2KGXB

Haddock structure of the talin f3 domain in complex with talin 1655-1822
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
SFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Talin-1
publication title The structure of an interdomain complex that regulates talin activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 13
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2009-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2kgxB00
2W2XC 1FHXA 2LYDA 2P0DA 5D3VA 4Z2NA 1DDWA 1RRPB 1BAKA 2RSGA 2CY4A 3N7CA 1WJMA 3QBVB 2YS5A 2R0DA 1U5GA 2UZSA 4K2PA 5LONB 3CXBB 5GOWB 2D9ZA 2Y8GA 4MK0A 2Z0OA 2P8VA 3ML4A 1TJ6A 1GC6A 3TW1A 4DBBA 1U27A 2IYBA 1J0WA 3AU5A 3DXEA 4H8SA 1K5DB 2E2XA 2P0FA 1W1HA 4XWXA 3SV1A 2DHJA 1XX0A 3QIJA 4HDOA 3FEHA 2OTXA 3PVWA 2JP2A 3QWMA 3ZDTA 3X23A 4BBKA 1DROA 4TYZA 5JP4A 1TXDA 1Y19B 2ROVA 2LG1A 2GJYA 1XD4A 2D10A 3ODOA 4DXAB 3RCPA 1ZVRA 1UPQA 2M14A 2RUKB 1EAZA 1UNPA 2I1KA 2IFSA 5EFXA 1H10A 3DXDA 2NZ8B 1V88A 5D3YA 1AQCA 2DKPA 1NTYA 5DIFB 3A98B 3PP2A 4HHVA 5KQ1A 2OQBA 4HB2B 5JHHA 2Z0PA 1LB1A 3D8FA 4GPTB 4Y94A 2VRWB 3D8DA 1U5DA 2YSZA 3AU4A 3PSCA 3FM8C 1UPRA 2CRFA 1KZ7A 4IOYX 4B6HA 1FGYA 2AL6A 3SO6A 5DI9B 1EVHA 2DX5A 1NTVA 2DTCA 2COFA 3TFMA 4PNKA 2I5CA 4GZUA 3F0WA 3WYFB 2L2IA 4DX90 3U8ZA 3IVFA 4GMVA 4GXBA 4K81A 5DHAB 2DLWA 1QC6A 2M38A 2HE7A 1SHCA 4HAWB 3D8EA 5C16A 3HW2B 2GCJA 1UNRA 4HAUB 4C0AA 2RLOA 1X05A 5CLLB 1BTNA 1X86A 3PEGA 3MDBC 1EF1A 2X18A 2YF0A 2DX1A 1UEFA 5LOPB 5HE1A 3CIKA 4IFSA 1XKEA 3HK0A 1DBHA 2CODA 1P6SA 4HAZB 3PZDA 1KI1B 1H4RA 3OANA 5HE0A 3DXCA 2LKOA 1K5GB 1Y5OA 3MPXA 3SUZA 4GN1A 5HE2A 2MKRA 3G9WA 2KCJA 2MWNB 4MT7A 2DHKA 3WA0A 3LJUX 2Y8FA 1BTKA 2DKQA 3V5WA 4YONA 1U2BA 1B55A 3KY9A 2DFKA 2N0YA 1U5EA 2ADZA 3SNHA 2J0KA 2D2QA 1OMWA 1FHWA 2LOZA 5DH9B 3ULCA 1EGXA 3KRWA 5JLJB 1ZC3B 2DA0A 4KHAA 1FB8A 3TO1A 1FHOA 2MFQA 3KSYA 4KHOA 4EKUA 3BINA 1MK7B 4ZRIA 1XCGA 4L6EA 1E5WA 2YS1A 4CYEA 2GS0A 2LULA 5JHGA 2GCLA 2I1JA 3ZVRA 5D3XA 2CAYA 2EJ8A 4DX8A 2PZ1A 3O96A 3T06A 1W1GA 1PFJA 3VIAA 5J3TA 4GMXB 5FI1A 1WG7A 2FJLA 4KHBB 4F7GA 2J0MA 1ZM0A 5L81A 2DHIA 2AEHA 1P5TA 1V5MA 2EMTA 5C5BB 1KZGA 4HAYB 2RVBB 1UNQA 2I5FA 1NU2A 1DDVA 4HAXB 4D0NB 1AWEA 1W1DA 4A6HA 5C79A 3PVLA 5C5BA 2G35A 1MKEA 1OY2A 5CLQB 2VSZA 1DYNA 1X1GA 2W2XD 1I7AA 4K17A 1ISNA 2RNRB 1ZC4B 2DYNA 3GYOA 2ELBA 2ZPYA 3PVUA 1FAOA 5D27A 3VOQA 2D9WA 2YVCA 1I2HA 2Q13A 2DYQA 3FSSA 2VKIA 5KQ4A 1Z87A 4KAXB 2J0JA 2UZRA 4ZRJA 1SGHA 1QQGA 3HQCA 4WSFA 2R09A 4NSWA 1PMSA 2H7DA 4P7IA 4PQ0A 2LOXA 1X1FA 2P0HA 1BWNA 5DHFB 3SYXA 2QKLA 1DDMA 1U29A 3KZ1A 2YT1A 4HDQA 2H7EA 4F7UP 1WGUA 1V89A 4CHMA 4A6FB 5C6RA 3M1IB 4TKNA 4ZRKA 2YRYA 2KGXB 1V5UA 1WI1A 2MDXA 4MY6A 4A6FA 1GC7A 1Q67A 2D4QA 1XODA 2D9VA 2J59M 4A6KA 1WJ1A 5FI0A 3U7DA 4HB4B 1XR0B 4HAVB 2Y7BA 3TCAA 2DN6A 1TQZA 2QKMA 4EMOA 1ZSQA 3A8QA 1MIZB 1X11A 1LW3A 1U5FA 3PG7A 2EMSA 1MIXA 3F5RA 2YS3A 2ROZB 2V76A 3TVVA 4WJ7A 4HB3B 