2KHCA

Bruno rrm3+
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
118
structure length
118
Chain Sequence
AAGLPQFGSASALSTSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Testis-specific RNP-type RNA binding protein
publication title Bruno protein contains an expanded RNA recognition motif.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
total genus 11
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2khcA00
3R1LA 3MD1A 4F02A 2L08A 2DHGA 2MQPA 3G9CA 2CQHA 2KT5A 2MY8A 1VQLS 1VQ4S 3EGNA 2LEAA 2LA6A 2DNGA 3DXBA 1Q82T 2EVZA 1R8PA 3MDFA 4ZKAA 4WKRA 2L9WA 5IM0B 2F3JA 2CQ4A 2DGUA 4U67Q 2K3KA 4QQBA 4PR6A 1VQKS 1X4EA 2M0GB 3N9UC 2MZJA 3EX7B 1YITS 3CCUS 2DNOA 2MSSA 3VF0B 2MHNA 1O0PA 3NNCA 1OIAA 2XS7A 2MKJA 1HL6A 1NO8A 1KOOA 4CIOA 2XNRA 2CPIA 1VC6A 2X1AA 2CQBA 4M5DB 4QU6A 1A9NB 2N7CA 2MZQA 2MQQA 3R1HA 1X4GA 2I2YA 3P6YC 5IFMA 3Q2TC 2M8HA 2DK2A 1U1LA 2RT3A 2QA4S 1VC5A 3VAHA 2MMYA 1QM9A 3J7ZT 2CQGA 2CPYA 3ZZZA 3CCJS 3UCZP 1WF1A 2CQIA 1ZZNA 2CQ0A 4WF9Q 2A3JA 1NJIT 2M2BA 2AYEA 5CA5A 1PGZA 1FJEB 3IWNC 4ERDA 4WFNQ 1N52B 1XN9A 2ADCA 2FY1A 4WCEQ 2KXFA 1H2VZ 4TU9A 2U2FA 2V94A 1D8ZA 1YWXA 1VQ9S 2JX2A 4W92B 2M4MA 1JJ2R 1SJRA 2MSTA 3VAFA 2OIHA 1URNA 4CH1A 5FJ4A 2RQCA 1M5OC 2DGOA 2JRSA 2MKKA 2DNHA 2MZTA 2MKIA 3MOJB 4C0OC 3CTRA 1WEXA 2KI2A 1U1PA 3U1LA 2DNKA 4LIRA 1JJ4A 2QFJA 3UCUP 5JVGQ 3NS5A 1X5TA 1VBZA 2AYBA 2VODA 3SXLA 1FJ7A 1U1NA 3EGZA 2E5HA 2FC9A 2YTCA 1PO6A 4IOAQ 4PKDB 1WHYA 2UP1A 2VOPA 1OWXA 2RS2A 4UY8T 4PRFA 1DRZA 3FEYB 2XSFA 4WFAQ 2GHPA 2DNYA 3HHNB 3CCMS 1JJHA 4YUDA 1WWHA 4A8XA 3DLLQ 1AUDA 2AYGA 1QVFR 1M5VC 1YJWS 2DGTA 4WIIA 3CPWR 1M1KT 3MXHP 1RKJA 1YJNS 2BOPA 4Z2XA 2KXHA 3J7YU 2YH0A 4C7QA 1U1KA 2DHSA 1P27B 2CPHA 2RRAA 3NS6A 3Q2SC 2J76E 2MJUA 1H6KX 1VC0A 4Y0FA 1WG4A 5CXTA 2M9KA 2N82B 1VBXA 1VQOS 2MKSA 3BO3A 2F9DA 2DITA 1WHXA 2DO0A 1W2BR 3FEXB 1UFWA 3P3DA 2XB2D 2DNQA 2DNNA 5HL7Q 1WF2A 2BZ2A 3VAMA 3CC7S 1FJCA 2MQLA 1Q7YT 4C4WA 2CQDA 1U2FA 3LQVA 2KM8B 1SXLA 5GAHU 4FXVA 1K9MT 5LJ5Y 3CCSS 5LSLA 4F25A 2KRRA 3PIOQ 5H1SV 3CCVS 3I56S 2DH8A 3G6ES 1FHTA 2RRBA 2XS5A 1HA1A 1X5PA 2VOOA 2PEHA 2EK6A 2LXUA 3IRWP 