2KGXB

Haddock structure of the talin f3 domain in complex with talin 1655-1822
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
SFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Talin-1
publication title The structure of an interdomain complex that regulates talin activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 13
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2009-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2kgxB00
5LONB 4NY0A 2W2WA 3PVWA 4A6FA 1X05A 1UPQA 1X1GA 4KHBB 4A6FB 4HAUB 3KZ1A 1WGQA 2YVCA 1XKEA 4IAPA 1X11A 4F7GA 1FHXA 2Z0QA 1W1HA 3IVFA 4GMVA 3HK0A 3PSCA 2J59M 4WJ7A 2D2QA 4D0NB 4HAVB 2D4QA 3TFMA 4DBBA 1U5FA 5C5BA 4Z2NA 4KAXB 5C5BB 3P6AA 4TYZA 2LULA 1WJMA 4HAXB 2W2XD 1KZGA 2PZ1A 1DBHA 2YF0A 3FSSA 3PZDA 4A6KA 3A8PA 4ZRKA 4KHOA 4MY6A 4HATB 4EKUA 1ZSQA 2KGXB 1WGUA 2P0DA 5FI1A 2J0JA 3DXEA 1WG7A 4H8SA 3ULBA 3ML4A 1EGXA 2D9VA 2FJLA 5JHGA 1MIZB 2COAA 1EF1A 1ZVRA 2H7EA 3ODWA 5JP4A 3F5RA 2DX1A 3PP2A 2R09A 1J0WA 3MDBC 1NU2A 3P7ZA 2RUKB 2Y8GA 1XCGA 2UZSA 3F0WA 4K2PA 2N0YA 3A8QA 4PNKA 1EVHA 1V88A 1PMSA 1V61A 1OMWA 3GYPA 1FOEA 1P6SA 4MK0A 1WVHA 2D10A 3FEHA 5D3WA 3NSUA 2I5CA 2V76A 1AWEA 1WI1A 2DHIA 2IFSA 2Y8FA 1FHOA 2KCJA 3OANA 2DN6A 1Q67A 1DDMA 1XODA 1FGYA 3FM8C 4WSFA 1FB8A 3HW2B 2ELAA 4CHMA 3QWMA 1MK7B 3N7CA 3ODXA 4HB0B 2RNRB 3X23A 1U29A 1ZC3B 2GCJA 2HE7A 2EC1A 2LOZA 3TCAA 3TW1A 3KY9A 3QIJA 4CYEA 3VIAA 4F7HA 4ZRIA 3RCPA 2CY4A 3V5WA 4P7IA 2P8VA 1KI1B 2DHJA 3D8DA 2IYBA 2HTHB 4GPTB 2EMTA 1V5MA 1GC6A 1Y19B 2XQNM 2H7DA 1K5DB 2D9ZA 1U5EA 2NZ8B 2QKMA 4HAZB 5D3VA 3HQCA 4KHAA 4DX90 4HDQA 1TJ6A 2UVMA 2DLWA 1MK9B 2MDXA 5C16A 1OY2A 2DKPA 1UNRA 3T06A 2ELBA 2ADZA 4ZRJA 3DXCA 3QBVB 5DHFB 1MPHA 2RVBB 1FAOA 2COFA 2DKQA 2D9XA 1EAZA 2DTCA 4YL8A 2L2IA 2MWNB 4DXAB 1M7EA 2M38A 4CHJA 1DROA 1FHWA 1AQCA 2I1JA 4HAYB 1DYNA 1XX0A 1MIXA 4TKNA 4KVGB 5DH9B 5HE2A 1B55A 1ZC4B 5J3YA 2YT1A 5EFXA 1WJ1A 4EMOA 2J0MA 2YS5A 3TVVA 3AU5A 1UNPA 5DI9B 1MAIA 5HE1A 2I5FA 1FGZA 1PFJA 1BAKA 4C0AA 3D8EA 1Z87A 4GMXB 1UPRA 2D9WA 4B6HA 2GCLA 2COCA 4K17A 5KCVA 2RSGA 1DDWA 3ZVRA 2MKRA 2K00A 4XWXA 3SO6A 5CLQB 1J19A 5KQ4A 3BINA 2ROVA 4Y94A 5JLJB 1TXDA 1V5PA 2DYNA 2Y7BA 2DFKA 2G35A 2NMBA 1MKEA 4A5KA 1IRSA 4HB3B 4HDOA 2OTXA 3VOQA 5C6RA 2DHKA 4K81A 3ULCA 1RJ2A 3UZTA 5GOWB 1XR0B 2RGNB 1V89A 4YONA 1W1DA 4IFSA 3KSYA 1H4RA 1GC7A 3KRWA 5D27A 5KQ1A 4K2OA 1LW3A 3U8ZA 2MFQA 5C79A 2AEHA 1DDVA 4HB2B 2KUPA 3TO1A 2YRYA 5D3XA 1M7RA 1Y5OA 1W1GA 2EJ8A 3DXDA 1XD4A 1H10A 1LB1A 2BCJA 1I7AA 3KRXA 3CIKA 3PVUA 4GN1A 1V5UA 1SGHA 4F7UP 1QC6A 1U5GA 1KZ7A 2I1KA 3ZDTA 2YT0A 3SV1A 1GG3A 1PLSA 2M14A 4GXBA 5FI0A 2K2UA 2LKOA 1UNQA 4HB4B 3LJUX 2CAYA 2P0FA 2D9YA 3WA0A 2N23A 5JHHA 2YS1A 5J3TA 2Q13A 1ISNA 3CXBB 1U2BA 3M1IB 2W2XC 2DA0A 4GZUA 2J0KA 2Z0PA 4DX8A 3O96A 1I2HA 1N3HA 3G9WA 5DHAB 2ROZB 5J3QA 2EMSA 1BTKA 4Z2MB 2QKLA 2ZPYA 1X1FA 1NI2A 3AJ4A 1K5GB 2CRFA 3SNHA 3ODOA 3SYXA 3WYFB 