2KGXB

Haddock structure of the talin f3 domain in complex with talin 1655-1822
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
SFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of an interdomain complex that regulates talin activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Talin-1
total genus 13
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2009-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2kgxB00
1NI2A 2JP2A 2VSZA 1FAOA 2CODA 3KRWA 3M1IB 5L81A 1EGXA 2DHKA 2DX5A 3ULCA 5KCVA 4A5KA 4L6EA 1E5WA 2DFKA 5KQ4A 1MKEA 3ULBA 1FOEA 1W1HA 2X18A 3KZ1A 2COFA 4EMOA 2Z0OA 4GN1A 2G35A 5D3WA 5D27A 4C0AA 2GCJA 3SO6A 2GS0A 2YS3A 2P0FA 3P6AA 3ODXA 2Y8FA 2YVCA 2MFQA 3G9WA 3QWMA 4HAUB 4HHVA 1XCGA 2MKRA 4B6HA 3ML4A 3QIJA 5JHGA 2YT1A 3CXBB 5EFXA 1WG7A 4DXAB 5JLJB 1BWNA 4BBKA 2J59M 4NY0A 1NTYA 2DHIA 3DXCA 4YONA 4K81A 1WGUA 2EC1A 1WJMA 3X23A 2P0DA 2R09A 2J0JA 3MPXA 1BTKA 4EJNA 1FHXA 5JHHA 1M7RA 1X11A 1WJ1A 3HQCA 2COAA 4HAVB 2LKOA 1ZSQA 2QKMA 3BJIA 3SV1A 1SHCA 1P5TA 1B55A 4IAPA 3AU4A 1I2HA 5LOPB 1MK9B 2Z0QA 3PSCA 1U5FA 5DHFB 3WYFB 4MT7A 3GYOA 1AWEA 2BCJA 2KGXB 4HDQA 4A6KA 2Y8GA 2ROZB 3FSSA 2N23A 2YS1A 3PP2A 2HTHB 4Y94A 1UNQA 2I1JA 3SNHA 2Y7BA 4A6HA 1EVHA 1UEFA 2I1KA 1X1GA 5D3VA 3QBVB 1OQNA 1XX0A 1Z87A 2QKLA 2ZPYA 2RGNB 3NSUA 3AU5A 5DH9B 2EMTA 2D10A 3V5WA 4D0NB 2E2XA 4KVGB 1GC6A 2J0KA 1W1DA 1X86A 1UNPA 1PFJA 1KI1B 3PG7A 1DBHA 3LJUX 4CHJA 2LULA 2NZ8B 1K5GB 1V5PA 3VOQA 2ADZA 1NU2A 2FJLA 1TXDA 2DLWA 1UPRA 4IFSA 2RVBB 1KZ7A 3ODWA 1FGZA 4XWXA 4KHOA 2M38A 1FHWA 5KQ1A 2CRFA 3BINA 1MPHA 2K2JA 5CLQB 1Y19B 2P8VA 1J0WA 3F0WA 2DYQA 4MK0A 4HB2B 3A8QA 1WGQA 1V5UA 4KHAA 2LOXA 2D9ZA 2H7DA 3D8FA 5JP4A 1ZVRA 2EJ8A 2D9VA 1U5GA 5HE2A 4A6FB 2PZ1A 3DXEA 2LOZA 4GZUA 3O96A 2CY4A 2EMSA 2DHJA 2KUPA 3U8ZA 3ZVRA 4ZRJA 2RLOA 1OY2A 1UNRA 1FGYA 5J3YA 2XQNM 2W2XD 5D3YA 1LB1A 5D3XA 1TQZA 3N7CA 1UPQA 1U29A 1K5DB 3D8EA 1I7AA 1MK7B 1Q67A 4NSWA 2CY5A 1ZM0A 3WA0A 3UZTA 2YSZA 1LW3A 1X05A 1U5EA 3ODOA 3KSYA 2D2QA 1NTVA 2GCLA 4WVFB 1DDMA 4DX90 2P0HA 2DX1A 1AQCA 4TYZA 1U2BA 1P6SA 1KZGA 1V88A 3KRXA 4HAYB 2R0DA 1N3HA 4K17A 2LG1A 5FI1A 1J19A 1ISNA 1M7EA 3VIAA 2MWNB 1PMSA 4GXBA 2D4QA 3HW2B 3F5RA 1U5DA 1W1GA 3A8PA 4GMXB 2DYNA 4HB0B 3TFMA 5C79A 5DHAB 3TO1A 2DTCA 2COCA 1FHOA 1GG3A 3TVVA 2H7EA 4HB3B 3ZDTA 1EAZA 5DI9B 2Z0PA 3PZDA 2RUKB 1BTNA 2DA0A 5FI0A 4GMVA 5LONB 2AL6A 3OANA 1Y5OA 1FB8A 2LYDA 4F7UP 2CAYA 1BAKA 3U7DA 3PVWA 4HAZB 1PLSA 2L2IA 4HAXB 3TCAA 5J3TA 2VKIA 1DDVA 2YRYA 1MAIA 3PEGA 5CLLB 4Z2NA 3P7ZA 1OMWA 3D8DA 2W2XC 3IVFA 2GJYA 2K2UA 5J3QA 2ELAA 5C5BA 3MDBC 2W2WA 4HDOA 4Z2MB 4IOYX 2J0MA 4CHMA 4H8SA 2KCJA 2YS5A 2NMBA 5GOWB 1X1FA 2IFSA 3A98B 2UZRA 2HE7A 5C5BB 1WI1A 1ZC3B 2D9WA 3KY9A 3TW1A 2UZSA 4K2PA 4PNKA 2DKQA 2MDXA 5DIFB 1H4RA 4WJ7A 2IYBA 2UVMA 4TKNA 2M14A 4WSFA 4HATB 3T06A 4HAWB 1SGHA 4K2OA 2I5CA 4ZRKA 1EF1A 3GYPA 1DROA 2RSGA 1GC7A 5C6RA 4F7HA 2I5FA 3AJ4A 