3P49B 1RK8A 2L41A 1H2UX 3TO8A 2CQ2A 2F9JA 5DDQC 5DDOC 2PE8A 1VQ7S 2RVJA 4YB1P 3G4SS 2XS2A 4EGLA 2B0GA 2KRBA 2ZJRQ 3VAKA 1N8RT 5DDPC 1U6FA 3V4MA 2D3OR 5ITHA 2KG0A 1YTYA 4OZ1A 4CH0S 5IQQA 4FXWA 1U1MA 2E5JA 1SJFA 5LXRA 1IQTA 1WF0A 2X1FA 3CXCR 4Y00A 1M5PC 4RU2A 1U6BA 1UP1A 1UW4A 2J8AA 1VQ6S 1UAWA 3THPA 3BEGB 3CCES 3VAIA 1VQ8S 1JMTA 2N3OA 1X4CA 3PIPQ 2O3DA 4F26A 1WELA 1ZH5A 3G8SA 3K0JA 3D2WA 1VBYA 3MURP 2XNQA 5CYJA 2CPEA 1N54B 3THTA 5LJ3Y 1VQNS 1KQSR 4OZ0A 3CUNA 2OTLS 3NNAA 2MGZA 5LSOA 2ZJQQ 1BY9A 2VONA 3G71S 2DISA 2QEXS 2U1AA 2RQ4A 5D77A 1WHWA 2LYVA 3CF5Q 3CC2S 2DNRA 2KU7A 4TLQA 2KVIA 3CMAS 2KN4A 5DDRC 3CULA 1D9AA 3S8SA 2KYXA 2LA4A 4IUFA 3SDEA 2LKZA 2LXIA 2LMIA 2OTJS 1M5KC 3SMZA 2MQMA 1S79A 1KC8T 4UQTA 3RW7A 3MUMP 1F9FA 4J5OA 3JB9k 3US5A 3P5TL 1P1TA 4QPTA 2KXNB 3UE2A 3CCRS 2X1BA 5D78A 2M52A 1WG1A 5DM7Q 2MPUA 1DZ5A 2HZCA 3MI7X 2CPDA 2E5GA 2NLWA 3UD3P 2AYMA 1WHVA 2MXYA 2CPXA 4YOEA 2CQ1A 1X5OA 2D9PA 2DIUA 3I55S 1L3KA 3CD6S 1OO0B 2CQCA 2DNLA 2FC8A 3UWTA 1X4HA 2DNZA 2J0QD 1ZZFA 2D9OA 1A7GE 2KH9A 1U1QA 1X4AA 2M88A 3NNHA 3B4DA 2LCWA 3L3CA 2WBRA 2JVOA 1NU4A 2LECA 1YJ9S 2G1DA 4IOCQ 2AD9A 2MGZB 4P6QA 2MZ1A 3CCLS 2DNPA 3TP2A 4TU8A 3VAGA 2KHCA 2MZRA 4BS2A 1X0FA 1Q86T 5GAEU 2DGQA 1X4BA 2I38A 2J0SD 2NZ4A 5LXYA 3H2VE 2CQPA 2KG1A 2CQ3A 4QU7A 1DBDA 3SDEB 3BS9A 4CQ1A 2G4BA 3UCGA 1X5SA 2ERRA 2DB1A 1SJQA 1WG5A 2E44A 3S7RA 3TYTA 2MZSA 2LQ5A 1U1RA 1S72S 1U1OA 1X4FA 3B4MA 2Q79A 2DO4A 2YH1A 2DHAA 4V19X 2CJKA 2N3LA 3G96A 2CPJA 4IO9Q 5MLCV 1R8HA 2DGVA 1SJ4P 1FNXH 2MQOA 4LJMA 2MKCA 2HVZA 2DHXA 2LEBA 3LPYA 3MUVP 5GAGU 2MB0B 1WTBA 1DHMA 1YHQS 4ED5A 2CPFA 1FO1A 1X4DA 1G2EA 3G8TA 5GVQA 2RS8A 2SXLA 2KM8C 1WEZA 2M8DB 1Q81T 3S6EA 2DGSA 1CVJA 2M70A 1YI2S 3MUTP 2G0CA 2GO9A 1K73T 2M7SA 4W90B 2ADBA 3R27A 2DH7A 2K8GA 2KFYA 2MY7A 2YKAA 1WI6A 3ZZYA 2EK1A 1FT8A 2DH9A 5GADU 1VQMS 3VAJA 3BO2A 2RU3A 5IM0A 5DM6Q 1VQPS 5JVHQ 1M90T 3UD4P 1KD1T 2HGNA 1HD1A 2RNEA 5GMKa 2FPHX 3S01A 2MJNA 2OJ3A 3RW6A 5DETA 5BJRA 1N88A 3MD3A 4WFBQ 2FHOB 4LMZA 2DNMA 2HYIB 1WI8A 2MKHA 4TU7A 2OSRA 2ZJPQ 2DGWA 1H2TZ 2E5IA 2MYFA 3ULHA 1HD0A 3H2UB 3CCQS 2YWKA 1WEYA 2DIVA 1FXLA 1B7FA 1VQ5S 1KOHA 2RUGA 3HI9A 3VALA 3OW2R 1YIJS 3CMES 2HGMA 3BO4A 1QVGR 3CC4S 1SJ3P 2JWNA 1K8AT 2JVRA 5HO4A 2MQNA 2HGLA 3NMRA 5EN1A 2OSQA 1OPIA 2DGXA 2CPZA 2X1GA 3U1MA