3PVLA 1E5WA 2Z0OA 4PQ0A 2RLOA 1X86A 3A98B 1U27A 2D11A 4A6HA 5DIFB 4WVFB 3AU4A 1NTVA 4BBKA 2LOXA 3PEGA 1SHCA 5HE0A 2E2XA 4L6EA 2CODA 3PG7A 2R0DA 1NTYA 1OQNA 2LYDA 1RRPB 1U5DA 1BWNA 3MPXA 4MT7A 2VRWB 1TQZA 2LG1A 2YS3A 2DX5A 3D8FA 4IOYX 5HE3A 2UZRA 3SUZA 2CY5A 2L1CA 2YSZA 2JP2A 3U7DA 4NSWA 5D3YA 2P0HA 1BTNA 2GS0A 2OQBA 5CLLB 2GJYA 1ZM0A 3GYOA 2VKIA 4EJNA 5L81A 1UEFA 1P5TA 1P3RA 4HAWB 2AL6A 3BJIA 1QQGA 4HHVA 2VSZA 2X18A 5LOPB 2DYQA 2K2JA
chains in the Genus database with same CATH superfamily
5LONB 4NY0A 2W2WA 3PVWA 4KHBA 4A6FA 1X05A 1UPQA 1X1GA 4KHBB 4A6FB 4HAUB 3KZ1A 1WGQA 2YVCA 1XKEA 4IAPA 1X11A 2R2YA 4F7GA 1FHXA 2Z0QA 1W1HA 3IVFA 4GMVA 3HK0A 4GOUA 3PSCA 2J59M 3OHMB 4WJ7A 2D2QA 4D0NB 4HAVB 2Z13A 2D4QA 5IRSA 3TFMA 4DBBA 1U5FA 5C5BA 4Z2NA 2K49A 4KAXB 5C5BB 3P6AA 4TYZA 2LULA 3NW8A 4DIXA 1WJMA 4HAXB 2W2XD 1KZGA 2PZ1A 1DBHA 2KIEA 2YF0A 3FSSA 3PZDA 4A6KA 4GNKB 3A8PA 4ZRKA 4KHOA 4MY6A 4HATB 4EKUA 1ZSQA 2KGXB 1WGUA 2P0DA 5FI1A 2J0JA 3DXEA 1WG7A 4H8SA 3ULBA 3ML4A 1EGXA 2D9VA 2FJLA 5JHGA 1MIZB 2COAA 1EF1A 1ZVRA 2H7EA 3ODWA 5JP4A 3F5RA 4CSQA 2DX1A 2KIGA 3NWAA 3PP2A 2R09A 1J0WA 3MDBC 1NU2A 3P7ZA 1T77A 2RUKB 2Y8GA 1XCGA 4QXAB 2UZSA 3F0WA 4K2PA 2N0YA 3A8QA 4PNKA 1EVHA 1V88A 1PMSA 2Z14A 2Z59A 1V61A 1OMWA 3GYPA 1FOEA 1P6SA 4MK0A 1WVHA 2D10A 3FEHA 5D3WA 3NSUA 2I5CA 2V76A 1AWEA 1WI1A 2DHIA 2IFSA 2Y8FA 1FHOA 2KCJA 4QJ3B 3OANA 2DN6A 3U12A 1Q67A 1DDMA 1XODA 1FGYA 3FM8C 4WSFA 1FB8A 3HW2B 2ELAA 4CHMA 3QWMA 1MK7B 3N7CA 3ODXA 4HB0B 2RNRB 3X23A 1U29A 1ZC3B 2GCJA 2HE7A 2EC1A 2LOZA 3TCAA 3TW1A 3KY9A 3QIJA 4CYEA 3VIAA 4F7HA 4ZRIA 3RCPA 2CY4A 3V5WA 4P7IA 2P8VA 1KI1B 2DHJA 2YT2A 3D8DA 2IYBA 2HTHB 4GPTB 2EMTA 1V5MA 1GC6A 1Y19B 4QJ4B 2XQNM 2H7DA 1K5DB 2D9ZA 1U5EA 2NZ8B 2QKMA 4HAZB 5D3VA 3HQCA 4KHAA 4DX90 4HDQA 1TJ6A 2UVMA 2DLWA 1MK9B 2MDXA 5C16A 1OY2A 5I2SA 2DKPA 1UNRA 4OT1A 3T06A 2ELBA 2ADZA 4ZRJA 3DXCA 3QBVB 5DHFB 1MPHA 2RVBB 1FAOA 2COFA 2DKQA 2D9XA 1EAZA 2DTCA 2K8EA 4YL8A 2L2IA 2MWNB 4DXAB 1M7EA 2M38A 4CHJA 1DROA 1FHWA 3NWDA 1AQCA 2I1JA 4HAYB 1DYNA 1XX0A 3HIEA 1MIXA 4TKNA 4KVGB 5DH9B 5HE2A 1B55A 2RRFA 1ZC4B 5J3YA 2YT1A 5EFXA 1WJ1A 5M4YB 4EMOA 1ZYIA 2J0MA 2YS5A 3TVVA 3AU5A 1UNPA 5DI9B 1MAIA 5HE1A 4OSNA 2I5FA 1FGZA 1PFJA 3FVCA 4C0AA 1BAKA 3D8EA 1Z87A 4GMXB 4D6WA 1UPRA 2D9WA 4B6HA 2GCLA 2COCA 3A58A 4K17A 5KCVA 2RSGA 1DDWA 3ZVRA 2MKRA 2K00A 4XWXA 3SO6A 5CLQB 1J19A 5KQ4A 3BINA 2ROVA 4Y94A 4L1RA 5JLJB 1TXDA 1V5PA 2DYNA 2Y7BA 2DFKA 2G35A 2NMBA 1MKEA 4A5KA 1IRSA 4HB3B 4HDOA 2OTXA 3VOQA 5C6RA 2DHKA 4K81A 3ULCA 1RJ2A 3UZTA 5GOWB 1XR0B 2RGNB 1V89A 4YONA 1W1DA 4IFSA 1H4RA 3KSYA 1GC7A 3KRWA 5D27A 5KQ1A 4K2OA 1LW3A 3U8ZA 2MFQA 5C79A 2AEHA 1DDVA 4HB2B 2KUPA 3TO1A 2YRYA 5D3XA 1M7RA 5I2MA 1Y5OA 1W1GA 2EJ8A 3DXDA 1XD4A 1H10A 1LB1A 2BCJA 1I7AA 3KRXA 3CIKA 3PVUA 2NBVA 4GN1A 1V5UA 1SGHA 4F7UP 1QC6A 1U5GA 1KZ7A 2I1KA 3ZDTA 2YT0A 3SV1A 1GG3A 1PLSA 2M14A 4GXBA 5FI0A 2K2UA 2LKOA 