3SYXA 4ZRIA 3DXDA 2D11A 4MY6A 1DYNA 2D9YA 5HE1A 4CYEA 1MIXA 3HK0A 1XD4A 2Q13A 1DDWA 4KAXB 1TJ6A 4EKUA 1XODA 2DKPA 3FM8C 4P7IA 2N0YA 2VRWB 4F7GA 4DX8A 2K00A 2OQBA 3SUZA 2RNRB 1XR0B 4A6FA 1V61A 2DN6A 5HE3A 1P3RA 4YL8A 1V89A 3RCPA 2V76A 3PVLA 1QQGA 5HE0A 2YF0A 5C16A 2ELBA 1MIZB 1RJ2A 1H10A 1V5MA 2ROVA 4KHBB 2D9XA 2L1CA 4DBBA 1WVHA 1U27A 2OTXA 1XKEA 3CIKA 1RRPB 4PQ0A 1ZC4B 2AEHA 4GPTB 3FEHA 1IRSA 4HB4B 2YT0A 3PVUA 1QC6A
chains in the Genus database with same CATH superfamily
1NI2A 2JP2A 2VSZA 1FAOA 1ZYIA 2CODA 3KRWA 3M1IB 5L81A 1EGXA 2DHKA 2DX5A 3ULCA 5KCVA 2GUMA 4A5KA 4L6EA 1E5WA 2DFKA 5KQ4A 1MKEA 3ULBA 1FOEA 1W1HA 2X18A 3KZ1A 2COFA 4EMOA 2Z0OA 4GN1A 2G35A 2R2YA 5D3WA 5D27A 4C0AA 2GCJA 4QJ5B 3SO6A 2GS0A 2YS3A 2P0FA 3P6AA 3ODXA 2Y8FA 2YVCA 2MFQA 2KR0A 3G9WA 3QWMA 4HAUB 4HHVA 1XCGA 2MKRA 4B6HA 3ML4A 3QIJA 5JHGA 2YT1A 3CXBB 5EFXA 1WG7A 4DXAB 5JLJB 1BWNA 4BBKA 4QJ3B 2J59M 4NY0A 1NTYA 2DHIA 3DXCA 4YONA 4K81A 4QXAB 1WGUA 2EC1A 1WJMA 3X23A 2P0DA 2R09A 2J0JA 2KUQA 3MPXA 1MI1A 1BTKA 4EJNA 1FHXA 4L1RA 5JHHA 1M7RA 1X11A 4QJ4B 1WJ1A 3HQCA 2COAA 4HAVB 1T77A 2LKOA 1ZSQA 2QKMA 3BJIA 3SV1A 1SHCA 1P5TA 1B55A 4IAPA 3AU4A 1I2HA 5LOPB 1MK9B 2Z0QA 3PSCA 1U5FA 5DHFB 3WYFB 4MT7A 3GYOA 1AWEA 2BCJA 2KGXB 4HDQA 4A6KA 2Y8GA 2ROZB 3FSSA 2N23A 2Z13A 2YS1A 3PP2A 2HTHB 4Y94A 1UNQA 2I1JA 3SNHA 2Y7BA 4A6HA 1EVHA 1UEFA 2I1KA 1X1GA 5D3VA 3QBVB 1OQNA 1XX0A 1Z87A 2QKLA 2ZPYA 2RGNB 3NSUA 3AU5A 5DH9B 2EMTA 2D10A 3V5WA 4D0NB 2E2XA 4KVGB 1GC6A 2J0KA 1W1DA 1X86A 1UNPA 1PFJA 1KI1B 3PG7A 2KIEA 1DBHA 3LJUX 4CHJA 2LULA 2NZ8B 1K5GB 1V5PA 3FVCA 3VOQA 2ADZA 1NU2A 2FJLA 1TXDA 2DLWA 3NWFA 1UPRA 4IFSA 2RVBB 1KZ7A 3ODWA 1FGZA 4XWXA 4KHOA 2M38A 1FHWA 3NWAA 5KQ1A 2CRFA 3BINA 2YT2A 1MPHA 2K2JA 2FJUB 5LG4B 5CLQB 2Z59A 1Y19B 2P8VA 1J0WA 3F0WA 2DYQA 4MK0A 4HB2B 3A8QA 1WGQA 1V5UA 4KHAA 4GNKB 5IRSA 2LOXA 2D9ZA 2H7DA 3NW8A 3D8FA 5JP4A 1ZVRA 2EJ8A 2D9VA 1U5GA 5HE2A 4A6FB 2PZ1A 3OHMB 3DXEA 2LOZA 4GZUA 3O96A 2CY4A 2EMSA 2DHJA 2KUPA 3U8ZA 3ZVRA 4ZRJA 2RLOA 1OY2A 1UNRA 1FGYA 5J3YA 2XQNM 2W2XD 5D3YA 1LB1A 5D3XA 1TQZA 3N7CA 1UPQA 1U29A 1K5DB 3D8EA 1I7AA 1MK7B 1Q67A 4NSWA 2CY5A 1ZM0A 3WA0A 3UZTA 2YSZA 1LW3A 1X05A 1U5EA 3ODOA 3KSYA 2D2QA 1NTVA 4KHBA 2GCLA 4WVFB 1DDMA 3B77A 4DX90 2P0HA 4OSNA 2DX1A 1AQCA 4TYZA 1U2BA 1P6SA 1KZGA 1V88A 3KRXA 2Z14A 3NWDA 4HAYB 2R0DA 1N3HA 4K17A 2LG1A 5FI1A 1J19A 1ISNA 1M7EA 3HIEA 3VIAA 3DCXA 2MWNB 1PMSA 4GXBA 2D4QA 3HW2B 3F5RA 1U5DA 1W1GA 3A8PA 4GMXB 2DYNA 4HB0B 3TFMA 4CSQA 5C79A 5DHAB 2Z4DA 3TO1A 2DTCA 2NBVA 2COCA 1FHOA 1GG3A 3TVVA 2H7EA 4HB3B 3ZDTA 1EAZA 5DI9B 2Z0PA 3PZDA 2RUKB 1BTNA 2DA0A 5FI0A 4GMVA 2ZKMX 5LONB 2AL6A 5I2MA 3OANA 1Y5OA 1FB8A 3HSAA 2LYDA 4F7UP 2CAYA 1BAKA 3U7DA 3PVWA 4HAZB 1PLSA 2L2IA 4HAXB 3TCAA 5J3TA 2K8EA 2VKIA 1DDVA 2YRYA 1MAIA 3PEGA 5CLLB 4Z2NA 3P7ZA 1OMWA 3D8DA 2W2XC 4D6WA 3IVFA 2GJYA 2K2UA 5I2SA 5J3QA 2ELAA 5C5BA 3MDBC 2W2WA 2KIGA 4HDOA 4Z2MB 