chains in the Genus database with same CATH superfamily
4PG5A 2WW4A 2VQFJ 3G9CA 4JI6F 1KQKA 2DD8S 1VQKS 4ICLB 1MU2B 2MZJA 4JI5F 1L3TA 4OLOA 1X9WA 1N56A 4U8VA 1YBTA 1HPZB 4ID5B 2DRAA 3CCZA 1KOOA 2XNRA 4OLPA 2FYXA 2MZQA 4DX7A 1TR0A 3K57A 2DK2A 4HTJA 2LLZA 1EAYC 1PGZA 5KFWA 4CLUA 4UQGA 2KXFA 2PA8D 2M4MA 2NXNA 2HVIA 4DZDA 2FLLA 4V1Ak 3EDQB 2KI2A 5IWAJ 1WSVA 3V6DB 2D41A 5HMZA 1W26A 1W7WA 5DGBA 1S6PB 1SI9A 1RHKB 4KPYA 4USHA 1TL5A 1GXUA 4OHWA 2JC1A 1RHRB 2BABA 2OKQA 2Y1LB 3OTBA 1VR6A 4NLDA 1RCXB 4MFBB 1M1KT 2XO7A 5ETLA 2BOPA 4KPCA 3BSOA 1NHUA 3RBEA 1VC0A 2M9KA 1QY7A 1VQOS 1MG7A 3FDSA 4ZP8A 2ZBCA 2Q66A 1C0TA 1H3DA 4Y34A 2CZ4A 4ANDA 3CC7S 1NEEA 4MYUA 5KFDA 5GAHU 4B3TJ 2BJ1A 2HIQA 4P2XA 4DV2J 4FKYA 2RRBA 2V0NA 2GVZA 1F2HA 1RK8A 2VPYB 2QSWA 2L41A 4C3MA 3OL7A 4TQRA 2YKOA 3H0PA 5G0RB 4FF3A 5L9NA 5C2CA 3C6TA 1D9FA 2JFKA 5LMNF 1RLCL 2OEKA 2HNYA 2ZH8A 4KR0B 1YQHA 1RU2A 3J81j 5KFBA 1HARA 5A8KB 2J8AA 1XIQA 2RHSB 3L7OA 4ZPCA 1MMLA 4ETZA 3H4DA 3FC9A 2ZHOA 4MYTA 2EC0A 1S6UA 2G13A 2ZOGA 4ZLJA 3QSIA 3THVA 4Q0BB 4NEZA 2DISA 2GQCA 2IBKA 3CMAS 4TQSA 2XI2A 4DPTA 3HP6A 1M5KC 1UA0A 4N7TA 1AFIA 1IM6A 4LRDA 5HP1B 1SC3B 3P5TL 4DUZJ 4YHHF 2VICA 3QWPA 3TRGA 1SC4B 2W01A 1JLFB 4WTYA 2EWHA 3N0VA 2WBRA 3MPWA 5C5JA 3TP2A 4WTOB 2DGQA 2I38A 2J0SD 1REVA 3IR5B 2A18A 3QAEA 3H2VE 1OJ4A 3ADAC 2KG1A 4X4UA 2IJFA 3MAAB 4C8MA 3O2IA 4RWWA 1WC5A 3ENVA 3E51A 1FD8A 4U95A 2V9KA 1R6YA 3TUIC 5M2PA 4OJ1A 1S1XB 3TQEA 3JAMU 4X66F 3R9LA 2UUCJ 2DGVA 2MQOA 4LSNB 2X7IA 5L9XA 3NWRA 4PABA 5H9EK 4GVLA 3ENQA 4HT5A 1UETA 3KJVB 1KQGB 1S9GA 4K7QA 1IQZA 5ETNA 3DMJB 3R27A 3POTB 5HJYA 2C2OB 3HHLA 1SH2A 4NCAA 2J7UA 1RE1B 5GADU 3OFEA 1RYRA 3MM6A 1EQMA 5JVHQ 5J1NA 1T8EA 1ZM9A 2HMIA 2Y8WA 1UMJA 1FKPA 2PMHA 2K06A 2DY9A 1RT3B 3PR4A 1H2TZ 1DQAA 1S0MA 3NKYA 2PC6A 1TQLA 2Q43A 2IPOB 1U0HB 2J0WA 1HHQA 4JI0F 1MLAA 3J81U 2JWNA 4J9MA 2G2YA 1QUVA 5EX0A 3J7A1 3SIPB 1N5YA 2PD1A 2HQCA 4CTAB 2ILZA 3H5UA 3W60A 3I5BA 4WKRA 