3J7AR 3VTIC 4XCQA 2HRUA 3FFMA 1W41A 1YJWF 5LP6C 1W42A 1SA0B 4WBNB 2HP0A 3EORA 4X1YA 4ZI7A 3J80M 5LA6A 2OHWA 3G4SF 1QVGF 3OBWA 3E1YA 3S03A 4X20B 5GIPC 1COMA 3WGMA 4X1YB 4ZI7B 3N4YA 4G4XA 4O4JA 3V7QA 1Q8RA 3J81M 3F0DA 5BMVA 5IYZA 3JVHA 5G4VC 1TVKA 2VAWA 1GO0A 3JALB 3V3TA 3OW2F 2HS3A 2DT4A 1QAHA 4G4YA 3HAXD 3PAFA 1NQ3A 2Q1XA 5EAZA 3NVIB 1KNJA 1JN1A 3E22A 3KJKA 4WBNA 1YI2F 5HP8A 3IR9A 2H6LA 3VMFB 1U3LA 3HTNA 3G6EF 2V9YA 3CCRF 3C9UA 3LWRC 1VH8A 3D01A 3M1XA 1NJIH 1Z5WA 3R0PA 4EB6A 3CMEF 4RQOA 3LWVC 3BYQA 2CHSA 4IHJA 1VK3A 3CB2A 3WJQA 4DXDA 4F6RA 4BVQA 4ZOLA 3WPWA 2UYNB 3JATB 2UYPA 4TUYA 3CCVF 4FFBB 4G4VA 2HQSC 2KTVA 2HS4A 2CVLA 2VGMA 3VYUC 3JAKB 1M1KH 3I7TA 4PWTA 1Q82H 2FC3A 5HP7A 1VQLF 1VQNF 4EI8A 3LDTA 3HKCB 2IQQA 2BO1A 2CHTA 3I3FA 3S0YA 5J2TA 4YJ3A 3CYPB 3P10A 4ERHA 2ZVZA 1QD9A 1Q81H 1FNKA 2Z01A 3F0GA 4X1IA 4BT2A 2RHJA 2UYKA 3F0FA 3P4EA 5DCVA 3JAWB 4I55A 4LNUA 1W581 5CB4B 2GVIA 1GZ0A 2ZF8A 1IV3A 3MQWA 4BT4A 1ODEA 4C8IA 2R6R1 4O2BA 1KNKA 2LBTA 1ONIA 3LWPC 2PHNA 5EB0A 3CC4F 2CW4A 1VQVA 1DT9A 5BMVB 4YJ2B 3CCSF 4G4ZA 3JARB 5ITZB 4TV8B 3KHNA 4O4LA 1XHOA 3K2XA 3WGKA 4B5CA 3DDNA 1PF5A 4X1IB 4TZZA 1W3EX 1CLIA 1IPAA 1UI9A 1VQ9F 2L26A 3KIZA 2YYEA 2RHHA 2LCAA 3CCLF 1TVKB 4BW0B 5HXUA 5EIBC 3M4SA 2R751 3MCAB 2ZVYA 4NQ3A 3LWQC 1W57A 3HKEA 3I56F 3PLAC 1GO1A 1NMUB 2MQEA 4BVTA 3FD6A 5HY0A 3GYQA 3SIVA 1TUBA 2WALA 3FD5A 4U3JB 1K8AH 3ERNA 3F0EA 1IV4A 3HJWC 2W8BC 3CCQF 4EI9A 1YITF 3CCJF 3S02A 5HY4A 4BT3A 1VQ7F 1ZWZA 3HKDA 3RA6A 5JH7A 3M84A 2YXZA 3CC7F 5IT9M 5LP6B 3IEQA 5HWEA 5KMGA 4ZHVA 4O4IB 3RE3A 4X1KA 3WGNA 3K0TA 4X1KB 3VO8A 5JCOC 3VOAA 3ZP4A 3CXCF 3VOBA 3CYQA 3O85A 3JAKA 1KD1H 4BT5A 3DC2A 2QEXF 1N8RH 2AIZP 5MN5A 5EO3A 2Z1EA 1CK2A 3AGKA 2QA4F 4X3MA 3KE1A 2QTPA 2H8EA 3TD3A 4C8GA 4HNAA 3TD4A 5HXZA 1VQ5F 4I4TA 2BTOA 4G88A 2I6DA 1RLUA 1W55A 3LMEA 2VAPA 3V4DA 4ZHQB 3JALA 