4IOYX 2J0MA 4CHMA 4H8SA 2KCJA 2YS5A 2NMBA 4OT1A 1X1FA 5GOWB 2IFSA 3A98B 2UZRA 2HE7A 5C5BB 1WI1A 1ZC3B 2D9WA 3KY9A 3TW1A 2UZSA 4K2PA 4PNKA 2DKQA 2MDXA 5DIFB 1H4RA 4WJ7A 5M4YB 2IYBA 2UVMA 4TKNA 2M14A 4WSFA 4HATB 3T06A 4HAWB 1SGHA 3A58A 4K2OA 2I5CA 4ZRKA 1EF1A 3GYPA 1DROA 2RSGA 1GC7A 4HSIA 5C6RA 4F7HA 2I5FA 3AJ4A 3SYXA 4ZRIA 3DXDA 2D11A 4MY6A 1DYNA 2D9YA 5HE1A 4CYEA 1MIXA 3HK0A 1XD4A 2Q13A 1DDWA 4KAXB 1TJ6A 4EKUA 1XODA 2DKPA 4DIXA 3FM8C 4P7IA 2N0YA 2VRWB 4F7GA 4DX8A 2K00A 2OQBA 3SUZA 2RNRB 1XR0B 4A6FA 1V61A 2DN6A 5HE3A 1P3RA 4YL8A 2RRFA 1V89A 3RCPA 2V76A 3PVLA 1QQGA 5HE0A 2YF0A 5C16A 2ELBA 1MIZB 1RJ2A 1H10A 1V5MA 2ROVA 4KHBB 2D9XA 2L1CA 4DBBA 3U12A 1WVHA 1U27A 2OTXA 1XKEA 3CIKA 1RRPB 4PQ0A 1ZC4B 2AEHA 4GPTB 3FEHA 1IRSA 4HB4B 2YT0A 3PVUA 4GOUA 1QC6A 2K49A
chains in the Genus database with same CATH topology
1NI2A 2JP2A 2VSZA 1FAOA 2CODA 3KRWA 3M1IB 5L81A 1EGXA 2DHKA 2DX5A 3ULCA 5KCVA 4A5KA 4L6EA 1E5WA 2DFKA 5KQ4A 1MKEA 3ULBA 1FOEA 1W1HA 2X18A 3KZ1A 2COFA 4EMOA 2Z0OA 4GN1A 2G35A 5D3WA 5D27A 4C0AA 2GCJA 3SO6A 2GS0A 2YS3A 2P0FA 3P6AA 3ODXA 2Y8FA 2YVCA 2MFQA 3G9WA 3QWMA 4HAUB 4HHVA 1XCGA 2MKRA 4B6HA 3ML4A 3QIJA 5JHGA 2YT1A 3CXBB 5EFXA 1WG7A 4DXAB 5JLJB 1BWNA 4BBKA 2J59M 4NY0A 1NTYA 2DHIA 3DXCA 4YONA 4K81A 1WGUA 2EC1A 1WJMA 3X23A 2P0DA 2R09A 2J0JA 3MPXA 1BTKA 4EJNA 1FHXA 5JHHA 1M7RA 1X11A 1WJ1A 3HQCA 2COAA 4HAVB 2LKOA 1ZSQA 2QKMA 3BJIA 3SV1A 1SHCA 1P5TA 1B55A 4IAPA 3AU4A 1I2HA 5LOPB 1MK9B 2Z0QA 3PSCA 1U5FA 5DHFB 3WYFB 4MT7A 3GYOA 1AWEA 2BCJA 2KGXB 4HDQA 4A6KA 2Y8GA 2ROZB 3FSSA 2N23A 2YS1A 3PP2A 2HTHB 4Y94A 1UNQA 2I1JA 3SNHA 2Y7BA 4A6HA 1EVHA 1UEFA 2I1KA 1X1GA 5D3VA 3QBVB 1OQNA 1XX0A 1Z87A 2QKLA 2ZPYA 2RGNB 3NSUA 3AU5A 5DH9B 2EMTA 2D10A 3V5WA 4D0NB 2E2XA 4KVGB 1GC6A 2J0KA 1W1DA 1X86A 1UNPA 1PFJA 1KI1B 3PG7A 1DBHA 3LJUX 4CHJA 2LULA 2NZ8B 1K5GB 1V5PA 3VOQA 2ADZA 1NU2A 2FJLA 1TXDA 2DLWA 1UPRA 4IFSA 2RVBB 1KZ7A 3ODWA 1FGZA 4XWXA 4KHOA 2M38A 1FHWA 5KQ1A 2CRFA 3BINA 1MPHA 2K2JA 5CLQB 1Y19B 2P8VA 1J0WA 3F0WA 2DYQA 4MK0A 4HB2B 3A8QA 1WGQA 1V5UA 4KHAA 2LOXA 2D9ZA 2H7DA 3D8FA 5JP4A 1ZVRA 2EJ8A 2D9VA 1U5GA 5HE2A 4A6FB 2PZ1A 3DXEA 2LOZA 4GZUA 3O96A 2CY4A 2EMSA 2DHJA 2KUPA 3U8ZA 3ZVRA 4ZRJA 2RLOA 1OY2A 1UNRA 1FGYA 5J3YA 2XQNM 2W2XD 5D3YA 1LB1A 5D3XA 1TQZA 3N7CA 1UPQA 1U29A 1K5DB 3D8EA 1I7AA 1MK7B 1Q67A 4NSWA 2CY5A 1ZM0A 3WA0A 3UZTA 2YSZA 1LW3A 1X05A 1U5EA 3ODOA 3KSYA 2D2QA 1NTVA 2GCLA 4WVFB 1DDMA 4DX90 2P0HA 2DX1A 1AQCA 4TYZA 1U2BA 1P6SA 1KZGA 1V88A 3KRXA 4HAYB 2R0DA 1N3HA 4K17A 2LG1A 5FI1A 1J19A 1ISNA 1M7EA 3VIAA 2MWNB 1PMSA 4GXBA 2D4QA 3HW2B 3F5RA 1U5DA 1W1GA 3A8PA 4GMXB 2DYNA 4HB0B 3TFMA 5C79A 5DHAB 3TO1A 2DTCA 2COCA 1FHOA 1GG3A 3TVVA 2H7EA 4HB3B 3ZDTA 1EAZA 5DI9B 2Z0PA 3PZDA 2RUKB 1BTNA 2DA0A 5FI0A 4GMVA 5LONB 2AL6A 3OANA 1Y5OA 1FB8A 2LYDA 4F7UP 2CAYA 1BAKA 3U7DA 3PVWA 4HAZB 1PLSA 2L2IA 4HAXB 3TCAA 5J3TA 2VKIA 1DDVA 2YRYA 1MAIA 3PEGA 5CLLB 