1EHWA 4DV7J 1I5OB 2OAUA 2W2OP 4WIQA 5HMXA 3L9ZA 1XR5A 1BLUA 3CDBA 4I7FA 3CDEA 2WOMA 4OX9F 2UZAA 3AOBA 1FERA 4YQWA 2RH3A 4ZPVR 3I9ZA 3J80Y 2BEFA 3K5NA 5KOWA 3W9JA 1JLGA 1RHMB 3PRVA 3R5BA 4CT9A 4D3HA 3H4BA 1RCOB 1C0UA 4CH7A 2D3ZA 3A3PB 2M3DA 3CJKA 4M1KA 2JX2A 3Q0AA 4FPRA 1JJ2R 1S1TA 3GIMA 1BQXA 1FRMA 4K2XA 2DNHA 2MZTA 2XLJA 3JQJA 2VC1A 3U1LA 2DNKA 2KB2A 5JVGQ 1TUWA 1Z4UA 3C16B 4X4SA 2UUWA 3FFIA 4PKDB 4Y2CA 3DN9A 3MFIA 2F8EX 1NLKL 4PRFA 3IP0A 2P8IA 1LWXA 2DNYA 4MH8A 3CEDA 5IS2A 2E1AA 5J1PA 3DLLQ 1QVFR 2DGTA 3M7VA 3DLGB 3QRPA 2AU0A 2OPPA 1H6KX 2YNIB 1P9YA 2BQUA 4YB6A 3UNGC 2HS0A 5KFLA 1RTIA 1RKIA 1REGX 2DEIA 4PXDA 2BKPA 3K8VA 2MQLA 3WX8A 3RRHA 3QGGA 5F0UA 1PAEX 3LQVA 4FF2A 2G1HA 1K9MT 1IBMJ 1T9WA 1HNXJ 1NK7A 3I5AA 2MLZA 3A8KA 4E98A 3PX0A 3IC1A 1IM4A 5HLFA 2Y8YA 3R8YA 5DQGA 3LP1A 3VAKA 5BYSA 1RTJA 5KG5A 2BACA 1GMVA 1K47A 2HFVA 1S1UA 3BBBA 2DBBA 1XNRJ 2LDYA 3R97A 4YDDB 2V69A 3GQCA 2R8JA 4DR4F 1GNKA 3CE8A 1FFWB 1FDAA 1RT7B 3THPA 5F8GA 2VFUA 3VAIA 4AYBD 4F26A 3A3NB 1H74A 4WWSA 2NZCA 2F5GA 5K8MA 3HHDA 4ED4A 1GEHA 2C3MA 1S6QA 3LP2B 3OFFA 2P9GA 5D77A 3M1VB 5KFIA 4WXOA 1FDDA 3OR2B 1B3TA 4LR7A 3LA0A 4KB7A 4ED3A 2RJZA 5HATA 4LRCA 4RZRA 3MR6A 2M52A 4AQYF 3SSRA 2MXYA 3V2UC 2CQ1A 1DARA 3CD7A 1RTDB 5HK4A 3LAKA 3I55S 3DCAA 1ZZFA 3KLGB 2J6TA 3C46A 2PFFB 2G2ZA 4Y2KA 4P6QA 4ZPAA 1TL1A 4DR2J 5D0RA 3CSKA 4DQPA 3EPGA 3R5CA 4LRFA 3M9MB 3TR5A 2CQPA 5HVFA 2UVWA 1S10A 2NQPA 2HLUA 1JB0C 1RTZA 1X5SA 1P1LA 5LOQA 5HANA 1Q0NA 1XR7A 3B8HA 1Y5NB 1VBKA 4OX6A 2EW9A 2FZGB 1XMOJ 1RBLA 4ECXA 2CPFA 3K89A 3G8TA 3AB4B 1Y0HA 2CXEA 1N48A 2QYGA 5E41A 5AJ3J 2M70A 4J37A 4JI3F 5KFSA 1K73T 3DDIA 3DLEA 2YNHA 3ILIA 4EU0A 1EB0A 3FZBA 1OY6A 4KIAA 5E7OB 4Y2IA 4S0MA 4FYYB 1IKVA 3W66A 2E7VA 2WW8A 2RU3A 3C2PA 1M90T 2MJNA 2V4JA 1V5IB 1SQGA 5U47A 4DI6A 5H9FK 1N88A 1JQGA 3AOAA 2FHOB 4LUBA 1E6VA 4ZCKA 3WHIA 2FQQB 4F3QA 3HKWA 4DG1A 3VGUA 1VQYA 4OI4A 2DTJA 3OQ2A 1S1VA 2WB4A 1ICEB 2DEJA 3BO4A 2YWEA 2R7TA 1Y4ZB 3C15A 1FWKA 3RJMB 5K8OA 3VR1A 2VG6B 1KFSA 4G1PA 2XM3A 3HJFA 4ILMA 1VQLS 2ABYA 1VQ4S 2VQEF 2EVZA 1XC9A 3TJ8A 5IM0B 2WCXA 3UPFA 4JI4F 1F5BA 2GMLA 4WYWA 1OS5A 