1UNQA 4HB4B 3LJUX 2CAYA 2P0FA 2D9YA 3WA0A 2N23A 5JHHA 2YS1A 5J3TA 2Q13A 1ISNA 3CXBB 1U2BA 3M1IB 2W2XC 2DA0A 4GZUA 2J0KA 2Z0PA 4DX8A 3O96A 1I2HA 1N3HA 3G9WA 5DHAB 2ROZB 5J3QA 2EMSA 1BTKA 4Z2MB 2QKLA 2ZPYA 2FJUB 1X1FA 1NI2A 3AJ4A 1K5GB 2CRFA 3SNHA 3ODOA 3SYXA 3WYFB 3HSAA 3PVLA 1E5WA 2Z0OA 4PQ0A 2RLOA 1X86A 2ZKMX 3A98B 1U27A 2D11A 4A6HA 5DIFB 2Z4DA 4WVFB 3AU4A 1NTVA 5LG4B 4BBKA 2LOXA 3PEGA 1SHCA 5HE0A 2E2XA 4L6EA 2CODA 3PG7A 2R0DA 1NTYA 1OQNA 2LYDA 1RRPB 1U5DA 1BWNA 3MPXA 4MT7A 2GUMA 2VRWB 1TQZA 2KUQA 2LG1A 2YS3A 2DX5A 3D8FA 4IOYX 5HE3A 2UZRA 3SUZA 4QJ5B 2CY5A 2L1CA 2YSZA 1MI1A 2JP2A 3U7DA 4NSWA 5D3YA 2P0HA 1BTNA 2GS0A 2OQBA 5CLLB 2GJYA 1ZM0A 3GYOA 2VKIA 2KR0A 4EJNA 5L81A 4HSIA 1UEFA 3NWFA 1P5TA 1P3RA 4HAWB 2AL6A 3BJIA 1QQGA 3B77A 4HHVA 2VSZA 2X18A 5LOPB 2DYQA 3DCXA 2K2JA
chains in the Genus database with same CATH topology
5LONB 4NY0A 2W2WA 3PVWA 4A6FA 1X05A 1UPQA 1X1GA 4KHBB 4A6FB 4HAUB 3KZ1A 1WGQA 2YVCA 1XKEA 4IAPA 1X11A 4F7GA 1FHXA 2Z0QA 1W1HA 3IVFA 4GMVA 3HK0A 3PSCA 2J59M 4WJ7A 2D2QA 4D0NB 4HAVB 2D4QA 3TFMA 4DBBA 1U5FA 5C5BA 4Z2NA 4KAXB 5C5BB 3P6AA 4TYZA 2LULA 1WJMA 4HAXB 2W2XD 1KZGA 2PZ1A 1DBHA 2YF0A 3FSSA 3PZDA 4A6KA 3A8PA 4ZRKA 4KHOA 4MY6A 4HATB 4EKUA 1ZSQA 2KGXB 1WGUA 2P0DA 5FI1A 2J0JA 3DXEA 1WG7A 4H8SA 3ULBA 3ML4A 1EGXA 2D9VA 2FJLA 5JHGA 1MIZB 2COAA 1EF1A 1ZVRA 2H7EA 3ODWA 5JP4A 3F5RA 2DX1A 3PP2A 2R09A 1J0WA 3MDBC 1NU2A 3P7ZA 2RUKB 2Y8GA 1XCGA 2UZSA 3F0WA 4K2PA 2N0YA 3A8QA 4PNKA 1EVHA 1V88A 1PMSA 1V61A 1OMWA 3GYPA 1FOEA 1P6SA 4MK0A 1WVHA 2D10A 3FEHA 5D3WA 3NSUA 2I5CA 2V76A 1AWEA 1WI1A 2DHIA 2IFSA 2Y8FA 1FHOA 2KCJA 3OANA 2DN6A 1Q67A 1DDMA 1XODA 1FGYA 3FM8C 4WSFA 1FB8A 3HW2B 2ELAA 4CHMA 3QWMA 1MK7B 3N7CA 3ODXA 4HB0B 2RNRB 3X23A 1U29A 1ZC3B 2GCJA 2HE7A 2EC1A 2LOZA 3TCAA 3TW1A 3KY9A 3QIJA 4CYEA 3VIAA 4F7HA 4ZRIA 3RCPA 2CY4A 3V5WA 4P7IA 2P8VA 1KI1B 2DHJA 3D8DA 2IYBA 2HTHB 4GPTB 2EMTA 1V5MA 1GC6A 1Y19B 2XQNM 2H7DA 1K5DB 2D9ZA 1U5EA 2NZ8B 2QKMA 4HAZB 5D3VA 3HQCA 4KHAA 4DX90 4HDQA 1TJ6A 2UVMA 2DLWA 1MK9B 2MDXA 5C16A 1OY2A 2DKPA 1UNRA 3T06A 2ELBA 2ADZA 4ZRJA 3DXCA 3QBVB 5DHFB 1MPHA 2RVBB 1FAOA 2COFA 2DKQA 2D9XA 1EAZA 2DTCA 4YL8A 2L2IA 2MWNB 4DXAB 1M7EA 2M38A 4CHJA 1DROA 1FHWA 1AQCA 2I1JA 4HAYB 1DYNA 1XX0A 1MIXA 4TKNA 4KVGB 5DH9B 5HE2A 1B55A 1ZC4B 5J3YA 2YT1A 5EFXA 1WJ1A 4EMOA 2J0MA 2YS5A 3TVVA 3AU5A 1UNPA 5DI9B 1MAIA 5HE1A 2I5FA 1FGZA 1PFJA 1BAKA 4C0AA 3D8EA 1Z87A 4GMXB 1UPRA 2D9WA 4B6HA 2GCLA 2COCA 4K17A 5KCVA 2RSGA 1DDWA 3ZVRA 2MKRA 2K00A 4XWXA 3SO6A 5CLQB 1J19A 5KQ4A 3BINA 2ROVA 4Y94A 5JLJB 1TXDA 1V5PA 2DYNA 2Y7BA 2DFKA 2G35A 2NMBA 1MKEA 4A5KA 1IRSA 4HB3B 4HDOA 2OTXA 3VOQA 5C6RA 2DHKA 4K81A 3ULCA 1RJ2A 3UZTA 5GOWB 1XR0B 2RGNB 1V89A 4YONA 1W1DA 4IFSA 3KSYA 1H4RA 1GC7A 3KRWA 5D27A 5KQ1A 4K2OA 1LW3A 3U8ZA 2MFQA 5C79A 2AEHA 1DDVA 4HB2B 2KUPA 3TO1A 2YRYA 5D3XA 1M7RA 1Y5OA 1W1GA 2EJ8A 3DXDA 1XD4A 1H10A 1LB1A 2BCJA 1I7AA 3KRXA 3CIKA 