1IRSA 4A5KA 4WVFB 1NI2A 1RJ2A 4IAPA 2ELAA 1J19A 1MAIA 2W2WA 5HE3A 4NY0A 2NMBA 4YL8A 2CY5A 1M7EA 1OQNA 2K00A 3NSUA 3ULBA 3BJIA 4K2OA 2K2JA 3UZTA 3ODWA 3A8PA 4HATB 2COAA 2D9XA 1P3RA 3AJ4A 2BCJA 1MK9B 2N23A 5D3WA 2L1CA 1MPHA 5J3YA 2Z0QA 4Z2MB 1V61A 5J3QA 1M7RA 4F7HA 1N3HA 1PLSA 2K2UA 3KRXA 4HB0B 2D11A 2YT0A 2D9YA 3P7ZA 2RGNB 1WGQA 2EC1A 2KUPA 1FGZA 2XQNM 2HTHB 1V5PA 2COCA 4CHJA 4EJNA 2UVMA 4KVGB 1WVHA 1GG3A 3P6AA 1FOEA 3ODXA 5KCVA 3GYPA
chains in the Genus database with same CATH superfamily
3HIEA 2W2XC 1FHXA 2LYDA 2P0DA 5D3VA 4Z2NA 3HSAA 1DDWA 1RRPB 1BAKA 2RSGA 2CY4A 3N7CA 1WJMA 3QBVB 2YS5A 2R0DA 1U5GA 1T77A 2UZSA 4K2PA 5LONB 3CXBB 5GOWB 2D9ZA 2Y8GA 4MK0A 2Z0OA 2P8VA 3ML4A 1TJ6A 2NBVA 1GC6A 3TW1A 4DBBA 1U27A 2IYBA 1J0WA 3AU5A 2GUMA 3DXEA 4H8SA 1K5DB 2E2XA 2P0FA 1W1HA 4XWXA 3SV1A 2DHJA 1XX0A 3QIJA 4HDOA 3FEHA 2OTXA 4GNKB 4QJ5B 3PVWA 2JP2A 2YT2A 3QWMA 4OSNA 3ZDTA 3X23A 4BBKA 1DROA 4TYZA 5JP4A 3NW8A 1TXDA 3NWAA 1Y19B 2ROVA 2LG1A 2ZKMX 2GJYA 1XD4A 2D10A 3ODOA 4DXAB 3RCPA 1ZVRA 1UPQA 2M14A 2RUKB 1EAZA 1UNPA 2I1KA 2IFSA 5EFXA 1H10A 3DXDA 2NZ8B 1V88A 5D3YA 1AQCA 2DKPA 1NTYA 5DIFB 4CSQA 2KIGA 3A98B 3PP2A 4HHVA 5KQ1A 2OQBA 4HB2B 5JHHA 2Z0PA 1LB1A 3D8FA 4GPTB 4Y94A 2VRWB 3D8DA 1U5DA 2YSZA 3AU4A 3PSCA 3FM8C 1UPRA 2CRFA 1KZ7A 4IOYX 4B6HA 1FGYA 2AL6A 3SO6A 5DI9B 1EVHA 2DX5A 1NTVA 2DTCA 2COFA 3TFMA 4PNKA 3B77A 2I5CA 4GZUA 3F0WA 3WYFB 2L2IA 4DX90 3U8ZA 3IVFA 4GMVA 4GXBA 4K81A 4GOUA 5DHAB 2DLWA 1QC6A 2Z14A 2M38A 2HE7A 1SHCA 4HAWB 3D8EA 5C16A 3HW2B 2GCJA 1UNRA 4HAUB 4C0AA 5LG4B 2RLOA 1X05A 5CLLB 1BTNA 1X86A 3PEGA 3MDBC 1EF1A 3U12A 2X18A 2YF0A 2DX1A 1UEFA 5LOPB 5HE1A 3CIKA 4IFSA 1XKEA 3HK0A 1DBHA 2CODA 1P6SA 4HAZB 3PZDA 4L1RA 1KI1B 1H4RA 3OANA 5HE0A 3DXCA 2LKOA 1K5GB 1Y5OA 3MPXA 3SUZA 4GN1A 3OHMB 5HE2A 2MKRA 3G9WA 2KCJA 5IRSA 2MWNB 4MT7A 2DHKA 3WA0A 3LJUX 2Y8FA 1BTKA 2DKQA 3V5WA 4YONA 1U2BA 3P6AA 1B55A 3KY9A 2DFKA 2N0YA 1U5EA 2ADZA 4QJ3B 3SNHA 2J0KA 2D2QA 1OMWA 1FHWA 2LOZA 5DH9B 3ULCA 1EGXA 3KRWA 5JLJB 1ZC3B 2DA0A 4KHAA 1FB8A 2KUQA 3TO1A 1FHOA 3DCXA 2RRFA 2MFQA 3KSYA 4KHOA 4EKUA 3BINA 1MK7B 4ZRIA 1XCGA 4L6EA 1E5WA 2YS1A 4CYEA 2GS0A 2LULA 5JHGA 3FVCA 2GCLA 2I1JA 3ZVRA 5D3XA 2CAYA 2EJ8A 4DX8A 2PZ1A 2Z59A 3O96A 3T06A 4OT1A 1W1GA 1PFJA 3VIAA 5J3TA 2KIEA 4GMXB 5FI1A 1WG7A 2FJLA 4KHBB 4F7GA 2J0MA 1ZM0A 5L81A 3A58A 2DHIA 2AEHA 1P5TA 1V5MA 2EMTA 5C5BB 1KZGA 4HAYB 2RVBB 1UNQA 1ZYIA 2I5FA 4KHBA 1NU2A 1DDVA 2FJUB 4HAXB 4D0NB 1AWEA 1W1DA 4A6HA 5C79A 3PVLA 5C5BA 2G35A 1MKEA 1OY2A 5CLQB 2VSZA 1DYNA 1X1GA 2W2XD 1I7AA 4K17A 1ISNA 2RNRB 5M4YB 1ZC4B 2DYNA 3GYOA 2ELBA 2ZPYA 3PVUA 1FAOA 5D27A 3VOQA 2D9WA 2YVCA 1I2HA 5I2MA 2Q13A 2DYQA 3FSSA 2VKIA 5KQ4A 4QXAB 1Z87A 4KAXB 2J0JA 2Z4DA 2UZRA 4ZRJA 1SGHA 4D6WA 1QQGA 3HQCA 4WSFA 2R09A 4NSWA 1PMSA 2H7DA 4P7IA 4PQ0A 2LOXA 1X1FA 2P0HA 1BWNA 5DHFB 3SYXA 5I2SA 2QKLA 4DIXA 1DDMA 1U29A 3KZ1A 2YT1A 4HDQA 2H7EA 4F7UP 1WGUA 1V89A 