5J2PB 1MROA 2YQ3A 2B4OA 5A8WB 2PSZA 4U7UK 4A8FA 4K2JA 1PC4A 2XYGB 3W1YC 4P9SA 1VC5A 4K0KF 5E3PA 2XZTB 2JHEA 3DRPB 1Y9OA 3G87A 5KFRA 1HWIA 2M2BA 3PACA 2ADCA 3PO5A 3LALA 2GGPA 4HLBA 4BCAA 4Q8FA 2HWTA 1XMBA 1O8BA 1URNA 2R7UA 4FP9A 1FK9B 2HFNA 1L3UA 4B3RJ 3D9BA 5F0WA 3NS5A 2N7YA 2X3GA 4K5RA 3QIPB 2IVMA 2EPIA 1NM2A 2F8HA 2CNKB 2V8PA 1JXEA 2XSFA 4DQQA 2HBZB 2ASDA 3MECA 1CULA 1WC1A 4C7QA 3GR1A 3OR1A 3QZ8A 1RADB 3M32A 4I56A 4DL4A 2MKSA 3RG6A 2F9DA 3BH7B 1IWGA 1K0TA 4URQU 1U02A 2LEPA 3FBEA 3DLHA 1HQEB 2UXDF 2I9SA 3E01B 4LF4F 1RTHB 4DV6J 2J7KA 3M2VA 2H4YB 3PYEA 3MPDA 2VG7B 4C0HA 1QUPA 1FWPA 4PWDB 5THWA 1HA1A 2VOOA 4KBIA 2GX8A 1H2UX 3AAWB 3O6QA 1SB6A 1KWMA 2VL1A 2LU2A 1RZMA 1FEEA 2B0GA 3ZXWA 2XO6A 1HYSB 1Z1ZA 4WE1A 2HRYA 1JLCA 4FVCA 4IH6A 1VQSA 3MHYA 4LF7F 4B3TF 3PRBA 4DV2F 4ZA1A 4IYQA 4J9LA 2O3DA 1ZM3A 2HNDA 5BR8J 3D2WA 2KT3A 2V2VA 4TVAB 5CYJA 4BDPA 2YWWA 2HAIA 4OX8A 3VV2B 1T02A 2QEXS 3D0IE 1RAJA 3CF5Q 4M5HA 3SV4A 4EYHB 1D9AA 1DQ9A 4F4ZA 2QA2A 2EKYA 3HSZA 5I42B 5T7LA 3K5LA 1BXNA 2MQMA 3IRXA 2R8GA 2VBWA 2BE2A 1NSQA 3MMBB 2NUUG 1B70B 2CPDA 4KHMA 2ROPA 1PG5B 1RACB 1JLEA 1SKSA 2DIUA 3UWTA 2FC8A 2XBPA 2DNZA 3FEZA 3N6MA 4PUOB 3GCXP 2XHWA 4FS2A 3Q22A 1DJ0A 3DGVA 3QRQA 2AZ1A 2HG4A 2RD5C 4DL7A 4LBPA 2OP5A 3B82A 3CJSA 4RW6A 2E7WA 3KJFB 4DSIA 3QGPA 1AXQA 2NZ4A 1Q5VA 4M5JA 2EFOA 4PYDA 1RYSA 4RNMA 1KEKA 3C14B 3MTKA 3CJ8A 4CQ1A 1V3ZA 4NCGA 1WC3A 3JSMB 2E44A 3BM7A 4RL1A 3O5TB 2RUSA 1U1RA 1NDKA 2VG5A 1QTNB 2YH1A 1R27B 5HMWA 3B78A 4OMFG 1HBMA 2P6SA 1DQ8A 1KN6A 1SJ4P 2RKIA 4OI0A 4XO0A 2CJXB 3RAXA 4UTGA 1T03A 4R0EA 2QC3A 1Q78A 2DGSA 4MJKA 2HQFA 3ZZPA 1NK9A 5C7PA 1A6LA 4F67A 2K8GA 4F8RA 1U25A 1WKLA 4K4YA 4IRDA 1OMSA 4JI7F 3MPVA 5C2GA 4DV5F 1QE1B 3PFEA 3UD4P 4ICLA 2HGNA 2RNEA 1MU2A 3HK2A 2FPHX 2UUCF 4ZCMA 1EARA 2ZZNA 1HPZA 4ID5A 1UA1A 2W2NP 2R8KA 4M95A 3AQOA 4IKAA 2RF2B 3R7BB 2QV6A 3RUBL 3D6FB 1EKRA 2RUGA 4HHJA 2UV8A 5KFPA 3CC4S 4K8RA 3GFXA 2AJQA 4O3RA 6AT1B 2DR7A 3TQ1A 2DGXA 3U1MA 2ZBPA 3CWJA 2W7PA 4CNYA 4RO0A 4QPXA 4ALZA 3EWGA 4NWBA 3O44A 3N9UC 3V6DA 2EG2A 4CLLA 1O0PA 1S6PA 1C1CB 2HLTA 4X64J 2Y0BB 2MKJA 1WC0A 4FF4A 4DV4J 4ECUA 