4Z2NA 3P7ZA 1OMWA 3D8DA 2W2XC 3IVFA 2GJYA 2K2UA 5J3QA 2ELAA 5C5BA 3MDBC 2W2WA 4HDOA 4Z2MB 4IOYX 2J0MA 4CHMA 4H8SA 2KCJA 2YS5A 2NMBA 5GOWB 1X1FA 2IFSA 3A98B 2UZRA 2HE7A 5C5BB 1WI1A 1ZC3B 2D9WA 3KY9A 3TW1A 2UZSA 4K2PA 4PNKA 2DKQA 2MDXA 5DIFB 1H4RA 4WJ7A 2IYBA 2UVMA 4TKNA 2M14A 4WSFA 4HATB 3T06A 4HAWB 1SGHA 4K2OA 2I5CA 4ZRKA 1EF1A 3GYPA 1DROA 2RSGA 1GC7A 5C6RA 4F7HA 2I5FA 3AJ4A 3SYXA 4ZRIA 3DXDA 2D11A 4MY6A 1DYNA 2D9YA 5HE1A 4CYEA 1MIXA 3HK0A 1XD4A 2Q13A 1DDWA 4KAXB 1TJ6A 4EKUA 1XODA 2DKPA 3FM8C 4P7IA 2N0YA 2VRWB 4F7GA 4DX8A 2K00A 2OQBA 3SUZA 2RNRB 1XR0B 4A6FA 1V61A 2DN6A 5HE3A 1P3RA 4YL8A 1V89A 3RCPA 2V76A 3PVLA 1QQGA 5HE0A 2YF0A 5C16A 2ELBA 1MIZB 1RJ2A 1H10A 1V5MA 2ROVA 4KHBB 2D9XA 2L1CA 4DBBA 1WVHA 1U27A 2OTXA 1XKEA 3CIKA 1RRPB 4PQ0A 1ZC4B 2AEHA 4GPTB 3FEHA 1IRSA 4HB4B 2YT0A 3PVUA 1QC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI2 A;  2JP2 A;  2VSZ A;  1FAO A;  2COD A;  3KRW A;  3M1I B;  5L81 A;  1EGX A;  2DHK A;  2DX5 A;  3ULC A;  5KCV A;  4A5K A;  4L6E A;  1E5W A;  2DFK A;  5KQ4 A;  1MKE A;  3ULB A;  1FOE A;  1W1H A;  2X18 A;  3KZ1 A;  2COF A;  4EMO A;  2Z0O A;  4GN1 A;  2G35 A;  5D3W A;  5D27 A;  4C0A A;  2GCJ A;  3SO6 A;  2GS0 A;  2YS3 A;  2P0F A;  3P6A A;  3ODX A;  2Y8F A;  2YVC A;  2MFQ A;  3G9W A;  3QWM A;  4HAU B;  4HHV A;  1XCG A;  2MKR A;  4B6H A;  3ML4 A;  3QIJ A;  5JHG A;  2YT1 A;  3CXB B;  5EFX A;  1WG7 A;  4DXA B;  5JLJ B;  1BWN A;  4BBK A;  2J59 M;  4NY0 A;  1NTY A;  2DHI A;  3DXC A;  4YON A;  4K81 A;  1WGU A;  2EC1 A;  1WJM A;  3X23 A;  2P0D A;  2R09 A;  2J0J A;  3MPX A;  1BTK A;  4EJN A;  1FHX A;  5JHH A;  1M7R A;  1X11 A;  1WJ1 A;  3HQC A;  2COA A;  4HAV B;  2LKO A;  1ZSQ A;  2QKM A;  3BJI A;  3SV1 A;  1SHC A;  1P5T A;  1B55 A;  4IAP A;  3AU4 A;  1I2H A;  5LOP B;  1MK9 B;  2Z0Q A;  3PSC A;  1U5F A;  5DHF B;  3WYF B;  4MT7 A;  3GYO A;  1AWE A;  2BCJ A;  2KGX B;  4HDQ A;  4A6K A;  2Y8G A;  2ROZ B;  3FSS A;  2N23 A;  2YS1 A;  3PP2 A;  2HTH B;  4Y94 A;  1UNQ A;  2I1J A;  3SNH A;  2Y7B A;  4A6H A;  1EVH A;  1UEF A;  2I1K A;  1X1G A;  5D3V A;  3QBV B;  1OQN A;  1XX0 A;  1Z87 A;  2QKL A;  2ZPY A;  2RGN B;  3NSU A;  3AU5 A;  5DH9 B;  2EMT A;  2D10 A;  3V5W A;  4D0N B;  2E2X A;  4KVG B;  1GC6 A;  2J0K A;  1W1D A;  1X86 A;  1UNP A;  1PFJ A;  1KI1 B;  3PG7 A;  1DBH A;  3LJU X;  4CHJ A;  2LUL A;  2NZ8 B;  1K5G B;  1V5P A;  3VOQ A;  2ADZ A;  1NU2 A;  2FJL A;  1TXD A;  2DLW A;  1UPR A;  4IFS A;  2RVB B;  1KZ7 A;  3ODW A;  1FGZ A;  4XWX A;  4KHO A;  2M38 A;  1FHW A;  5KQ1 A;  2CRF A;  3BIN A;  1MPH A;  2K2J A;  5CLQ B;  1Y19 B;  2P8V A;  1J0W A;  3F0W A;  2DYQ A;  4MK0 A;  4HB2 B;  3A8Q A;  1WGQ A;  1V5U A;  4KHA A;  2LOX A;  2D9Z A;  2H7D A;  3D8F A;  5JP4 A;  1ZVR A;  2EJ8 A;  2D9V A;  1U5G A;  5HE2 A;  4A6F B;  2PZ1 A;  3DXE A;  2LOZ A;  4GZU A;  3O96 A;  2CY4 A;  2EMS A;  2DHJ A;  2KUP A;  3U8Z A;  3ZVR A;  