3PVUA 4GN1A 1V5UA 1SGHA 4F7UP 1QC6A 1U5GA 1KZ7A 2I1KA 3ZDTA 2YT0A 3SV1A 1GG3A 1PLSA 2M14A 4GXBA 5FI0A 2K2UA 2LKOA 1UNQA 4HB4B 3LJUX 2CAYA 2P0FA 2D9YA 3WA0A 2N23A 5JHHA 2YS1A 5J3TA 2Q13A 1ISNA 3CXBB 1U2BA 3M1IB 2W2XC 2DA0A 4GZUA 2J0KA 2Z0PA 4DX8A 3O96A 1I2HA 1N3HA 3G9WA 5DHAB 2ROZB 5J3QA 2EMSA 1BTKA 4Z2MB 2QKLA 2ZPYA 1X1FA 1NI2A 3AJ4A 1K5GB 2CRFA 3SNHA 3ODOA 3SYXA 3WYFB 3PVLA 1E5WA 2Z0OA 4PQ0A 2RLOA 1X86A 3A98B 1U27A 2D11A 4A6HA 5DIFB 4WVFB 3AU4A 1NTVA 4BBKA 2LOXA 3PEGA 1SHCA 5HE0A 2E2XA 4L6EA 2CODA 3PG7A 2R0DA 1NTYA 1OQNA 2LYDA 1RRPB 1U5DA 1BWNA 3MPXA 4MT7A 2VRWB 1TQZA 2LG1A 2YS3A 2DX5A 3D8FA 4IOYX 5HE3A 2UZRA 3SUZA 2CY5A 2L1CA 2YSZA 2JP2A 3U7DA 4NSWA 5D3YA 2P0HA 1BTNA 2GS0A 2OQBA 5CLLB 2GJYA 1ZM0A 3GYOA 2VKIA 4EJNA 5L81A 1UEFA 1P5TA 1P3RA 4HAWB 2AL6A 3BJIA 1QQGA 4HHVA 2VSZA 2X18A 5LOPB 2DYQA 2K2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LON B;  4NY0 A;  2W2W A;  3PVW A;  4A6F A;  1X05 A;  1UPQ A;  1X1G A;  4KHB B;  4A6F B;  4HAU B;  3KZ1 A;  1WGQ A;  2YVC A;  1XKE A;  4IAP A;  1X11 A;  4F7G A;  1FHX A;  2Z0Q A;  1W1H A;  3IVF A;  4GMV A;  3HK0 A;  3PSC A;  2J59 M;  4WJ7 A;  2D2Q A;  4D0N B;  4HAV B;  2D4Q A;  3TFM A;  4DBB A;  1U5F A;  5C5B A;  4Z2N A;  4KAX B;  5C5B B;  3P6A A;  4TYZ A;  2LUL A;  1WJM A;  4HAX B;  2W2X D;  1KZG A;  2PZ1 A;  1DBH A;  2YF0 A;  3FSS A;  3PZD A;  4A6K A;  3A8P A;  4ZRK A;  4KHO A;  4MY6 A;  4HAT B;  4EKU A;  1ZSQ A;  2KGX B;  1WGU A;  2P0D A;  5FI1 A;  2J0J A;  3DXE A;  1WG7 A;  4H8S A;  3ULB A;  3ML4 A;  1EGX A;  2D9V A;  2FJL A;  5JHG A;  1MIZ B;  2COA A;  1EF1 A;  1ZVR A;  2H7E A;  3ODW A;  5JP4 A;  3F5R A;  2DX1 A;  3PP2 A;  2R09 A;  1J0W A;  3MDB C;  1NU2 A;  3P7Z A;  2RUK B;  2Y8G A;  1XCG A;  2UZS A;  3F0W A;  4K2P A;  2N0Y A;  3A8Q A;  4PNK A;  1EVH A;  1V88 A;  1PMS A;  1V61 A;  1OMW A;  3GYP A;  1FOE A;  1P6S A;  4MK0 A;  1WVH A;  2D10 A;  3FEH A;  5D3W A;  3NSU A;  2I5C A;  2V76 A;  1AWE A;  1WI1 A;  2DHI A;  2IFS A;  2Y8F A;  1FHO A;  2KCJ A;  3OAN A;  2DN6 A;  1Q67 A;  1DDM A;  1XOD A;  1FGY A;  3FM8 C;  4WSF A;  1FB8 A;  3HW2 B;  2ELA A;  4CHM A;  3QWM A;  1MK7 B;  3N7C A;  3ODX A;  4HB0 B;  2RNR B;  3X23 A;  1U29 A;  1ZC3 B;  2GCJ A;  2HE7 A;  2EC1 A;  2LOZ A;  3TCA A;  3TW1 A;  3KY9 A;  3QIJ A;  4CYE A;  3VIA A;  4F7H A;  4ZRI A;  3RCP A;  2CY4 A;  3V5W A;  4P7I A;  2P8V A;  1KI1 B;  2DHJ A;  3D8D A;  2IYB A;  2HTH B;  4GPT B;  2EMT A;  1V5M A;  1GC6 A;  1Y19 B;  2XQN M;  2H7D A;  1K5D B;  2D9Z A;  1U5E A;  2NZ8 B;  2QKM A;  4HAZ B;  5D3V A;  3HQC A;  4KHA A;  4DX9 0;  4HDQ A;  1TJ6 A;  2UVM A;  2DLW A;  1MK9 B;  2MDX A;  5C16 A;  1OY2 A;  2DKP A;  1UNR A;  3T06 A;  2ELB A;  2ADZ A;  4ZRJ A;  3DXC A;  3QBV B;  5DHF B;  1MPH A;  2RVB B;  1FAO A;  2COF A;  2DKQ A;  2D9X A;  1EAZ A;  2DTC A;  4YL8 A;  2L2I A;  2MWN B;  4DXA B;  1M7E A;  2M38 A;  4CHJ A;  1DRO A;  1FHW