3NK6A 4HNAB 2CSLA 2OTJF 3RYIB 3N2GA 1U3PA 1U40A 2N48A 3HKBA 4I55B 4LNUB 1W5BA 5AVMA 2Z1FA 3C9RA 4TUYB 5HY2A 2B33A 1IV1A 2FGYA 5GANK 1VQMF 1W2BF 1RA4A 3E22B 1E7KA 4U39A 3SIUA 1T0KB 5GONA 3HKCA 5JVDB 3S0WA 1W5FA 3GHZA 5EYPB 3JAMM 5LYJA 3CPWF 1H47A 4O2AB 3LYBA 2HVYD 4O4JB 3JASA 1J7HA 4ZOLB 1H7MA 2OTLF 4IHJB 1YJ9F 1R1MA 2NMUA 3QUWA 3G71F 2HP0B 1SDSA 3N2KB 1VQKF 1FFXA 3VYSC 2AIFA 5EZYB 3WGJA 3I55F 3ELCA 1VQ4F 2BTQB 1X7PA 5FNVB 3T80A 1XBIA 2HRYA 2OZBA 5EYPA 4ZHYB 3IEWA 1Q86H 4X20A 2Z1TA 2KG4A 3RYCB 3VI6A 3K14A 4TV8A 5EB1B 2ZOVA 3D54A 1RQ2A 1JJ2F 3CD6F 4LCKA 2QI2A 2GLZA 3KJJA 4I50A 4B46A 1PXWA 5FLXM 1DBFA 1YGYA 2JNBA 3OBYA 3UT5A 4BT6A 3CMAF 5CA0A 1FFXB 3C9SA 2PMPA 5EWRA 3RYFB 4I4TB 5IJ9A 3WJPA 2EWCA 4M8IA 1SZQA 2F9ZC 2AMTA 5EIBD 4DRXB 3NMUC 4C8EA 3VYTC 4TV9A 5IJ0A 1VQ6F 5LA6B 3V7EA 2HX0A 3JARA 3IKFA 4O4HA 5ITZA 3FBAA 2Q1YA 2RB9A 4EI7A 4O2AA 4BY9D 5CA1A 3N2GB 4B62A 5LYJB 1W59A 2CWJA 3RYIA 3C8LA 5B8FA 3CC2F 3ESJA 3CG6A 3ON1A 1JY8A 4O4IA 3UT5B 5KMGB 2ALEA 1CN7A 1JFFA 1FSZA 3CPQA 4R40B 3QTYA 3JAWA 5GINC 3NVKE 4I50B 1QU9A 1UFYA 3RA5A 1FNJA 1XV2A 5LOVA 1OFUA 2KTUA 2UYJA 4DRXA 4IIJA 4NUTA 4B45A 5LXTB 5KX5A 1K9MH 4KWEA 3LFOA 5MN4A 4U3JA 1RQ7A 1OAPA 3CCMF 1YQNA 3ZO8A 4C82A 4YJ2A 3U0OA 1VHAA 1KC8H 1IV2A 3B6NA 5LP6A 1JD1A 2VXYA 3N4ZA 1X25A 3HKDB 3C9TA 5JH7B 2ZODA 3ZP7A 2VGNA 3N2KA 1VQOF 3WJRA 4RHAA 4BT7A 1M90H 3K12A 3JATA 5CB4A 4IIJB 5A2QM 3WXMB 1QVFF 1TUBB 1RLGA 5LOVB 3QHDA 4ZHWA 4E6EA 2ZAUA 5C8YA 5IJ9B 3CCEF 1SA0A 1U43A 1YJNF 3OONA 5HY1A 3RYHB 1KQSF 2CZWA 4YJ3B 2IAFA 5IYZB 3S0HA 3IKEA 5FJ4C 4ZHQA 1VQ8F 3L7QA 3D00A 2Z1UA 1S72F 5CA1B 1W40A
chains in the Genus database with same CATH topology