4CHMA 4A6FB 5C6RA 3M1IB 4TKNA 4ZRKA 2YRYA 2KGXB 1V5UA 1WI1A 2MDXA 4MY6A 4A6FA 1GC7A 1Q67A 2D4QA 1XODA 2D9VA 2J59M 4A6KA 1WJ1A 5FI0A 3U7DA 4HB4B 1XR0B 4HAVB 2Y7BA 3TCAA 2DN6A 1TQZA 2QKMA 4EMOA 1ZSQA 3A8QA 1MIZB 1X11A 1LW3A 1U5FA 3PG7A 2EMSA 1MIXA 3F5RA 2YS3A 2ROZB 1MI1A 2V76A 3TVVA 4WJ7A 4HB3B 1IRSA 4A5KA 4WVFB 2K49A 1NI2A 1RJ2A 4IAPA 1J19A 1MAIA 2W2WA 5HE3A 2Z13A 3NWDA 4NY0A 2NMBA 4YL8A 2CY5A 1M7EA 1OQNA 2K00A 3NSUA 3ULBA 3BJIA 4K2OA 2K8EA 2K2JA 3UZTA 3ODWA 3A8PA 4HATB 2COAA 2D9XA 2R2YA 1P3RA 3AJ4A 2BCJA 3NWFA 1MK9B 2N23A 5D3WA 2L1CA 1MPHA 5J3YA 2Z0QA 4Z2MB 1V61A 5J3QA 1M7RA 4F7HA 1N3HA 1PLSA 2K2UA 3KRXA 4HB0B 2D11A 2YT0A 2D9YA 3P7ZA 2RGNB 1WGQA 2EC1A 4HSIA 2KUPA 1FGZA 2XQNM 2HTHB 2KR0A 1V5PA 2COCA 4CHJA 4EJNA 2UVMA 4KVGB 4QJ4B 1WVHA 1GG3A 2ELAA 1FOEA 3ODXA 5KCVA 3GYPA
chains in the Genus database with same CATH topology
2W2XC 1FHXA 2LYDA 2P0DA 5D3VA 4Z2NA 1DDWA 1RRPB 1BAKA 2RSGA 2CY4A 3N7CA 1WJMA 3QBVB 2YS5A 2R0DA 1U5GA 2UZSA 4K2PA 5LONB 3CXBB 5GOWB 2D9ZA 2Y8GA 4MK0A 2Z0OA 2P8VA 3ML4A 1TJ6A 1GC6A 3TW1A 4DBBA 1U27A 2IYBA 1J0WA 3AU5A 3DXEA 4H8SA 1K5DB 2E2XA 2P0FA 1W1HA 4XWXA 3SV1A 2DHJA 1XX0A 3QIJA 4HDOA 3FEHA 2OTXA 3PVWA 2JP2A 3QWMA 3ZDTA 3X23A 4BBKA 1DROA 4TYZA 5JP4A 1TXDA 1Y19B 2ROVA 2LG1A 2GJYA 1XD4A 2D10A 3ODOA 4DXAB 3RCPA 1ZVRA 1UPQA 2M14A 2RUKB 1EAZA 1UNPA 2I1KA 2IFSA 5EFXA 1H10A 3DXDA 2NZ8B 1V88A 5D3YA 1AQCA 2DKPA 1NTYA 5DIFB 3A98B 3PP2A 4HHVA 5KQ1A 2OQBA 4HB2B 5JHHA 2Z0PA 1LB1A 3D8FA 4GPTB 4Y94A 2VRWB 3D8DA 1U5DA 2YSZA 3AU4A 3PSCA 3FM8C 1UPRA 2CRFA 1KZ7A 4IOYX 4B6HA 1FGYA 2AL6A 3SO6A 5DI9B 1EVHA 2DX5A 1NTVA 2DTCA 2COFA 3TFMA 4PNKA 2I5CA 4GZUA 3F0WA 3WYFB 2L2IA 4DX90 3U8ZA 3IVFA 4GMVA 4GXBA 4K81A 5DHAB 2DLWA 1QC6A 2M38A 2HE7A 1SHCA 4HAWB 3D8EA 5C16A 3HW2B 2GCJA 1UNRA 4HAUB 4C0AA 2RLOA 1X05A 5CLLB 1BTNA 1X86A 3PEGA 3MDBC 1EF1A 2X18A 2YF0A 2DX1A 1UEFA 5LOPB 5HE1A 3CIKA 4IFSA 1XKEA 3HK0A 1DBHA 2CODA 1P6SA 4HAZB 3PZDA 1KI1B 1H4RA 3OANA 5HE0A 3DXCA 2LKOA 1K5GB 1Y5OA 3MPXA 3SUZA 4GN1A 5HE2A 2MKRA 3G9WA 2KCJA 2MWNB 4MT7A 2DHKA 3WA0A 3LJUX 2Y8FA 1BTKA 2DKQA 3V5WA 4YONA 1U2BA 1B55A 3KY9A 2DFKA 2N0YA 1U5EA 2ADZA 3SNHA 2J0KA 2D2QA 1OMWA 1FHWA 2LOZA 5DH9B 3ULCA 1EGXA 3KRWA 5JLJB 1ZC3B 2DA0A 4KHAA 1FB8A 3TO1A 1FHOA 2MFQA 3KSYA 4KHOA 4EKUA 3BINA 1MK7B 4ZRIA 1XCGA 4L6EA 1E5WA 2YS1A 4CYEA 2GS0A 2LULA 5JHGA 2GCLA 2I1JA 3ZVRA 5D3XA 2CAYA 2EJ8A 4DX8A 2PZ1A 3O96A 3T06A 1W1GA 1PFJA 3VIAA 5J3TA 4GMXB 5FI1A 1WG7A 2FJLA 4KHBB 4F7GA 2J0MA 1ZM0A 5L81A 2DHIA 2AEHA 1P5TA 1V5MA 2EMTA 5C5BB 1KZGA 4HAYB 2RVBB 1UNQA 2I5FA 1NU2A 1DDVA 4HAXB 4D0NB 1AWEA 1W1DA 4A6HA 5C79A 3PVLA 5C5BA 2G35A 1MKEA 1OY2A 5CLQB 2VSZA 1DYNA 1X1GA 2W2XD 1I7AA 4K17A 1ISNA 2RNRB 1ZC4B 2DYNA 3GYOA 2ELBA 2ZPYA 3PVUA 1FAOA 5D27A 3VOQA 2D9WA 2YVCA 1I2HA 2Q13A 2DYQA 3FSSA 2VKIA 5KQ4A 1Z87A 4KAXB 2J0JA 2UZRA 4ZRJA 1SGHA 1QQGA 3HQCA 4WSFA 2R09A 4NSWA 1PMSA 2H7DA 4P7IA 4PQ0A 2LOXA 1X1FA 