1F0XA 4M5DB 2VFVA 3DRRB 4ED7A 4TLRA 4NLOA 4LRBA 2BW2A 5HJXA 3DRSB 3J7ZT 3CCJS 4MFBA 4F0KA 2AYEA 4DV7F 3S1TA 1GAOA 2V4RA 2GQQA 2ZWPA 1TL3A 2IM1A 3GJTB 4F0MA 2VBZA 2OIHA 1EP4B 1M5OC 3IG1B 2VASA 3P96A 3BPDA 3R6GB 5J2NB 3MR2A 4OYBA 1QTMA 3NGUA 1VI7A 1DURA 3HSGA 2VODA 2FGOA 3GJSB 4IQMA 2C28A 3ONQA 4ZVTB 2L9DA 2VOPA 4NXMJ 4I1TA 4RBTA 1X9MA 2KVQE 2BRKA 3HF5A 1SKWA 1RHUB 1JJHA 1PILA 5G0RA 2OFGX 1U8WA 4N47A 1S1WB 4RW8B 2OMOA 1I94J 1DTTA 3KWMA 2V34A 1IVZA 2DITA 2MHEA 2ACYA 2Q6CA 3EMTA 3BZQA 1TKTB 4N8OA 3MTJA 1B0VA 3IN5A 2OGUA 2PI5A 1YX2A 2GMJA 3FZ2A 3FRZA 1SXLA 4FXVA 4PQUA 1J5EJ 3AJ2A 4DR5J 2E1RA 2BANB 3G6ES 1Q16B 3V81B 3SCLE 3TNVA 5I3QA 2OD4A 4Q0BA 4F4WA 4ED2A 1F2GA 4HR2A 2GMHA 4EWTA 1QSSA 3H90A 4ES3A 2FB0A 3GYXB 1YTYA 2VHGA 3QJJA 2I5JB 5KFGA 5HP1A 4M63A 4QWEA 3QYYA 1WF0A 5IT4A 3MEKA 2C22A 1IBMF 2C2MB 1U6BA 1UAWA 1CPZA 1I6JA 3FQLA 1RBOB 1JWWA 1JLAB 1XEZA 1JLFA 1SBRA 1CG2A 5KFCA 2EFQA 3K8WA 1KQSR 3A8IA 3PW7A 3NAIA 1B4SA 5LSOA 2VONA 5LSRA 2AEJA 4HYKA 2FHKA 1XNRF 4ZMMA 2L3MA 4YN3B 4LT6A 3S8SA 1VK8A 2F4FA 4ED0A 2LKZA 1UVJA 1M1HA 1IKYB 1SPBP 3SI8A 4RW4B 2KXNB 1LWEB 2I0XA 1ZM2A 4LSNA 2HBRB 3KJVA 1SUQA 1A7GE 4DQSA 4HVZA 1N0UA 2M88A 2A2DA 3G8QA 1W2IA 3K58A 4GKKF 3DMJA 3GFHA 2LECA 2MGZB 3POTA 3WZ0A 2MZRA 4V19J 3JTOA 3QT5A 1D09B 2XC9A 2ZC4A 3GFZA 4PG6A 1VDHA 2KFNA 3IS9A 4DQIA 4URSA 1RT5A 3V6JA 2FJBB 3CO0P 2LQ5A 4X62J 1RT3A 1JXVA 2EFNA 3SFUA 1UFLA 4IO9Q 3RAMA 3MUVP 2MB0B 5HQ8A 2R7WA 4C6AA 1FO1A 2WSCC 1U0HA 4DSJA 4LF9F 4UZCA 3Q8RB 4DR2F 1B99A 3N6NA 2X3DA 4WFXA 1Q81T 3NP5A 4DSFA 2F65A 4DU8A 4CTAA 1WI6A 3D1HA 2DH9A 2Z2YB 4P74A 1H73A 2AX0A 3IBWA 1UVLA 1GFWB 1RWXB 3JYTB 4RUHA 2RAQA 2GJ2A 4H4KC 4QYZJ 3MD3A 2BMBA 4IRKA 3MR3A 3M2UB 4KHRA 7FDRA 1QLNA 2H48B 3FMWA 3GILA 5D4NA 1PJ5A 5IZHA 1LK5A 3C3LA 1JNZB 4N56A 4OI3A 3JSBA 2IAJA 1Y7PA 1K8AT 2GVDB 3HM9A 3CDUA 3K2YA 3ZZUA 1TL7B 1GX6A 2LA6A 1Q82T 3MDFA 1GQEA 1RP5A 3VVUA 3OTOJ 2E7XA 2Z58B 1XMQJ 3UR0A 1HL6A 3C16A 3D1QA 1VYAA 1WTFA 4IDKB 1M1GA 2ZOMA 4XK8C 2CQBA 4ZP9A 2VPZB 2UU9J 2N7CA 3R1HA 5F8LA 2FVRA 2IDLA 2KT2A 1LFWA 3DLGA 2D69A 3DFEA 3PYGA 4W4MA 1FA0A 4LFCJ 3WIVA 3KYLA 2U2FA 2QLWA 