2K1SA 3KHNA 5EAZA 3WPWA 2W8BC 3IMPA 2ZOVA 5EB1B 4G4VA 2HQSC 4B5CA 3S03A 1R1MA 4ZHWA 3S02A 4G4WA 4G4XA 3S06A 2ZF8A 4B62A 3TD3A 2L26A 3OONA 1OAPA 3TD4A 2KGWA 3S0WA 2LCAA 4PWTA 4G88A 2LBTA 3S0HA 4ZHVA 5EB0A 3TD5A 3LDTA 2ZVYA 3WPXA 3S0YA 2N48A 2MQEA 4ZHYB 3CYPB 3CYQA 4G4YA 4R40B 4ERHA 4G4ZA 4RHAA 2ZVZA 2AIZP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1S A;  3KHN A;  5EAZ A;  3WPW A;  2W8B C;  3IMP A;  2ZOV A;  5EB1 B;  4G4V A;  2HQS C;  4B5C A;  3S03 A;  1R1M A;  4ZHW A;  3S02 A;  4G4W A;  4G4X A;  3S06 A;  2ZF8 A;  4B62 A;  3TD3 A;  2L26 A;  3OON A;  1OAP A;  3TD4 A;  2KGW A;  3S0W A;  2LCA A;  4PWT A;  4G88 A;  2LBT A;  3S0H A;  4ZHV A;  5EB0 A;  3TD5 A;  3LDT A;  2ZVY A;  3WPX A;  3S0Y A;  2N48 A;  2MQE A;  4ZHY B;  3CYP B;  3CYQ A;  4G4Y A;  4R40 B;  4ERH A;  4G4Z A;  4RHA A;  2ZVZ A;  2AIZ P; 
#chains in the Genus database with same CATH topology
 1XRG A;  1X7O A;  3MCQ A;  5JQG B;  1Z5V A;  5JQG A;  3JAS B;  3HWU A;  1X52 A;  5G4U C;  2I6R A;  3MDO A;  3ZOP A;  5MN6 A;  4F6R B;  4C81 A;  2GZL A;  4BVR A;  5GAP K;  2UZH A;  3FPI A;  1T0A A;  3RYF A;  4X3L A;  2LBX A;  2OTM A;  2RHL A;  5J2T B;  1YIJ F;  2G9I A;  3Q8H A;  3TD5 A;  3RYH A;  3F6M A;  2HS0 A;  1W5A A;  4NWO B;  5C8Y B;  2BTU A;  5KX5 B;  3NK7 A;  5LXT A;  1H48 A;  3GTZ A;  4O4L B;  2VAM A;  3IMP A;  1K73 H;  1W5E A;  4FFB A;  3WGL A;  2UYN A;  3S06 A;  1JFF B;  1VQP F;  3P0Z A;  4BVS A;  3LWO C;  5J2U A;  1YHQ F;  4EB6 B;  3HKE B;  4O2B B;  4ZK7 A;  5JVD A;  5FNV A;  5J2U B;  5CA0 B;  5GON B;  3WPX A;  3JCM M;  5EZY A;  4O4H B;  2K1S A;  2LBW A;  5JCO A;  3E20 B;  5GIO C;  2DYY A;  4TV9 B;  3VCZ A;  5IJ0 B;  1GX1 A;  2HP3 A;  2P6Y A;  3RYC A;  3HKB B;  4G4W A;  2RHO A;  2H8C A;  2IG8 A;  4C4W C;  2KGW A;  3CCU F;  1Q7Y H;  3MBM A;  3VIU A;  3J7A R;  3VTI C;  4XCQ A;  2HRU A;  3FFM A;  1W41 A;  1YJW F;  5LP6 C;  1W42 A;  1SA0 B;  4WBN B;  2HP0 A;  3EOR A;  4X1Y A;  4ZI7 A;  3J80 M;  5LA6 A;  2OHW A;  3G4S F;  1QVG F;  3OBW A;  3E1Y A;  3S03 A;  4X20 B;  5GIP C;  1COM A;  3WGM A;  4X1Y B;  4ZI7 B;  3N4Y A;  4G4X A;  4O4J A;  3V7Q A;  1Q8R A;  3J81 M;  3F0D A;  5BMV A;  5IYZ A;  3JVH A;  5G4V C;  1TVK A;  2VAW A;  1GO0 A;  3JAL B;  3V3T A;  3OW2 F;  2HS3 A;  2DT4 A;  1QAH A;  4G4Y A;  3HAX D;  3PAF A;  1NQ3 A;  2Q1X A;  5EAZ A;  3NVI B;  1KNJ A;  1JN1 A;  3E22 A;  3KJK A;  4WBN A;  1YI2 F;  5HP8 A;  3IR9 A;  2H6L A;  3VMF B;  1U3L A;  3HTN A;  3G6E F;  2V9Y A;  3CCR F;  3C9U A;  3LWR C;  1VH8 A;  3D01 A;  3M1X A;  1NJI H;  1Z5W A;  3R0P A;  4EB6 A;  3CME F;  4RQO A;  3LWV C;  3BYQ A;  2CHS A;  4IHJ A;  1VK3 A;  3CB2 A;  3WJQ A;  4DXD A;  4F6R A;  4BVQ A;  4ZOL A;  3WPW A;  2UYN B;  3JAT B;  2UYP A;  4TUY A;  3CCV F;  4FFB B;  4G4V A;  2HQS C;  2KTV A;  2HS4 A;  2CVL A;  2VGM A;  3VYU C;  3JAK B;  1M1K H;  3I7T A;  4PWT A;  1Q82 H;  2FC3 A;  5HP7 A;  1VQL F;  1VQN F;  4EI8 A;  3LDT A;  3HKC B;  2IQQ A;  2BO1 A;  2CHT A;  3I3F A;  3S0Y A;  5J2T A;  4YJ3 A;  3CYP B;  3P10 A;  4ERH A;  2ZVZ A;  1QD9 A;  1Q81 H;  1FNK A;  2Z01 A;  3F0G A;  4X1I A;  4BT2 A;  2RHJ A;  2UYK A;  3F0F A;  3P4E A;  5DCV A;  3JAW B;  4I55 A;  4LNU A;  1W58 1;  5CB4 B;  2GVI A;  1GZ0 A;  2ZF8 A;  1IV3 A;  3MQW A;  4BT4 A;  1ODE A;  4C8I A;  2R6R 1;  4O2B A;  1KNK A;  2LBT A;  1ONI A;  3LWP C;  2PHN A;  5EB0 A;  3CC4 F;  2CW4 A;  1VQV A;  1DT9 A;  5BMV B;  4YJ2 B;  3CCS F;  4G4Z A;  3JAR B;  5ITZ B;  4TV8 B;  3KHN A;  4O4L A;  1XHO A;  3K2X A;  3WGK A;  4B5C A;  3DDN A;  1PF5 A;  4X1I B;  4TZZ A;  1W3E X;  1CLI A;  1IPA A;  1UI9 A;  1VQ9 F;  2L26 A;  3KIZ A;  2YYE A;  2RHH A;  2LCA A;  3CCL F;  1TVK B;  4BW0 B;  5HXU A;  5EIB C;  3M4S A;  2R75 1;  3MCA B;  2ZVY A;  4NQ3 A;  3LWQ C;  1W57 A;  3HKE A;  3I56 F;  3PLA C;  1GO1 A;  1NMU B;  2MQE A;  4BVT A;  3FD6 A;  5HY0 A;  3GYQ A;  3SIV A;  1TUB A;  2WAL A;  3FD5 A;  4U3J B;  1K8A