2P0HA 1BWNA 5DHFB 3SYXA 2QKLA 1DDMA 1U29A 3KZ1A 2YT1A 4HDQA 2H7EA 4F7UP 1WGUA 1V89A 4CHMA 4A6FB 5C6RA 3M1IB 4TKNA 4ZRKA 2YRYA 2KGXB 1V5UA 1WI1A 2MDXA 4MY6A 4A6FA 1GC7A 1Q67A 2D4QA 1XODA 2D9VA 2J59M 4A6KA 1WJ1A 5FI0A 3U7DA 4HB4B 1XR0B 4HAVB 2Y7BA 3TCAA 2DN6A 1TQZA 2QKMA 4EMOA 1ZSQA 3A8QA 1MIZB 1X11A 1LW3A 1U5FA 3PG7A 2EMSA 1MIXA 3F5RA 2YS3A 2ROZB 2V76A 3TVVA 4WJ7A 4HB3B 1IRSA 4A5KA 4WVFB 1NI2A 1RJ2A 4IAPA 2ELAA 1J19A 1MAIA 2W2WA 5HE3A 4NY0A 2NMBA 4YL8A 2CY5A 1M7EA 1OQNA 2K00A 3NSUA 3ULBA 3BJIA 4K2OA 2K2JA 3UZTA 3ODWA 3A8PA 4HATB 2COAA 2D9XA 1P3RA 3AJ4A 2BCJA 1MK9B 2N23A 5D3WA 2L1CA 1MPHA 5J3YA 2Z0QA 4Z2MB 1V61A 5J3QA 1M7RA 4F7HA 1N3HA 1PLSA 2K2UA 3KRXA 4HB0B 2D11A 2YT0A 2D9YA 3P7ZA 2RGNB 1WGQA 2EC1A 2KUPA 1FGZA 2XQNM 2HTHB 1V5PA 2COCA 4CHJA 4EJNA 2UVMA 4KVGB 1WVHA 1GG3A 3P6AA 1FOEA 3ODXA 5KCVA 3GYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2X C;  1FHX A;  2LYD A;  2P0D A;  5D3V A;  4Z2N A;  1DDW A;  1RRP B;  1BAK A;  2RSG A;  2CY4 A;  3N7C A;  1WJM A;  3QBV B;  2YS5 A;  2R0D A;  1U5G A;  2UZS A;  4K2P A;  5LON B;  3CXB B;  5GOW B;  2D9Z A;  2Y8G A;  4MK0 A;  2Z0O A;  2P8V A;  3ML4 A;  1TJ6 A;  1GC6 A;  3TW1 A;  4DBB A;  1U27 A;  2IYB A;  1J0W A;  3AU5 A;  3DXE A;  4H8S A;  1K5D B;  2E2X A;  2P0F A;  1W1H A;  4XWX A;  3SV1 A;  2DHJ A;  1XX0 A;  3QIJ A;  4HDO A;  3FEH A;  2OTX A;  3PVW A;  2JP2 A;  3QWM A;  3ZDT A;  3X23 A;  4BBK A;  1DRO A;  4TYZ A;  5JP4 A;  1TXD A;  1Y19 B;  2ROV A;  2LG1 A;  2GJY A;  1XD4 A;  2D10 A;  3ODO A;  4DXA B;  3RCP A;  1ZVR A;  1UPQ A;  2M14 A;  2RUK B;  1EAZ A;  1UNP A;  2I1K A;  2IFS A;  5EFX A;  1H10 A;  3DXD A;  2NZ8 B;  1V88 A;  5D3Y A;  1AQC A;  2DKP A;  1NTY A;  5DIF B;  3A98 B;  3PP2 A;  4HHV A;  5KQ1 A;  2OQB A;  4HB2 B;  5JHH A;  2Z0P A;  1LB1 A;  3D8F A;  4GPT B;  4Y94 A;  2VRW B;  3D8D A;  1U5D A;  2YSZ A;  3AU4 A;  3PSC A;  3FM8 C;  1UPR A;  2CRF A;  1KZ7 A;  4IOY X;  4B6H A;  1FGY A;  2AL6 A;  3SO6 A;  5DI9 B;  1EVH A;  2DX5 A;  1NTV A;  2DTC A;  2COF A;  3TFM A;  4PNK A;  2I5C A;  4GZU A;  3F0W A;  3WYF B;  2L2I A;  4DX9 0;  3U8Z A;  3IVF A;  4GMV A;  4GXB A;  4K81 A;  5DHA B;  2DLW A;  1QC6 A;  2M38 A;  2HE7 A;  1SHC A;  4HAW B;  3D8E A;  5C16 A;  3HW2 B;  2GCJ A;  1UNR A;  4HAU B;  4C0A A;  2RLO A;  1X05 A;  5CLL B;  1BTN A;  1X86 A;  3PEG A;  3MDB C;  1EF1 A;  2X18 A;  2YF0 A;  2DX1 A;  1UEF A;  5LOP B;  5HE1 A;  3CIK A;  4IFS A;  1XKE A;  3HK0 A;  1DBH A;  2COD A;  1P6S A;  4HAZ B;  3PZD A;  1KI1 B;  1H4R A;  3OAN A;  5HE0 A;  3DXC A;  2LKO A;  1K5G B;  1Y5O A;  3MPX A;  3SUZ A;  4GN1 A;  5HE2 A;  2MKR A;  3G9W A;  2KCJ A;  2MWN B;  4MT7 A;  2DHK A;  3WA0 A;  3LJU X;  2Y8F A;  1BTK A;  2DKQ A;  3V5W A;  4YON A;  1U2B A;  1B55 A;  3KY9 A;  2DFK A;  2N0Y A;  1U5E A;  2ADZ A;  3SNH A;  2J0K A;  2D2Q A;  1OMW A;  1FHW A;  2LOZ A;  5DH9 B;  3ULC A;  1EGX A;  3KRW A;  5JLJ B;  1ZC3 B;  2DA0 A;  4KHA A;  1FB8 A;  3TO1 A;  1FHO A;  2MFQ A;  3KSY A;  4KHO A;  4EKU A;  3BIN A;  1MK7 B;  4ZRI A;  1XCG A;  4L6E A;  1E5W A;  2YS1 A;  4CYE A;  2GS0 A;  2LUL A;  5JHG A;  2GCL A;  2I1J A;  3ZVR A;  5D3X A;  2CAY A;  2EJ8 A;  4DX8 A;  2PZ1 A;  3O96 A;  3T06 A;  1W1G A;  1PFJ A;  3VIA A;  5J3T A;  4GMX B;  5FI1 A;  1WG7 A;  2FJL A;  4KHB B;  4F7G A;  2J0M A;  1ZM0 A;  5L81 A;  2DHI A;  2AEH A;  1P5T A;  1V5M A;  2EMT A;  5C5B B;  1KZG A;  4HAY B;  2RVB B;  1UNQ A;  2I5F A;  1NU2 A;  1DDV A;  4HAX B;  4D0N B;  1AWE A;  1W1D A;  4A6H A;  5C79 A;  3PVL A;  5C5B A;  2G35 A;  1MKE A;  1OY2 A;  5CLQ B;  2VSZ A;  1DYN A;  1X1G A;  2W2X D;  1I7A A;  4K17 A;  1ISN A;  2RNR B;  1ZC4 B;  2DYN A;  3GYO A;  2ELB A;  2ZPY A;  3PVU A;  1FAO A;  5D27 A;  3VOQ A;  2D9W A;  2YVC A;  1I2H A;  2Q13 A;  2DYQ A;  3FSS A;  2VKI A;  5KQ4 A;  1Z87 A;  4KAX B;  2J0J A;  2UZR A;  4ZRJ A;  1SGH A;  1QQG A;  3HQC A;  4WSF A;  2R09 A;  4NSW A;  1PMS A;  2H7D A;  4P7I A;  4PQ0 A;  2LOX A;  1X1F A;  2P0H A;  1BWN A;  5DHF B;  3SYX A;  2QKL A;  1DDM A;  1U29 A;  3KZ1 A;  2YT1 A;  4HDQ A;  2H7E A;  4F7U P;  1WGU A;  1V89 A;  4CHM A;  4A6F B;  5C6R A;  3M1I B;  4TKN A;  4ZRK A;  2YRY A;  2KGX B;  1V5U A;  1WI1 A;  2MDX A;  4MY6 A;  4A6F A;  1GC7 A;  1Q67 A;  2D4Q A;  1XOD A;  2D9V A;  2J59 M;  4A6K A;  1WJ1 A;  5FI0 A;  3U7D A;  4HB4 B;  1XR0 B;  4HAV B;  2Y7B A;  3TCA A;  2DN6 A;  1TQZ A;  2QKM A;  4EMO A;  1ZSQ A;  3A8Q A;  1MIZ B;  1X11 A;  1LW3 A;  1U5F A;  3PG7 A;  2EMS A;  1MIX A;  3F5R A;  2YS3 A;  2ROZ B;  2V76 A;  3TVV A;  4WJ7 A;  4HB3 B;  1IRS A;  4A5K A;  4WVF B;  1NI2 A;  1RJ2 A;  4IAP A;  2ELA A;  1J19 A;  1MAI A;  2W2W A;  5HE3 A;  4NY0 A;  2NMB A;  4YL8 A;  2CY5 A;  1M7E A;  1OQN A;  2K00 A;  3NSU A;  3ULB A;  3BJI A;  4K2O A;  2K2J A;  3UZT A;  3ODW A;  3A8P A;  4HAT B;  2COA A;  2D9X A;  1P3R A;  3AJ4 A;  2BCJ A;  1MK9 B;  2N23 A;  5D3W A;  2L1C A;  1MPH A;  5J3Y A;  2Z0Q A;  4Z2M B;  1V61 A;  5J3Q A;  1M7R A;  4F7H A;  1N3H A;  1PLS A;  2K2U A;  3KRX A;  4HB0 B;  2D11 A;  2YT0 A;  2D9Y A;  3P7Z A;  2RGN B;  1WGQ A;  2EC1 A;  2KUP A;  1FGZ A;  2XQN M;  2HTH B;  1V5P A;  2COC A;  4CHJ A;  4EJN A;  2UVM A;  4KVG B;  1WVH A;  1GG3 A;  3P6A A;  1FOE A;  3ODX A;  5KCV A;  3GYP A; 
#chains in the Genus database with same CATH topology
 3HIE A;  2W2X C;  1FHX A;  2LYD A;  2P0D A;  5D3V A;  4Z2N A;  3HSA A;  1DDW A;  1RRP B;  1BAK A;  2RSG A;  2CY4 A;  3N7C A;  1WJM A;  3QBV B;  2YS5 A;  2R0D A;  1U5G A;  1T77 A;  2UZS A;  4K2P A;  5LON B;  3CXB B;  5GOW B;  2D9Z A;  2Y8G A;  4MK0 A;  2Z0O A;  2P8V A;  3ML4 A;  1TJ6 A;  2NBV A;  1GC6 A;  3TW1 A;  4DBB A;  1U27 A;  2IYB A;  1J0W A;  3AU5 A;  2GUM A;  3DXE A;  4H8S A;  1K5D B;  2E2X A;  2P0F A;  1W1H A;  4XWX A;  3SV1 A;  2DHJ A;  1XX0 A;  3QIJ A;  4HDO A;  3FEH A;  2OTX A;  4GNK B;  