A;  1AQC A;  2I1J A;  4HAY B;  1DYN A;  1XX0 A;  1MIX A;  4TKN A;  4KVG B;  5DH9 B;  5HE2 A;  1B55 A;  1ZC4 B;  5J3Y A;  2YT1 A;  5EFX A;  1WJ1 A;  4EMO A;  2J0M A;  2YS5 A;  3TVV A;  3AU5 A;  1UNP A;  5DI9 B;  1MAI A;  5HE1 A;  2I5F A;  1FGZ A;  1PFJ A;  1BAK A;  4C0A A;  3D8E A;  1Z87 A;  4GMX B;  1UPR A;  2D9W A;  4B6H A;  2GCL A;  2COC A;  4K17 A;  5KCV A;  2RSG A;  1DDW A;  3ZVR A;  2MKR A;  2K00 A;  4XWX A;  3SO6 A;  5CLQ B;  1J19 A;  5KQ4 A;  3BIN A;  2ROV A;  4Y94 A;  5JLJ B;  1TXD A;  1V5P A;  2DYN A;  2Y7B A;  2DFK A;  2G35 A;  2NMB A;  1MKE A;  4A5K A;  1IRS A;  4HB3 B;  4HDO A;  2OTX A;  3VOQ A;  5C6R A;  2DHK A;  4K81 A;  3ULC A;  1RJ2 A;  3UZT A;  5GOW B;  1XR0 B;  2RGN B;  1V89 A;  4YON A;  1W1D A;  4IFS A;  3KSY A;  1H4R A;  1GC7 A;  3KRW A;  5D27 A;  5KQ1 A;  4K2O A;  1LW3 A;  3U8Z A;  2MFQ A;  5C79 A;  2AEH A;  1DDV A;  4HB2 B;  2KUP A;  3TO1 A;  2YRY A;  5D3X A;  1M7R A;  1Y5O A;  1W1G A;  2EJ8 A;  3DXD A;  1XD4 A;  1H10 A;  1LB1 A;  2BCJ A;  1I7A A;  3KRX A;  3CIK A;  3PVU A;  4GN1 A;  1V5U A;  1SGH A;  4F7U P;  1QC6 A;  1U5G A;  1KZ7 A;  2I1K A;  3ZDT A;  2YT0 A;  3SV1 A;  1GG3 A;  1PLS A;  2M14 A;  4GXB A;  5FI0 A;  2K2U A;  2LKO A;  1UNQ A;  4HB4 B;  3LJU X;  2CAY A;  2P0F A;  2D9Y A;  3WA0 A;  2N23 A;  5JHH A;  2YS1 A;  5J3T A;  2Q13 A;  1ISN A;  3CXB B;  1U2B A;  3M1I B;  2W2X C;  2DA0 A;  4GZU A;  2J0K A;  2Z0P A;  4DX8 A;  3O96 A;  1I2H A;  1N3H A;  3G9W A;  5DHA B;  2ROZ B;  5J3Q A;  2EMS A;  1BTK A;  4Z2M B;  2QKL A;  2ZPY A;  1X1F A;  1NI2 A;  3AJ4 A;  1K5G B;  2CRF A;  3SNH A;  3ODO A;  3SYX A;  3WYF B;  3PVL A;  1E5W A;  2Z0O A;  4PQ0 A;  2RLO A;  1X86 A;  3A98 B;  1U27 A;  2D11 A;  4A6H A;  5DIF B;  4WVF B;  3AU4 A;  1NTV A;  4BBK A;  2LOX A;  3PEG A;  1SHC A;  5HE0 A;  2E2X A;  4L6E A;  2COD A;  3PG7 A;  2R0D A;  1NTY A;  1OQN A;  2LYD A;  1RRP B;  1U5D A;  1BWN A;  3MPX A;  4MT7 A;  2VRW B;  1TQZ A;  2LG1 A;  2YS3 A;  2DX5 A;  3D8F A;  4IOY X;  5HE3 A;  2UZR A;  3SUZ A;  2CY5 A;  2L1C A;  2YSZ A;  2JP2 A;  3U7D A;  4NSW A;  5D3Y A;  2P0H A;  1BTN A;  2GS0 A;  2OQB A;  5CLL B;  2GJY A;  1ZM0 A;  3GYO A;  2VKI A;  4EJN A;  5L81 A;  1UEF A;  1P5T A;  1P3R A;  4HAW B;  2AL6 A;  3BJI A;  1QQG A;  4HHV A;  2VSZ A;  2X18 A;  5LOP B;  2DYQ A;  2K2J A; 
#chains in the Genus database with same CATH topology
 5LON B;  4NY0 A;  2W2W A;  3PVW A;  4KHB A;  4A6F A;  1X05 A;  1UPQ A;  1X1G A;  4KHB B;  4A6F B;  4HAU B;  3KZ1 A;  1WGQ A;  2YVC A;  1XKE A;  4IAP A;  1X11 A;  2R2Y A;  4F7G A;  1FHX A;  2Z0Q A;  1W1H A;  3IVF A;  4GMV A;  3HK0 A;  4GOU A;  3PSC A;  2J59 M;  3OHM B;  4WJ7 A;  2D2Q A;  4D0N B;  4HAV B;  2Z13 A;  2D4Q A;  5IRS A;  3TFM A;  4DBB A;  1U5F A;  5C5B A;  4Z2N A;  2K49 A;  4KAX B;  5C5B B;  3P6A A;  4TYZ A;  2LUL A;  3NW8 A;  4DIX A;  1WJM A;  4HAX B;  2W2X D;  1KZG A;  2PZ1 A;  1DBH A;  