4RJVA 1KLMB 1EETB 5FDLB 2IHR1 1C0TB 2JRSA 4CDIA 3FSYA 1X31C 4CM0A 1H7WA 4J9VA 3SXLA 5D4PA 4P7VA 1PYSB 5HROA 2GVZB 2HWIA 3EPIA 2PI4A 2GAHC 2HKEA 4X65J 3T6JA 3RBDA 5CABA 2FVSA 4KJIA 4TYBA 3C6TB 1B64A 2L9NA 4QBUA 2CJYB 4CCHA 4CLKA 2RDJA 2HNYB 3FBCA 2MJUA 3SQGB 1AA1B 4ELVA 1T94A 4EYIB 4CLSA 1ZA2B 2VBXA 3I6PA 2CUYA 4YR2A 7FD1A 1HBUB 2KM8B 2D7SA 3CCSS 4ZJOA 5LSLA 4EEYA 3SCJE 2RE1A 1HW8A 2BE7D 5KFEA 3LP2A 3J7Z5 5HN0A 1U2CA 4TN2A 4IR9A 2XSJB 4LF6J 3VTIA 2KZMA 1BD6A 3OR2A 1OQ3A 4L75A 2NXEA 3K7RA 5IV4A 4JB8B 3FQKA 4NYPA 2G9OA 3BQ2A 1PSDA 1FVQA 4DV6F 5LXRA 1NJXA 2ZBQA 3KMQA 3G6VA 4QR1A 1X4CA 1GK8A 1EZZB 3KLGA 2YNGB 3FBBA 2XNQA 4CO0A 2FJDB 3T5JA 4OZ0A 4R5PB 2UXCJ 1J5OB 3M4XA 2J6SA 3Q8VA 3G71S 3KMSA 4NA2A 4NLUA 2R7QA 1WSRA 4JV2A 2FDNA 1BUXA 2LXIA 2VF3A 4RU9A 2YXLA 4P75A 4ZHRB 1KC8T 3OHAA 2XLKA 2PT0A 4JP8A 5BR8F 3GG1A 1HWLA 2MPUA 1UVMA 4YFUA 3I0RB 4DS4A 2D9OA 4NLRA 4KGKA 3PW2A 2G1DA 4NZ0A 3HHLB 5D0HA 2DNPA 2B8QA 3PJXA 4MKBA 4TU8A 4YY3J 4DEZA 4OYPA 5K8PA 2XMKA 3A4TA 3Q89A 1X4BA 3UVJA 4DZ6A 3D6TB 1ZAXA 2BOAA 3LWMA 3NGRA 1BWEA 4QIVA 3N4WA 4RBVA 2CJKA 4ZIVA 4DPYA 2BBEA 3M8SA 2HBYB 4ZJQA 1QSLA 1KDNA 5B0GA 3EM1A 1G4CA 2KM8C 2Z0GA 1KVKA 1K1SA 2B9XA 5KFHA 2AEMA 2VG6A 5B0BA 3IAS9 4J91A 2B5JA 4WP8A 2XEXA 1VIOA 5IM0A 5DM6Q 1MSWD 1HD1A 1Z2LA 2K3IA 5GMKa 3DXSX 4MIAA 5FD1A 5J2PA 4F3OA 3LF0A 5A8WA 4YDXA 4ZP6A 4AXJA 3EGWB 1LQ9A 3D6HB 4KGMA 5B08A 5A0YB 1VLOA 5C25B 1EX8A 3R3TA 1TKDA 3DRPA 3DI6A 4DLEA 4DV3J 2JNJA 3VZHA 2EFVA 1QSYA 3TEHB 2X1GA 1FNOA 3MWBA 3HVAA 2MY8A 1VLYA 3UDEA 3EYZA 4GKJJ 4PR6A 1NSKL 4I68A 1VIXA 3EX7B 5A6WA 3NNCA 3VGSA 3PX4A 3AOCA 3LW5C 5KFAA 2ROGA 4CIOA 2C2DA 5GAGI 3QIPA 1LXNA 1HQUB 3TUPA 2E1CA 2QA4S 2DRBA 4OYIA 2MMYA 3AHPA 2ZM6J 4WF9Q 4JYAJ 5DZ7A 4W98A 2OPPB 4ZVUB 3HHLC 3RR7A 1NUEA 4PAAA 1D8ZA 1HMVB 3OL9A 2IRYA 2VA3A 2AGOA 2XMTA 2RQCA 2CWXA 4DUTA 4X64F 2IA0A 2V5HG 3G82B 3E01A 1RTHA 1NKEA 3Q8YA 4EBDA 2NXCA 1X5TA 2QSFA 2H54B 3IXQA 2ZH2A 1VBZA 1TFYA 3GIJA 2E5HA 2IY5B 4JI1F 4MK9A 4PWDA 1C2PA 5HLFB 1NNDA 2BJ9A 2GHPA 3MMJA 3LP1B 4KH0B 1S9EB 5E3AA 3TZZA 4NEYA 2F4VF 2HHHJ 3OLBA 1HYSA 3FCVA 2RRAA 3Q2SC 2GW8A 3I32A 2IMWP 