4QJ5 B;  3PVW A;  2JP2 A;  2YT2 A;  3QWM A;  4OSN A;  3ZDT A;  3X23 A;  4BBK A;  1DRO A;  4TYZ A;  5JP4 A;  3NW8 A;  1TXD A;  3NWA A;  1Y19 B;  2ROV A;  2LG1 A;  2ZKM X;  2GJY A;  1XD4 A;  2D10 A;  3ODO A;  4DXA B;  3RCP A;  1ZVR A;  1UPQ A;  2M14 A;  2RUK B;  1EAZ A;  1UNP A;  2I1K A;  2IFS A;  5EFX A;  1H10 A;  3DXD A;  2NZ8 B;  1V88 A;  5D3Y A;  1AQC A;  2DKP A;  1NTY A;  5DIF B;  4CSQ A;  2KIG A;  3A98 B;  3PP2 A;  4HHV A;  5KQ1 A;  2OQB A;  4HB2 B;  5JHH A;  2Z0P A;  1LB1 A;  3D8F A;  4GPT B;  4Y94 A;  2VRW B;  3D8D A;  1U5D A;  2YSZ A;  3AU4 A;  3PSC A;  3FM8 C;  1UPR A;  2CRF A;  1KZ7 A;  4IOY X;  4B6H A;  1FGY A;  2AL6 A;  3SO6 A;  5DI9 B;  1EVH A;  2DX5 A;  1NTV A;  2DTC A;  2COF A;  3TFM A;  4PNK A;  3B77 A;  2I5C A;  4GZU A;  3F0W A;  3WYF B;  2L2I A;  4DX9 0;  3U8Z A;  3IVF A;  4GMV A;  4GXB A;  4K81 A;  4GOU A;  5DHA B;  2DLW A;  1QC6 A;  2Z14 A;  2M38 A;  2HE7 A;  1SHC A;  4HAW B;  3D8E A;  5C16 A;  3HW2 B;  2GCJ A;  1UNR A;  4HAU B;  4C0A A;  5LG4 B;  2RLO A;  1X05 A;  5CLL B;  1BTN A;  1X86 A;  3PEG A;  3MDB C;  1EF1 A;  3U12 A;  2X18 A;  2YF0 A;  2DX1 A;  1UEF A;  5LOP B;  5HE1 A;  3CIK A;  4IFS A;  1XKE A;  3HK0 A;  1DBH A;  2COD A;  1P6S A;  4HAZ B;  3PZD A;  4L1R A;  1KI1 B;  1H4R A;  3OAN A;  5HE0 A;  3DXC A;  2LKO A;  1K5G B;  1Y5O A;  3MPX A;  3SUZ A;  4GN1 A;  3OHM B;  5HE2 A;  2MKR A;  3G9W A;  2KCJ A;  5IRS A;  2MWN B;  4MT7 A;  2DHK A;  3WA0 A;  3LJU X;  2Y8F A;  1BTK A;  2DKQ A;  3V5W A;  4YON A;  1U2B A;  3P6A A;  1B55 A;  3KY9 A;  2DFK A;  2N0Y A;  1U5E A;  2ADZ A;  4QJ3 B;  3SNH A;  2J0K A;  2D2Q A;  1OMW A;  1FHW A;  2LOZ A;  5DH9 B;  3ULC A;  1EGX A;  3KRW A;  5JLJ B;  1ZC3 B;  2DA0 A;  4KHA A;  1FB8 A;  2KUQ A;  3TO1 A;  1FHO A;  3DCX A;  2RRF A;  2MFQ A;  3KSY A;  4KHO A;  4EKU A;  3BIN A;  1MK7 B;  4ZRI A;  1XCG A;  4L6E A;  1E5W A;  2YS1 A;  4CYE A;  2GS0 A;  2LUL A;  5JHG A;  3FVC A;  2GCL A;  2I1J A;  3ZVR A;  5D3X A;  2CAY A;  2EJ8 A;  4DX8 A;  2PZ1 A;  2Z59 A;  3O96 A;  3T06 A;  4OT1 A;  1W1G A;  1PFJ A;  3VIA A;  5J3T A;  2KIE A;  4GMX B;  5FI1 A;  1WG7 A;  2FJL A;  4KHB B;  4F7G A;  2J0M A;  1ZM0 A;  5L81 A;  3A58 A;  2DHI A;  2AEH A;  1P5T A;  1V5M A;  2EMT A;  5C5B B;  1KZG A;  4HAY B;  2RVB B;  1UNQ A;  1ZYI A;  2I5F A;  4KHB A;  1NU2 A;  1DDV A;  2FJU B;  4HAX B;  4D0N B;  1AWE A;  1W1D A;  4A6H A;  5C79 A;  3PVL A;  5C5B A;  2G35 A;  1MKE A;  1OY2 A;  5CLQ B;  2VSZ A;  1DYN A;  1X1G A;  2W2X D;  1I7A A;  4K17 A;  1ISN A;  2RNR B;  5M4Y B;  1ZC4 B;  2DYN A;  3GYO A;  2ELB A;  2ZPY A;  3PVU A;  1FAO A;  5D27 A;  3VOQ A;  2D9W A;  2YVC A;  1I2H A;  5I2M A;  2Q13 A;  2DYQ A;  3FSS A;  2VKI A;  5KQ4 A;  4QXA B;  1Z87 A;  4KAX B;  2J0J A;  2Z4D A;  2UZR A;  4ZRJ A;  1SGH A;  4D6W A;  1QQG A;  3HQC A;  4WSF A;  2R09 A;  4NSW A;  1PMS A;  2H7D A;  4P7I A;  4PQ0 A;  2LOX A;  1X1F A;  