2KIE A;  2YF0 A;  3FSS A;  3PZD A;  4A6K A;  4GNK B;  3A8P A;  4ZRK A;  4KHO A;  4MY6 A;  4HAT B;  4EKU A;  1ZSQ A;  2KGX B;  1WGU A;  2P0D A;  5FI1 A;  2J0J A;  3DXE A;  1WG7 A;  4H8S A;  3ULB A;  3ML4 A;  1EGX A;  2D9V A;  2FJL A;  5JHG A;  1MIZ B;  2COA A;  1EF1 A;  1ZVR A;  2H7E A;  3ODW A;  5JP4 A;  3F5R A;  4CSQ A;  2DX1 A;  2KIG A;  3NWA A;  3PP2 A;  2R09 A;  1J0W A;  3MDB C;  1NU2 A;  3P7Z A;  1T77 A;  2RUK B;  2Y8G A;  1XCG A;  4QXA B;  2UZS A;  3F0W A;  4K2P A;  2N0Y A;  3A8Q A;  4PNK A;  1EVH A;  1V88 A;  1PMS A;  2Z14 A;  2Z59 A;  1V61 A;  1OMW A;  3GYP A;  1FOE A;  1P6S A;  4MK0 A;  1WVH A;  2D10 A;  3FEH A;  5D3W A;  3NSU A;  2I5C A;  2V76 A;  1AWE A;  1WI1 A;  2DHI A;  2IFS A;  2Y8F A;  1FHO A;  2KCJ A;  4QJ3 B;  3OAN A;  2DN6 A;  3U12 A;  1Q67 A;  1DDM A;  1XOD A;  1FGY A;  3FM8 C;  4WSF A;  1FB8 A;  3HW2 B;  2ELA A;  4CHM A;  3QWM A;  1MK7 B;  3N7C A;  3ODX A;  4HB0 B;  2RNR B;  3X23 A;  1U29 A;  1ZC3 B;  2GCJ A;  2HE7 A;  2EC1 A;  2LOZ A;  3TCA A;  3TW1 A;  3KY9 A;  3QIJ A;  4CYE A;  3VIA A;  4F7H A;  4ZRI A;  3RCP A;  2CY4 A;  3V5W A;  4P7I A;  2P8V A;  1KI1 B;  2DHJ A;  2YT2 A;  3D8D A;  2IYB A;  2HTH B;  4GPT B;  2EMT A;  1V5M A;  1GC6 A;  1Y19 B;  4QJ4 B;  2XQN M;  2H7D A;  1K5D B;  2D9Z A;  1U5E A;  2NZ8 B;  2QKM A;  4HAZ B;  5D3V A;  3HQC A;  4KHA A;  4DX9 0;  4HDQ A;  1TJ6 A;  2UVM A;  2DLW A;  1MK9 B;  2MDX A;  5C16 A;  1OY2 A;  5I2S A;  2DKP A;  1UNR A;  4OT1 A;  3T06 A;  2ELB A;  2ADZ A;  4ZRJ A;  3DXC A;  3QBV B;  5DHF B;  1MPH A;  2RVB B;  1FAO A;  2COF A;  2DKQ A;  2D9X A;  1EAZ A;  2DTC A;  2K8E A;  4YL8 A;  2L2I A;  2MWN B;  4DXA B;  1M7E A;  2M38 A;  4CHJ A;  1DRO A;  1FHW A;  3NWD A;  1AQC A;  2I1J A;  4HAY B;  1DYN A;  1XX0 A;  3HIE A;  1MIX A;  4TKN A;  4KVG B;  5DH9 B;  5HE2 A;  1B55 A;  2RRF A;  1ZC4 B;  5J3Y A;  2YT1 A;  5EFX A;  1WJ1 A;  5M4Y B;  4EMO A;  1ZYI A;  2J0M A;  2YS5 A;  3TVV A;  3AU5 A;  1UNP A;  5DI9 B;  1MAI A;  5HE1 A;  4OSN A;  2I5F A;  1FGZ A;  1PFJ A;  3FVC A;  4C0A A;  1BAK A;  3D8E A;  1Z87 A;  4GMX B;  4D6W A;  1UPR A;  2D9W A;  4B6H A;  2GCL A;  2COC A;  3A58 A;  4K17 A;  5KCV A;  2RSG A;  1DDW A;  3ZVR A;  2MKR A;  2K00 A;  4XWX A;  3SO6 A;  5CLQ B;  1J19 A;  5KQ4 A;  3BIN A;  2ROV A;  4Y94 A;  4L1R A;  5JLJ B;  1TXD A;  1V5P A;  2DYN A;  2Y7B A;  2DFK A;  2G35 A;  2NMB A;  1MKE A;  4A5K A;  1IRS A;  4HB3 B;  4HDO A;  2OTX A;  3VOQ A;  5C6R A;  2DHK A;  4K81 A;  3ULC A;  1RJ2 A;  3UZT A;  5GOW B;  1XR0 B;  2RGN B;  1V89 A;  4YON A;  1W1D A;  4IFS A;  1H4R A;  3KSY A;  1GC7 A;  3KRW A;  5D27 A;  5KQ1 A;  4K2O A;  1LW3 A;  3U8Z A;  2MFQ A;  5C79 A;  2AEH A;  1DDV A;  4HB2 B;  2KUP A;  3TO1 A;  2YRY A;  5D3X A;  1M7R A;  5I2M A;  1Y5O A;  1W1G A;  2EJ8 A;  3DXD A;  1XD4 A;  1H10 A;  1LB1 A;  2BCJ A;  1I7A A;  3KRX A;  3CIK A;  3PVU A;  2NBV A;  4GN1 A;  1V5U A;  