4ZRJ A;  2RLO A;  1OY2 A;  1UNR A;  1FGY A;  5J3Y A;  2XQN M;  2W2X D;  5D3Y A;  1LB1 A;  5D3X A;  1TQZ A;  3N7C A;  1UPQ A;  1U29 A;  1K5D B;  3D8E A;  1I7A A;  1MK7 B;  1Q67 A;  4NSW A;  2CY5 A;  1ZM0 A;  3WA0 A;  3UZT A;  2YSZ A;  1LW3 A;  1X05 A;  1U5E A;  3ODO A;  3KSY A;  2D2Q A;  1NTV A;  2GCL A;  4WVF B;  1DDM A;  4DX9 0;  2P0H A;  2DX1 A;  1AQC A;  4TYZ A;  1U2B A;  1P6S A;  1KZG A;  1V88 A;  3KRX A;  4HAY B;  2R0D A;  1N3H A;  4K17 A;  2LG1 A;  5FI1 A;  1J19 A;  1ISN A;  1M7E A;  3VIA A;  2MWN B;  1PMS A;  4GXB A;  2D4Q A;  3HW2 B;  3F5R A;  1U5D A;  1W1G A;  3A8P A;  4GMX B;  2DYN A;  4HB0 B;  3TFM A;  5C79 A;  5DHA B;  3TO1 A;  2DTC A;  2COC A;  1FHO A;  1GG3 A;  3TVV A;  2H7E A;  4HB3 B;  3ZDT A;  1EAZ A;  5DI9 B;  2Z0P A;  3PZD A;  2RUK B;  1BTN A;  2DA0 A;  5FI0 A;  4GMV A;  5LON B;  2AL6 A;  3OAN A;  1Y5O A;  1FB8 A;  2LYD A;  4F7U P;  2CAY A;  1BAK A;  3U7D A;  3PVW A;  4HAZ B;  1PLS A;  2L2I A;  4HAX B;  3TCA A;  5J3T A;  2VKI A;  1DDV A;  2YRY A;  1MAI A;  3PEG A;  5CLL B;  4Z2N A;  3P7Z A;  1OMW A;  3D8D A;  2W2X C;  3IVF A;  2GJY A;  2K2U A;  5J3Q A;  2ELA A;  5C5B A;  3MDB C;  2W2W A;  4HDO A;  4Z2M B;  4IOY X;  2J0M A;  4CHM A;  4H8S A;  2KCJ A;  2YS5 A;  2NMB A;  5GOW B;  1X1F A;  2IFS A;  3A98 B;  2UZR A;  2HE7 A;  5C5B B;  1WI1 A;  1ZC3 B;  2D9W A;  3KY9 A;  3TW1 A;  2UZS A;  4K2P A;  4PNK A;  2DKQ A;  2MDX A;  5DIF B;  1H4R A;  4WJ7 A;  2IYB A;  2UVM A;  4TKN A;  2M14 A;  4WSF A;  4HAT B;  3T06 A;  4HAW B;  1SGH A;  4K2O A;  2I5C A;  4ZRK A;  1EF1 A;  3GYP A;  1DRO A;  2RSG A;  1GC7 A;  5C6R A;  4F7H A;  2I5F A;  3AJ4 A;  3SYX A;  4ZRI A;  3DXD A;  2D11 A;  4MY6 A;  1DYN A;  2D9Y A;  5HE1 A;  4CYE A;  1MIX A;  3HK0 A;  1XD4 A;  2Q13 A;  1DDW A;  4KAX B;  1TJ6 A;  4EKU A;  1XOD A;  2DKP A;  3FM8 C;  4P7I A;  2N0Y A;  2VRW B;  4F7G A;  4DX8 A;  2K00 A;  2OQB A;  3SUZ A;  2RNR B;  1XR0 B;  4A6F A;  1V61 A;  2DN6 A;  5HE3 A;  1P3R A;  4YL8 A;  1V89 A;  3RCP A;  2V76 A;  3PVL A;  1QQG A;  5HE0 A;  2YF0 A;  5C16 A;  2ELB A;  1MIZ B;  1RJ2 A;  1H10 A;  1V5M A;  2ROV A;  4KHB B;  2D9X A;  2L1C A;  4DBB A;  1WVH A;  1U27 A;  2OTX A;  1XKE A;  3CIK A;  1RRP B;  4PQ0 A;  1ZC4 B;  2AEH A;  4GPT B;  3FEH A;  1IRS A;  4HB4 B;  2YT0 A;  3PVU A;  1QC6 A; 
#chains in the Genus database with same CATH topology
 1NI2 A;  2JP2 A;  2VSZ A;  1FAO A;  1ZYI A;  2COD A;  3KRW A;  3M1I B;  5L81 A;  1EGX A;  2DHK A;  2DX5 A;  3ULC A;  5KCV A;  2GUM A;  4A5K A;  4L6E A;  1E5W A;  2DFK A;  5KQ4 A;  1MKE A;  3ULB A;  1FOE A;  1W1H A;  2X18 A;  3KZ1 A;  2COF A;  4EMO A;  2Z0O A;  4GN1 A;  2G35 A;  2R2Y A;  5D3W A;  5D27 A;  4C0A A;  2GCJ A;  4QJ5 B;  3SO6 A;  2GS0 A;  2YS3 A;  2P0F A;  3P6A A;  3ODX A;  2Y8F A;  2YVC A;  2MFQ A;  2KR0 A;  3G9W A;  3QWM A;  4HAU B;  4HHV A;  1XCG A;  2MKR A;  4B6H A;  3ML4 A;  3QIJ A;  5JHG A;  