2P0H A;  1BWN A;  5DHF B;  3SYX A;  5I2S A;  2QKL A;  4DIX A;  1DDM A;  1U29 A;  3KZ1 A;  2YT1 A;  4HDQ A;  2H7E A;  4F7U P;  1WGU A;  1V89 A;  4CHM A;  4A6F B;  5C6R A;  3M1I B;  4TKN A;  4ZRK A;  2YRY A;  2KGX B;  1V5U A;  1WI1 A;  2MDX A;  4MY6 A;  4A6F A;  1GC7 A;  1Q67 A;  2D4Q A;  1XOD A;  2D9V A;  2J59 M;  4A6K A;  1WJ1 A;  5FI0 A;  3U7D A;  4HB4 B;  1XR0 B;  4HAV B;  2Y7B A;  3TCA A;  2DN6 A;  1TQZ A;  2QKM A;  4EMO A;  1ZSQ A;  3A8Q A;  1MIZ B;  1X11 A;  1LW3 A;  1U5F A;  3PG7 A;  2EMS A;  1MIX A;  3F5R A;  2YS3 A;  2ROZ B;  1MI1 A;  2V76 A;  3TVV A;  4WJ7 A;  4HB3 B;  1IRS A;  4A5K A;  4WVF B;  2K49 A;  1NI2 A;  1RJ2 A;  4IAP A;  1J19 A;  1MAI A;  2W2W A;  5HE3 A;  2Z13 A;  3NWD A;  4NY0 A;  2NMB A;  4YL8 A;  2CY5 A;  1M7E A;  1OQN A;  2K00 A;  3NSU A;  3ULB A;  3BJI A;  4K2O A;  2K8E A;  2K2J A;  3UZT A;  3ODW A;  3A8P A;  4HAT B;  2COA A;  2D9X A;  2R2Y A;  1P3R A;  3AJ4 A;  2BCJ A;  3NWF A;  1MK9 B;  2N23 A;  5D3W A;  2L1C A;  1MPH A;  5J3Y A;  2Z0Q A;  4Z2M B;  1V61 A;  5J3Q A;  1M7R A;  4F7H A;  1N3H A;  1PLS A;  2K2U A;  3KRX A;  4HB0 B;  2D11 A;  2YT0 A;  2D9Y A;  3P7Z A;  2RGN B;  1WGQ A;  2EC1 A;  4HSI A;  2KUP A;  1FGZ A;  2XQN M;  2HTH B;  2KR0 A;  1V5P A;  2COC A;  4CHJ A;  4EJN A;  2UVM A;  4KVG B;  4QJ4 B;  1WVH A;  1GG3 A;  2ELA A;  1FOE A;  3ODX A;  5KCV A;  3GYP A; 
#chains in the Genus database with same CATH homology
 2W2X C;  1FHX A;  2LYD A;  2P0D A;  5D3V A;  4Z2N A;  1DDW A;  1RRP B;  1BAK A;  2RSG A;  2CY4 A;  3N7C A;  1WJM A;  3QBV B;  2YS5 A;  2R0D A;  1U5G A;  2UZS A;  4K2P A;  5LON B;  3CXB B;  5GOW B;  2D9Z A;  2Y8G A;  4MK0 A;  2Z0O A;  2P8V A;  3ML4 A;  1TJ6 A;  1GC6 A;  3TW1 A;  4DBB A;  1U27 A;  2IYB A;  1J0W A;  3AU5 A;  3DXE A;  4H8S A;  1K5D B;  2E2X A;  2P0F A;  1W1H A;  4XWX A;  3SV1 A;  2DHJ A;  1XX0 A;  3QIJ A;  4HDO A;  3FEH A;  2OTX A;  3PVW A;  2JP2 A;  3QWM A;  3ZDT A;  3X23 A;  4BBK A;  1DRO A;  4TYZ A;  5JP4 A;  1TXD A;  1Y19 B;  2ROV A;  2LG1 A;  2GJY A;  1XD4 A;  2D10 A;  3ODO A;  4DXA B;  3RCP A;  1ZVR A;  1UPQ A;  2M14 A;  2RUK B;  1EAZ A;  1UNP A;  2I1K A;  2IFS A;  5EFX A;  1H10 A;  3DXD A;  2NZ8 B;  1V88 A;  5D3Y A;  1AQC A;  2DKP A;  1NTY A;  5DIF B;  3A98 B;  3PP2 A;  4HHV A;  5KQ1 A;  2OQB A;  4HB2 B;  5JHH A;  2Z0P A;  1LB1 A;  3D8F A;  4GPT B;  4Y94 A;  2VRW B;  3D8D A;  1U5D A;  2YSZ A;  3AU4 A;  3PSC A;  3FM8 C;  1UPR A;  2CRF A;  1KZ7 A;  4IOY X;  4B6H A;  1FGY A;  2AL6 A;  3SO6 A;  5DI9 B;  1EVH A;  2DX5 A;  1NTV A;  2DTC A;  2COF A;  3TFM A;  4PNK A;  2I5C A;  4GZU A;  3F0W A;  3WYF B;  2L2I A;  4DX9 0;  3U8Z A;  3IVF A;  4GMV A;  4GXB A;  4K81 A;  5DHA B;  2DLW A;  1QC6 A;  2M38 A;  2HE7 A;  1SHC A;  4HAW B;  3D8E A;  5C16 A;  3HW2 B;  2GCJ A;  1UNR A;  4HAU B;  4C0A A;  2RLO A;  1X05 A;  5CLL B;  1BTN A;  1X86 A;  3PEG A;  3MDB C;  1EF1 A;  2X18 A;  2YF0 