H;  3ERN A;  3F0E A;  1IV4 A;  3HJW C;  2W8B C;  3CCQ F;  4EI9 A;  1YIT F;  3CCJ F;  3S02 A;  5HY4 A;  4BT3 A;  1VQ7 F;  1ZWZ A;  3HKD A;  3RA6 A;  5JH7 A;  3M84 A;  2YXZ A;  3CC7 F;  5IT9 M;  5LP6 B;  3IEQ A;  5HWE A;  5KMG A;  4ZHV A;  4O4I B;  3RE3 A;  4X1K A;  3WGN A;  3K0T A;  4X1K B;  3VO8 A;  5JCO C;  3VOA A;  3ZP4 A;  3CXC F;  3VOB A;  3CYQ A;  3O85 A;  3JAK A;  1KD1 H;  4BT5 A;  3DC2 A;  2QEX F;  1N8R H;  2AIZ P;  5MN5 A;  5EO3 A;  2Z1E A;  1CK2 A;  3AGK A;  2QA4 F;  4X3M A;  3KE1 A;  2QTP A;  2H8E A;  3TD3 A;  4C8G A;  4HNA A;  3TD4 A;  5HXZ A;  1VQ5 F;  4I4T A;  2BTO A;  4G88 A;  2I6D A;  1RLU A;  1W55 A;  3LME A;  2VAP A;  3V4D A;  4ZHQ B;  3JAL A;  3NK6 A;  4HNA B;  2CSL A;  2OTJ F;  3RYI B;  3N2G A;  1U3P A;  1U40 A;  2N48 A;  3HKB A;  4I55 B;  4LNU B;  1W5B A;  5AVM A;  2Z1F A;  3C9R A;  4TUY B;  5HY2 A;  2B33 A;  1IV1 A;  2FGY A;  5GAN K;  1VQM F;  1W2B F;  1RA4 A;  3E22 B;  1E7K A;  4U39 A;  3SIU A;  1T0K B;  5GON A;  3HKC A;  5JVD B;  3S0W A;  1W5F A;  3GHZ A;  5EYP B;  3JAM M;  5LYJ A;  3CPW F;  1H47 A;  4O2A B;  3LYB A;  2HVY D;  4O4J B;  3JAS A;  1J7H A;  4ZOL B;  1H7M A;  2OTL F;  4IHJ B;  1YJ9 F;  1R1M A;  2NMU A;  3QUW A;  3G71 F;  2HP0 B;  1SDS A;  3N2K B;  1VQK F;  1FFX A;  3VYS C;  2AIF A;  5EZY B;  3WGJ A;  3I55 F;  3ELC A;  1VQ4 F;  2BTQ B;  1X7P A;  5FNV B;  3T80 A;  1XBI A;  2HRY A;  2OZB A;  5EYP A;  4ZHY B;  3IEW A;  1Q86 H;  4X20 A;  2Z1T A;  2KG4 A;  3RYC B;  3VI6 A;  3K14 A;  4TV8 A;  5EB1 B;  2ZOV A;  3D54 A;  1RQ2 A;  1JJ2 F;  3CD6 F;  4LCK A;  2QI2 A;  2GLZ A;  3KJJ A;  4I50 A;  4B46 A;  1PXW A;  5FLX M;  1DBF A;  1YGY A;  2JNB A;  3OBY A;  3UT5 A;  4BT6 A;  3CMA F;  5CA0 A;  1FFX B;  3C9S A;  2PMP A;  5EWR A;  3RYF B;  4I4T B;  5IJ9 A;  3WJP A;  2EWC A;  4M8I A;  1SZQ A;  2F9Z C;  2AMT A;  5EIB D;  4DRX B;  