2YT1 A;  3CXB B;  5EFX A;  1WG7 A;  4DXA B;  5JLJ B;  1BWN A;  4BBK A;  4QJ3 B;  2J59 M;  4NY0 A;  1NTY A;  2DHI A;  3DXC A;  4YON A;  4K81 A;  4QXA B;  1WGU A;  2EC1 A;  1WJM A;  3X23 A;  2P0D A;  2R09 A;  2J0J A;  2KUQ A;  3MPX A;  1MI1 A;  1BTK A;  4EJN A;  1FHX A;  4L1R A;  5JHH A;  1M7R A;  1X11 A;  4QJ4 B;  1WJ1 A;  3HQC A;  2COA A;  4HAV B;  1T77 A;  2LKO A;  1ZSQ A;  2QKM A;  3BJI A;  3SV1 A;  1SHC A;  1P5T A;  1B55 A;  4IAP A;  3AU4 A;  1I2H A;  5LOP B;  1MK9 B;  2Z0Q A;  3PSC A;  1U5F A;  5DHF B;  3WYF B;  4MT7 A;  3GYO A;  1AWE A;  2BCJ A;  2KGX B;  4HDQ A;  4A6K A;  2Y8G A;  2ROZ B;  3FSS A;  2N23 A;  2Z13 A;  2YS1 A;  3PP2 A;  2HTH B;  4Y94 A;  1UNQ A;  2I1J A;  3SNH A;  2Y7B A;  4A6H A;  1EVH A;  1UEF A;  2I1K A;  1X1G A;  5D3V A;  3QBV B;  1OQN A;  1XX0 A;  1Z87 A;  2QKL A;  2ZPY A;  2RGN B;  3NSU A;  3AU5 A;  5DH9 B;  2EMT A;  2D10 A;  3V5W A;  4D0N B;  2E2X A;  4KVG B;  1GC6 A;  2J0K A;  1W1D A;  1X86 A;  1UNP A;  1PFJ A;  1KI1 B;  3PG7 A;  2KIE A;  1DBH A;  3LJU X;  4CHJ A;  2LUL A;  2NZ8 B;  1K5G B;  1V5P A;  3FVC A;  3VOQ A;  2ADZ A;  1NU2 A;  2FJL A;  1TXD A;  2DLW A;  3NWF A;  1UPR A;  4IFS A;  2RVB B;  1KZ7 A;  3ODW A;  1FGZ A;  4XWX A;  4KHO A;  2M38 A;  1FHW A;  3NWA A;  5KQ1 A;  2CRF A;  3BIN A;  2YT2 A;  1MPH A;  2K2J A;  2FJU B;  5LG4 B;  5CLQ B;  2Z59 A;  1Y19 B;  2P8V A;  1J0W A;  3F0W A;  2DYQ A;  4MK0 A;  4HB2 B;  3A8Q A;  1WGQ A;  1V5U A;  4KHA A;  4GNK B;  5IRS A;  2LOX A;  2D9Z A;  2H7D A;  3NW8 A;  3D8F A;  5JP4 A;  1ZVR A;  2EJ8 A;  2D9V A;  1U5G A;  5HE2 A;  4A6F B;  2PZ1 A;  3OHM B;  3DXE A;  2LOZ A;  4GZU A;  3O96 A;  2CY4 A;  2EMS A;  2DHJ A;  2KUP A;  3U8Z A;  3ZVR A;  4ZRJ A;  2RLO A;  1OY2 A;  1UNR A;  1FGY A;  5J3Y A;  2XQN M;  2W2X D;  5D3Y A;  1LB1 A;  5D3X A;  1TQZ A;  3N7C A;  1UPQ A;  1U29 A;  1K5D B;  3D8E A;  1I7A A;  1MK7 B;  1Q67 A;  4NSW A;  2CY5 A;  1ZM0 A;  3WA0 A;  3UZT A;  2YSZ A;  1LW3 A;  1X05 A;  1U5E A;  3ODO A;  3KSY A;  2D2Q A;  1NTV A;  4KHB A;  2GCL A;  4WVF B;  1DDM A;  3B77 A;  4DX9 0;  2P0H A;  4OSN A;  2DX1 A;  1AQC A;  4TYZ A;  1U2B A;  1P6S A;  1KZG A;  1V88 A;  3KRX A;  2Z14 A;  3NWD A;  4HAY B;  2R0D A;  1N3H A;  4K17 A;  2LG1 A;  5FI1 A;  1J19 A;  1ISN A;  1M7E A;  3HIE A;  3VIA A;  3DCX A;  2MWN B;  1PMS A;  4GXB A;  2D4Q A;  3HW2 B;  3F5R A;  1U5D A;  1W1G A;  3A8P A;  4GMX B;  2DYN A;  4HB0 B;  3TFM A;  4CSQ A;  5C79 A;  5DHA B;  2Z4D A;  3TO1 A;  2DTC A;  2NBV A;  2COC A;  1FHO A;  1GG3 A;  3TVV A;  2H7E A;  4HB3 B;  3ZDT A;  1EAZ A;  5DI9 B;  2Z0P A;  3PZD A;  2RUK B;  1BTN A;  2DA0 A;  5FI0 A;  4GMV A;  2ZKM X;  5LON B;  2AL6 A;  5I2M A;  3OAN A;  1Y5O A;  1FB8 A;  3HSA A;  2LYD A;  4F7U P;  2CAY A;  1BAK A;  3U7D A;  3PVW A;  4HAZ B;  1PLS A;  2L2I A;  4HAX B;  3TCA A;  5J3T A;  2K8E A;  2VKI A;  1DDV A;  2YRY A;  1MAI A;  3PEG A;  5CLL