1SGH A;  4F7U P;  1QC6 A;  1U5G A;  1KZ7 A;  2I1K A;  3ZDT A;  2YT0 A;  3SV1 A;  1GG3 A;  1PLS A;  2M14 A;  4GXB A;  5FI0 A;  2K2U A;  2LKO A;  1UNQ A;  4HB4 B;  3LJU X;  2CAY A;  2P0F A;  2D9Y A;  3WA0 A;  2N23 A;  5JHH A;  2YS1 A;  5J3T A;  2Q13 A;  1ISN A;  3CXB B;  1U2B A;  3M1I B;  2W2X C;  2DA0 A;  4GZU A;  2J0K A;  2Z0P A;  4DX8 A;  3O96 A;  1I2H A;  1N3H A;  3G9W A;  5DHA B;  2ROZ B;  5J3Q A;  2EMS A;  1BTK A;  4Z2M B;  2QKL A;  2ZPY A;  2FJU B;  1X1F A;  1NI2 A;  3AJ4 A;  1K5G B;  2CRF A;  3SNH A;  3ODO A;  3SYX A;  3WYF B;  3HSA A;  3PVL A;  1E5W A;  2Z0O A;  4PQ0 A;  2RLO A;  1X86 A;  2ZKM X;  3A98 B;  1U27 A;  2D11 A;  4A6H A;  5DIF B;  2Z4D A;  4WVF B;  3AU4 A;  1NTV A;  5LG4 B;  4BBK A;  2LOX A;  3PEG A;  1SHC A;  5HE0 A;  2E2X A;  4L6E A;  2COD A;  3PG7 A;  2R0D A;  1NTY A;  1OQN A;  2LYD A;  1RRP B;  1U5D A;  1BWN A;  3MPX A;  4MT7 A;  2GUM A;  2VRW B;  1TQZ A;  2KUQ A;  2LG1 A;  2YS3 A;  2DX5 A;  3D8F A;  4IOY X;  5HE3 A;  2UZR A;  3SUZ A;  4QJ5 B;  2CY5 A;  2L1C A;  2YSZ A;  1MI1 A;  2JP2 A;  3U7D A;  4NSW A;  5D3Y A;  2P0H A;  1BTN A;  2GS0 A;  2OQB A;  5CLL B;  2GJY A;  1ZM0 A;  3GYO A;  2VKI A;  2KR0 A;  4EJN A;  5L81 A;  4HSI A;  1UEF A;  3NWF A;  1P5T A;  1P3R A;  4HAW B;  2AL6 A;  3BJI A;  1QQG A;  3B77 A;  4HHV A;  2VSZ A;  2X18 A;  5LOP B;  2DYQ A;  3DCX A;  2K2J A; 
#chains in the Genus database with same CATH homology
 5LON B;  4NY0 A;  2W2W A;  3PVW A;  4A6F A;  1X05 A;  1UPQ A;  1X1G A;  4KHB B;  4A6F B;  4HAU B;  3KZ1 A;  1WGQ A;  2YVC A;  1XKE A;  4IAP A;  1X11 A;  4F7G A;  1FHX A;  2Z0Q A;  1W1H A;  3IVF A;  4GMV A;  3HK0 A;  3PSC A;  2J59 M;  4WJ7 A;  2D2Q A;  4D0N B;  4HAV B;  2D4Q A;  3TFM A;  4DBB A;  1U5F A;  5C5B A;  4Z2N A;  4KAX B;  5C5B B;  3P6A A;  4TYZ A;  2LUL A;  1WJM A;  4HAX B;  2W2X D;  1KZG A;  2PZ1 A;  1DBH A;  2YF0 A;  3FSS A;  3PZD A;  4A6K A;  3A8P A;  4ZRK A;  4KHO A;  4MY6 A;  4HAT B;  4EKU A;  1ZSQ A;  2KGX B;  1WGU A;  2P0D A;  5FI1 A;  2J0J A;  3DXE A;  1WG7 A;  4H8S A;  3ULB A;  3ML4 A;  1EGX A;  2D9V A;  2FJL A;  5JHG A;  1MIZ B;  2COA A;  1EF1 A;  1ZVR A;  2H7E A;  3ODW A;  5JP4 A;  3F5R A;  2DX1 A;  3PP2 A;  2R09 A;  1J0W A;  3MDB C;  1NU2 A;  3P7Z A;  2RUK B;  2Y8G A;  1XCG A;  2UZS A;  3F0W A;  4K2P A;  2N0Y A;  3A8Q A;  4PNK A;  1EVH A;  1V88 A;  1PMS A;  1V61 A;  1OMW A;  3GYP A;  1FOE A;  1P6S A;  4MK0 A;  1WVH A;  2D10 A;  3FEH A;  5D3W A;  3NSU A;  2I5C A;  2V76 A;  1AWE A;  1WI1 A;  2DHI A;  2IFS A;  2Y8F A;  1FHO A;  2KCJ A;  3OAN A;  2DN6 A;  1Q67 A;  1DDM A;  1XOD A;  1FGY A;  3FM8 C;  4WSF A;  1FB8 A;  3HW2 B;  2ELA A;  4CHM A;  3QWM A;  1MK7 B;  3N7C A;  3ODX A;  4HB0 B;  2RNR B;  3X23 A;  1U29 A;  1ZC3 B;  2GCJ A;  2HE7 A;  2EC1 A;  2LOZ A;  3TCA A;  3TW1 A;  3KY9 A;  3QIJ A;  4CYE A;  3VIA A;  4F7H A;  4ZRI A;  3RCP A;  2CY4 A;  3V5W A;  4P7I A;  2P8V