3NMU C;  4C8E A;  3VYT C;  4TV9 A;  5IJ0 A;  1VQ6 F;  5LA6 B;  3V7E A;  2HX0 A;  3JAR A;  3IKF A;  4O4H A;  5ITZ A;  3FBA A;  2Q1Y A;  2RB9 A;  4EI7 A;  4O2A A;  4BY9 D;  5CA1 A;  3N2G B;  4B62 A;  5LYJ B;  1W59 A;  2CWJ A;  3RYI A;  3C8L A;  5B8F A;  3CC2 F;  3ESJ A;  3CG6 A;  3ON1 A;  1JY8 A;  4O4I A;  3UT5 B;  5KMG B;  2ALE A;  1CN7 A;  1JFF A;  1FSZ A;  3CPQ A;  4R40 B;  3QTY A;  3JAW A;  5GIN C;  3NVK E;  4I50 B;  1QU9 A;  1UFY A;  3RA5 A;  1FNJ A;  1XV2 A;  5LOV A;  1OFU A;  2KTU A;  2UYJ A;  4DRX A;  4IIJ A;  4NUT A;  4B45 A;  5LXT B;  5KX5 A;  1K9M H;  4KWE A;  3LFO A;  5MN4 A;  4U3J A;  1RQ7 A;  1OAP A;  3CCM F;  1YQN A;  3ZO8 A;  4C82 A;  4YJ2 A;  3U0O A;  1VHA A;  1KC8 H;  1IV2 A;  3B6N A;  5LP6 A;  1JD1 A;  2VXY A;  3N4Z A;  1X25 A;  3HKD B;  3C9T A;  5JH7 B;  2ZOD A;  3ZP7 A;  2VGN A;  3N2K A;  1VQO F;  3WJR A;  4RHA A;  4BT7 A;  1M90 H;  3K12 A;  3JAT A;  5CB4 A;  4IIJ B;  5A2Q M;  3WXM B;  1QVF F;  1TUB B;  1RLG A;  5LOV B;  3QHD A;  4ZHW A;  4E6E A;  2ZAU A;  5C8Y A;  5IJ9 B;  3CCE F;  1SA0 A;  1U43 A;  1YJN F;  3OON A;  5HY1 A;  3RYH B;  1KQS F;  2CZW A;  4YJ3 B;  2IAF A;  5IYZ B;  3S0H A;  3IKE A;  5FJ4 C;  4ZHQ A;  1VQ8 F;  3L7Q A;  3D00 A;  2Z1U A;  1S72 F;  5CA1 B;  1W40 A; 
#chains in the Genus database with same CATH homology
 2K1S A;  3KHN A;  5EAZ A;  3WPW A;  2W8B C;  3IMP A;  2ZOV A;  5EB1 B;  4G4V A;  2HQS C;  4B5C A;  3S03 A;  1R1M A;  4ZHW A;  3S02 A;  4G4W A;  4G4X A;  3S06 A;  2ZF8 A;  4B62 A;  3TD3 A;  2L26 A;  3OON A;  1OAP A;  3TD4 A;  2KGW A;  3S0W A;  2LCA A;  4PWT A;  4G88 A;  2LBT A;  3S0H A;  4ZHV A;  5EB0 A;  3TD5 A;  3LDT A;  2ZVY A;  3WPX A;  3S0Y A;  2N48 A;  2MQE A;  4ZHY B;  3CYP B;  3CYQ A;  4G4Y A;  4R40 B;  4ERH A;  4G4Z A;  4RHA A;  2ZVZ A;  2AIZ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...