B;  4Z2N A;  3P7Z A;  1OMW A;  3D8D A;  2W2X C;  4D6W A;  3IVF A;  2GJY A;  2K2U A;  5I2S A;  5J3Q A;  2ELA A;  5C5B A;  3MDB C;  2W2W A;  2KIG A;  4HDO A;  4Z2M B;  4IOY X;  2J0M A;  4CHM A;  4H8S A;  2KCJ A;  2YS5 A;  2NMB A;  4OT1 A;  1X1F A;  5GOW B;  2IFS A;  3A98 B;  2UZR A;  2HE7 A;  5C5B B;  1WI1 A;  1ZC3 B;  2D9W A;  3KY9 A;  3TW1 A;  2UZS A;  4K2P A;  4PNK A;  2DKQ A;  2MDX A;  5DIF B;  1H4R A;  4WJ7 A;  5M4Y B;  2IYB A;  2UVM A;  4TKN A;  2M14 A;  4WSF A;  4HAT B;  3T06 A;  4HAW B;  1SGH A;  3A58 A;  4K2O A;  2I5C A;  4ZRK A;  1EF1 A;  3GYP A;  1DRO A;  2RSG A;  1GC7 A;  4HSI A;  5C6R A;  4F7H A;  2I5F A;  3AJ4 A;  3SYX A;  4ZRI A;  3DXD A;  2D11 A;  4MY6 A;  1DYN A;  2D9Y A;  5HE1 A;  4CYE A;  1MIX A;  3HK0 A;  1XD4 A;  2Q13 A;  1DDW A;  4KAX B;  1TJ6 A;  4EKU A;  1XOD A;  2DKP A;  4DIX A;  3FM8 C;  4P7I A;  2N0Y A;  2VRW B;  4F7G A;  4DX8 A;  2K00 A;  2OQB A;  3SUZ A;  2RNR B;  1XR0 B;  4A6F A;  1V61 A;  2DN6 A;  5HE3 A;  1P3R A;  4YL8 A;  2RRF A;  1V89 A;  3RCP A;  2V76 A;  3PVL A;  1QQG A;  5HE0 A;  2YF0 A;  5C16 A;  2ELB A;  1MIZ B;  1RJ2 A;  1H10 A;  1V5M A;  2ROV A;  4KHB B;  2D9X A;  2L1C A;  4DBB A;  3U12 A;  1WVH A;  1U27 A;  2OTX A;  1XKE A;  3CIK A;  1RRP B;  4PQ0 A;  1ZC4 B;  2AEH A;  4GPT B;  3FEH A;  1IRS A;  4HB4 B;  2YT0 A;  3PVU A;  4GOU A;  1QC6 A;  2K49 A; 
#chains in the Genus database with same CATH homology
 1NI2 A;  2JP2 A;  2VSZ A;  1FAO A;  2COD A;  3KRW A;  3M1I B;  5L81 A;  1EGX A;  2DHK A;  2DX5 A;  3ULC A;  5KCV A;  4A5K A;  4L6E A;  1E5W A;  2DFK A;  5KQ4 A;  1MKE A;  3ULB A;  1FOE A;  1W1H A;  2X18 A;  3KZ1 A;  2COF A;  4EMO A;  2Z0O A;  4GN1 A;  2G35 A;  5D3W A;  5D27 A;  4C0A A;  2GCJ A;  3SO6 A;  2GS0 A;  2YS3 A;  2P0F A;  3P6A A;  3ODX A;  2Y8F A;  2YVC A;  2MFQ A;  3G9W A;  3QWM A;  4HAU B;  4HHV A;  1XCG A;  2MKR A;  4B6H A;  3ML4 A;  3QIJ A;  5JHG A;  2YT1 A;  3CXB B;  5EFX A;  1WG7 A;  4DXA B;  5JLJ B;  1BWN A;  4BBK A;  2J59 M;  4NY0 A;  1NTY A;  2DHI A;  3DXC A;  4YON A;  4K81 A;  1WGU A;  2EC1 A;  1WJM A;  3X23 A;  2P0D A;  2R09 A;  2J0J A;  3MPX A;  1BTK A;  4EJN A;  1FHX A;  5JHH A;  1M7R A;  1X11 A;  1WJ1 A;  3HQC A;  2COA A;  4HAV B;  2LKO A;  1ZSQ A;  2QKM A;  3BJI A;  3SV1 A;  1SHC A;  1P5T A;  1B55 A;  4IAP A;  3AU4 A;  1I2H A;  5LOP B;  1MK9 B;  2Z0Q A;  3PSC A;  1U5F A;  5DHF B;  3WYF B;  4MT7 A;  3GYO A;  1AWE A;  2BCJ A;  2KGX B;  4HDQ A;  4A6K A;  2Y8G A;  2ROZ B;  3FSS A;  2N23 A;  2YS1 A;  3PP2 A;  2HTH B;  4Y94 A;  1UNQ A;  2I1J A;  3SNH A;  2Y7B A;  4A6H A;  1EVH A;  1UEF A;  2I1K A;  1X1G A;  5D3V A;  3QBV B;  1OQN A;  1XX0 A;  1Z87 A;  2QKL A;  2ZPY A;  2RGN B;  3NSU A;  3AU5 A;  5DH9 B;  2EMT A;  2D10 A;  3V5W A;  4D0N B;  2E2X A;  4KVG B;  1GC6 A;  2J0K A;  1W1D A;  1X86 A;  1UNP A;  1PFJ A;  1KI1 B;  3PG7 A;  1DBH A;  3LJU X;  4CHJ A;  2LUL A;  2NZ8 