A;  2DX1 A;  1UEF A;  5LOP B;  5HE1 A;  3CIK A;  4IFS A;  1XKE A;  3HK0 A;  1DBH A;  2COD A;  1P6S A;  4HAZ B;  3PZD A;  1KI1 B;  1H4R A;  3OAN A;  5HE0 A;  3DXC A;  2LKO A;  1K5G B;  1Y5O A;  3MPX A;  3SUZ A;  4GN1 A;  5HE2 A;  2MKR A;  3G9W A;  2KCJ A;  2MWN B;  4MT7 A;  2DHK A;  3WA0 A;  3LJU X;  2Y8F A;  1BTK A;  2DKQ A;  3V5W A;  4YON A;  1U2B A;  1B55 A;  3KY9 A;  2DFK A;  2N0Y A;  1U5E A;  2ADZ A;  3SNH A;  2J0K A;  2D2Q A;  1OMW A;  1FHW A;  2LOZ A;  5DH9 B;  3ULC A;  1EGX A;  3KRW A;  5JLJ B;  1ZC3 B;  2DA0 A;  4KHA A;  1FB8 A;  3TO1 A;  1FHO A;  2MFQ A;  3KSY A;  4KHO A;  4EKU A;  3BIN A;  1MK7 B;  4ZRI A;  1XCG A;  4L6E A;  1E5W A;  2YS1 A;  4CYE A;  2GS0 A;  2LUL A;  5JHG A;  2GCL A;  2I1J A;  3ZVR A;  5D3X A;  2CAY A;  2EJ8 A;  4DX8 A;  2PZ1 A;  3O96 A;  3T06 A;  1W1G A;  1PFJ A;  3VIA A;  5J3T A;  4GMX B;  5FI1 A;  1WG7 A;  2FJL A;  4KHB B;  4F7G A;  2J0M A;  1ZM0 A;  5L81 A;  2DHI A;  2AEH A;  1P5T A;  1V5M A;  2EMT A;  5C5B B;  1KZG A;  4HAY B;  2RVB B;  1UNQ A;  2I5F A;  1NU2 A;  1DDV A;  4HAX B;  4D0N B;  1AWE A;  1W1D A;  4A6H A;  5C79 A;  3PVL A;  5C5B A;  2G35 A;  1MKE A;  1OY2 A;  5CLQ B;  2VSZ A;  1DYN A;  1X1G A;  2W2X D;  1I7A A;  4K17 A;  1ISN A;  2RNR B;  1ZC4 B;  2DYN A;  3GYO A;  2ELB A;  2ZPY A;  3PVU A;  1FAO A;  5D27 A;  3VOQ A;  2D9W A;  2YVC A;  1I2H A;  2Q13 A;  2DYQ A;  3FSS A;  2VKI A;  5KQ4 A;  1Z87 A;  4KAX B;  2J0J A;  2UZR A;  4ZRJ A;  1SGH A;  1QQG A;  3HQC A;  4WSF A;  2R09 A;  4NSW A;  1PMS A;  2H7D A;  4P7I A;  4PQ0 A;  2LOX A;  1X1F A;  2P0H A;  1BWN A;  5DHF B;  3SYX A;  2QKL A;  1DDM A;  1U29 A;  3KZ1 A;  2YT1 A;  4HDQ A;  2H7E A;  4F7U P;  1WGU A;  1V89 A;  4CHM A;  4A6F B;  5C6R A;  3M1I B;  4TKN A;  4ZRK A;  2YRY A;  2KGX B;  1V5U A;  1WI1 A;  2MDX A;  4MY6 A;  4A6F A;  1GC7 A;  1Q67 A;  2D4Q A;  1XOD A;  2D9V A;  2J59 M;  4A6K A;  1WJ1 A;  5FI0 A;  3U7D A;  4HB4 B;  1XR0 B;  4HAV B;  2Y7B A;  3TCA A;  2DN6 A;  1TQZ A;  2QKM A;  4EMO A;  1ZSQ A;  3A8Q A;  1MIZ B;  1X11 A;  1LW3 A;  1U5F A;  3PG7 A;  2EMS A;  1MIX A;  3F5R A;  2YS3 A;  2ROZ B;  2V76 A;  3TVV A;  4WJ7 A;  4HB3 B;  1IRS A;  4A5K A;  4WVF B;  1NI2 A;  1RJ2 A;  4IAP A;  2ELA A;  1J19 A;  1MAI A;  2W2W A;  5HE3 A;  4NY0 A;  2NMB A;  4YL8 A;  2CY5 A;  1M7E A;  1OQN A;  2K00 A;  3NSU A;  3ULB A;  3BJI A;  4K2O A;  2K2J A;  3UZT A;  3ODW A;  3A8P A;  4HAT B;  2COA A;  2D9X A;  1P3R A;  3AJ4 A;  2BCJ A;  1MK9 B;  2N23 A;  5D3W A;  2L1C A;  1MPH A;  5J3Y A;  2Z0Q A;  4Z2M B;  1V61 A;  5J3Q A;  1M7R A;  4F7H A;  1N3H A;  1PLS A;  2K2U A;  3KRX A;  4HB0 B;  2D11 A;  2YT0 A;  2D9Y A;  3P7Z A;  2RGN B;  1WGQ A;  2EC1 A;  2KUP A;  1FGZ A;  2XQN M;  2HTH B;  1V5P A;  2COC A;  4CHJ A;  4EJN A;  2UVM A;  4KVG B;  1WVH A;  1GG3 A;  3P6A A;  1FOE A;  3ODX A;  5KCV A;  3GYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...