A;  1KI1 B;  2DHJ A;  3D8D A;  2IYB A;  2HTH B;  4GPT B;  2EMT A;  1V5M A;  1GC6 A;  1Y19 B;  2XQN M;  2H7D A;  1K5D B;  2D9Z A;  1U5E A;  2NZ8 B;  2QKM A;  4HAZ B;  5D3V A;  3HQC A;  4KHA A;  4DX9 0;  4HDQ A;  1TJ6 A;  2UVM A;  2DLW A;  1MK9 B;  2MDX A;  5C16 A;  1OY2 A;  2DKP A;  1UNR A;  3T06 A;  2ELB A;  2ADZ A;  4ZRJ A;  3DXC A;  3QBV B;  5DHF B;  1MPH A;  2RVB B;  1FAO A;  2COF A;  2DKQ A;  2D9X A;  1EAZ A;  2DTC A;  4YL8 A;  2L2I A;  2MWN B;  4DXA B;  1M7E A;  2M38 A;  4CHJ A;  1DRO A;  1FHW A;  1AQC A;  2I1J A;  4HAY B;  1DYN A;  1XX0 A;  1MIX A;  4TKN A;  4KVG B;  5DH9 B;  5HE2 A;  1B55 A;  1ZC4 B;  5J3Y A;  2YT1 A;  5EFX A;  1WJ1 A;  4EMO A;  2J0M A;  2YS5 A;  3TVV A;  3AU5 A;  1UNP A;  5DI9 B;  1MAI A;  5HE1 A;  2I5F A;  1FGZ A;  1PFJ A;  1BAK A;  4C0A A;  3D8E A;  1Z87 A;  4GMX B;  1UPR A;  2D9W A;  4B6H A;  2GCL A;  2COC A;  4K17 A;  5KCV A;  2RSG A;  1DDW A;  3ZVR A;  2MKR A;  2K00 A;  4XWX A;  3SO6 A;  5CLQ B;  1J19 A;  5KQ4 A;  3BIN A;  2ROV A;  4Y94 A;  5JLJ B;  1TXD A;  1V5P A;  2DYN A;  2Y7B A;  2DFK A;  2G35 A;  2NMB A;  1MKE A;  4A5K A;  1IRS A;  4HB3 B;  4HDO A;  2OTX A;  3VOQ A;  5C6R A;  2DHK A;  4K81 A;  3ULC A;  1RJ2 A;  3UZT A;  5GOW B;  1XR0 B;  2RGN B;  1V89 A;  4YON A;  1W1D A;  4IFS A;  3KSY A;  1H4R A;  1GC7 A;  3KRW A;  5D27 A;  5KQ1 A;  4K2O A;  1LW3 A;  3U8Z A;  2MFQ A;  5C79 A;  2AEH A;  1DDV A;  4HB2 B;  2KUP A;  3TO1 A;  2YRY A;  5D3X A;  1M7R A;  1Y5O A;  1W1G A;  2EJ8 A;  3DXD A;  1XD4 A;  1H10 A;  1LB1 A;  2BCJ A;  1I7A A;  3KRX A;  3CIK A;  3PVU A;  4GN1 A;  1V5U A;  1SGH A;  4F7U P;  1QC6 A;  1U5G A;  1KZ7 A;  2I1K A;  3ZDT A;  2YT0 A;  3SV1 A;  1GG3 A;  1PLS A;  2M14 A;  4GXB A;  5FI0 A;  2K2U A;  2LKO A;  1UNQ A;  4HB4 B;  3LJU X;  2CAY A;  2P0F A;  2D9Y A;  3WA0 A;  2N23 A;  5JHH A;  2YS1 A;  5J3T A;  2Q13 A;  1ISN A;  3CXB B;  1U2B A;  3M1I B;  2W2X C;  2DA0 A;  4GZU A;  2J0K A;  2Z0P A;  4DX8 A;  3O96 A;  1I2H A;  1N3H A;  3G9W A;  5DHA B;  2ROZ B;  5J3Q A;  2EMS A;  1BTK A;  4Z2M B;  2QKL A;  2ZPY A;  1X1F A;  1NI2 A;  3AJ4 A;  1K5G B;  2CRF A;  3SNH A;  3ODO A;  3SYX A;  3WYF B;  3PVL A;  1E5W A;  2Z0O A;  4PQ0 A;  2RLO A;  1X86 A;  3A98 B;  1U27 A;  2D11 A;  4A6H A;  5DIF B;  4WVF B;  3AU4 A;  1NTV A;  4BBK A;  2LOX A;  3PEG A;  1SHC A;  5HE0 A;  2E2X A;  4L6E A;  2COD A;  3PG7 A;  2R0D A;  1NTY A;  1OQN A;  2LYD A;  1RRP B;  1U5D A;  1BWN A;  3MPX A;  4MT7 A;  2VRW B;  1TQZ A;  2LG1 A;  2YS3 A;  2DX5 A;  3D8F A;  4IOY X;  5HE3 A;  2UZR A;  3SUZ A;  2CY5 A;  2L1C A;  2YSZ A;  2JP2 A;  3U7D A;  4NSW A;  5D3Y A;  2P0H A;  1BTN A;  2GS0 A;  2OQB A;  5CLL B;  2GJY A;  1ZM0 A;  3GYO A;  2VKI A;  4EJN A;  5L81 A;  1UEF A;  1P5T A;  1P3R A;  4HAW B;  2AL6 A;  3BJI A;  1QQG A;  4HHV A;  2VSZ A;  2X18 A;  5LOP B;  2DYQ A;  2K2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...