B;  1K5G B;  1V5P A;  3VOQ A;  2ADZ A;  1NU2 A;  2FJL A;  1TXD A;  2DLW A;  1UPR A;  4IFS A;  2RVB B;  1KZ7 A;  3ODW A;  1FGZ A;  4XWX A;  4KHO A;  2M38 A;  1FHW A;  5KQ1 A;  2CRF A;  3BIN A;  1MPH A;  2K2J A;  5CLQ B;  1Y19 B;  2P8V A;  1J0W A;  3F0W A;  2DYQ A;  4MK0 A;  4HB2 B;  3A8Q A;  1WGQ A;  1V5U A;  4KHA A;  2LOX A;  2D9Z A;  2H7D A;  3D8F A;  5JP4 A;  1ZVR A;  2EJ8 A;  2D9V A;  1U5G A;  5HE2 A;  4A6F B;  2PZ1 A;  3DXE A;  2LOZ A;  4GZU A;  3O96 A;  2CY4 A;  2EMS A;  2DHJ A;  2KUP A;  3U8Z A;  3ZVR A;  4ZRJ A;  2RLO A;  1OY2 A;  1UNR A;  1FGY A;  5J3Y A;  2XQN M;  2W2X D;  5D3Y A;  1LB1 A;  5D3X A;  1TQZ A;  3N7C A;  1UPQ A;  1U29 A;  1K5D B;  3D8E A;  1I7A A;  1MK7 B;  1Q67 A;  4NSW A;  2CY5 A;  1ZM0 A;  3WA0 A;  3UZT A;  2YSZ A;  1LW3 A;  1X05 A;  1U5E A;  3ODO A;  3KSY A;  2D2Q A;  1NTV A;  2GCL A;  4WVF B;  1DDM A;  4DX9 0;  2P0H A;  2DX1 A;  1AQC A;  4TYZ A;  1U2B A;  1P6S A;  1KZG A;  1V88 A;  3KRX A;  4HAY B;  2R0D A;  1N3H A;  4K17 A;  2LG1 A;  5FI1 A;  1J19 A;  1ISN A;  1M7E A;  3VIA A;  2MWN B;  1PMS A;  4GXB A;  2D4Q A;  3HW2 B;  3F5R A;  1U5D A;  1W1G A;  3A8P A;  4GMX B;  2DYN A;  4HB0 B;  3TFM A;  5C79 A;  5DHA B;  3TO1 A;  2DTC A;  2COC A;  1FHO A;  1GG3 A;  3TVV A;  2H7E A;  4HB3 B;  3ZDT A;  1EAZ A;  5DI9 B;  2Z0P A;  3PZD A;  2RUK B;  1BTN A;  2DA0 A;  5FI0 A;  4GMV A;  5LON B;  2AL6 A;  3OAN A;  1Y5O A;  1FB8 A;  2LYD A;  4F7U P;  2CAY A;  1BAK A;  3U7D A;  3PVW A;  4HAZ B;  1PLS A;  2L2I A;  4HAX B;  3TCA A;  5J3T A;  2VKI A;  1DDV A;  2YRY A;  1MAI A;  3PEG A;  5CLL B;  4Z2N A;  3P7Z A;  1OMW A;  3D8D A;  2W2X C;  3IVF A;  2GJY A;  2K2U A;  5J3Q A;  2ELA A;  5C5B A;  3MDB C;  2W2W A;  4HDO A;  4Z2M B;  4IOY X;  2J0M A;  4CHM A;  4H8S A;  2KCJ A;  2YS5 A;  2NMB A;  5GOW B;  1X1F A;  2IFS A;  3A98 B;  2UZR A;  2HE7 A;  5C5B B;  1WI1 A;  1ZC3 B;  2D9W A;  3KY9 A;  3TW1 A;  2UZS A;  4K2P A;  4PNK A;  2DKQ A;  2MDX A;  5DIF B;  1H4R A;  4WJ7 A;  2IYB A;  2UVM A;  4TKN A;  2M14 A;  4WSF A;  4HAT B;  3T06 A;  4HAW B;  1SGH A;  4K2O A;  2I5C A;  4ZRK A;  1EF1 A;  3GYP A;  1DRO A;  2RSG A;  1GC7 A;  5C6R A;  4F7H A;  2I5F A;  3AJ4 A;  3SYX A;  4ZRI A;  3DXD A;  2D11 A;  4MY6 A;  1DYN A;  2D9Y A;  5HE1 A;  4CYE A;  1MIX A;  3HK0 A;  1XD4 A;  2Q13 A;  1DDW A;  4KAX B;  1TJ6 A;  4EKU A;  1XOD A;  2DKP A;  3FM8 C;  4P7I A;  2N0Y A;  2VRW B;  4F7G A;  4DX8 A;  2K00 A;  2OQB A;  3SUZ A;  2RNR B;  1XR0 B;  4A6F A;  1V61 A;  2DN6 A;  5HE3 A;  1P3R A;  4YL8 A;  1V89 A;  3RCP A;  2V76 A;  3PVL A;  1QQG A;  5HE0 A;  2YF0 A;  5C16 A;  2ELB A;  1MIZ B;  1RJ2 A;  1H10 A;  1V5M A;  2ROV A;  4KHB B;  2D9X A;  2L1C A;  4DBB A;  1WVH A;  1U27 A;  2OTX A;  1XKE A;  3CIK A;  1RRP B;  4PQ0 A;  1ZC4 B;  2AEH A;  4GPT B;  3FEH A;  1IRS A;  4HB4 B;  2YT0 A;  3PVU A;  1QC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...