1Z2ZA 4LFBJ 1VMBA 4YB7A 4EO6A 3ZZRA 1N5SA 2BZ2A 1RWPB 3GIRA 4NXMF 1JXLA 2QA4G 4LFAJ 4RNNA 3FSIA 3KK3A 1U49A 1AYEA 4YP3A 2F1FA 5IQ6A 1W25A 2XS5A 4KO0A 1U2RA 4KHPF 3BKTA 5EX3A 3KLIB 4KV8B 3RTVA 4DCJB 2FLOA 2LXFA 5I42A 3ETMA 3PYDA 5D3GB 4OHZA 1SL0A 1EKSA 3MMBA 2W8LA 5K8NA 3ZZ0A 5KT7A 1J5EF 4KGXB 4RX6A 4JI2J 3TAPA 4DV0F 2CJAA 1VQ8S 3BSAA 3EVMA 2ACMA 2CA9A 2F63A 4PUOA 3J7AN 2QL5B 1HBNB 3ZO7A 4L3NA 2OTLS 2DHHA 3W2VB 4OHYA 4HTIA 4B9UA 2HHUA 2ZD1B 2H65B 4L73A 4TLQA 3BR8A 3HO1A 2KN4A 3J7YI 5DDRC 3C14A 5I3PA 2ROEA 3G6YA 2GIRA 2W2QP 3JSMA 2FY8A 3WC2A 3TOQA 2AYMA 3MOZA 4A8WA 4NLGA 4RLEA 1L3KA 1U47A 2CQCA 2KO1A 3W2WA 4P2SA 1TP7A 1U1QA 1OY9A 1SH0A 1X4AA 2AQ4A 4IOCQ 2E9RX 4GC6A 2VB6A 3CCLS 3K5MA 3IWXA 3IBFB 2K7JA 1QE1A 2HSEB 3CIZA 1UEKA 4DCOB 3M05A 4DWIA 4ETXA 1E6VB 1TKXB 4OZJA 3EUNA 1S72S 2A0FB 3QT6A 4QWDA 1ZETA 1A0OB 3HHLD 2BW7A 3F41A 1NK8A 2N3LA 3V4IB 2RF2A 2WSEC 1R8HA 2ZBRA 3X3UA 1H38A 4F4YA 1YHQS 4QZVB 2ZVIA 1NXIA 3RB6A 4ATNA 3DKDA 2M8DB 1U26A 3S6EA 4QW8A 1TK5A 2G0CA 4A8SA 1S6OA 4RW7B 1PYOB 2KKHA 4X62F 2GO8A 4KGVB 2IM2A 4OYXA 3DLKB 1C1CA 4WFBQ 1TMMA 2DNMA 1U4BA 4O3QA 4WU3A 1GMUA 2MYFA 5D0EA 4M5DA 3DRRA 1OY8A 2E1PA 4OI6A 2QL9B 3DRSA 4PG4A 3H40A 3MEEA 4QYZK 5IC4B 1SJ3P 1ELOA 3PW5A 4OYAA 1NJZA 2MQNA 4RW9A 4DV1F 1S4FA 1P9QC 1OSCA 5E3QA 3OL8A 4ZLNA 1T9TA 1EP4A 2DNGA 3IG1A 2DPJA 2F3JA 2RDDA 1YBAA 3WDOA 4NLPA 4Q43A 5J2NA 4NX9A 3ITHB 5IT0A 3CCUS 3BGOP 1VS3A 2V67A 3BGLA 2ALZA 3PX6A 3CMQA 2DPIA 3QFHA 1TUGB 1N6QB 4J7CA 1VC6A 2C42A 2UUAF 2HHSA 1AW0A 3K17A 3FK4A 5DG8A 3MECB 1CULB 2J9DA 1Q79A 3PKMA 3ZZZA 4U6PA 3PKYA 4NRTA 5CA5A 4NXNJ 1AROP 3F44A 1S1WA 4RW8A 2K7KA 2BA9A 3OTOF 1IKXB 4KRWA 4AL6A 4F2RA 2MSTA 3TWZA 4CH1A 4CWBA 5M2RA 1F1BB 1TKTA 2V8GA 3KHRA 2V9WA 2UU9F 4MK8A 2LQBA 2B4PA 1RA7A 2FC9A 2FJWA 4IOAQ 3V81A 4C8ZA 5F3ZA 3U27A 1OWXA 3OVSA 3W5XA 3LP0B 4HACA 4EBEA 2UXBJ 2BV3A 1OYDA 1G6BA 3PY8A 2VBYA 1WUUA 3VGTA 2R2UA 1M5VC 4WIIA 4A8MP 3M8QA 4H4KA 2W1BA 2I5JA 2DY1A 4GC7A 4Y0FA 2XQCA 1RAGB 3BO3A 4CLTA 3D0GE 1U24A 3GMGA 1W2BR 3P3DA 2XB2D 3DC2A 2WSFC 1QD1A 2HNDB 5CQGA 4HHHA 3AD7C 4C8LA 4X65F 2LFVA 5LJ5Y 1NCLA 2QX0A 1ZBTA 4ILLA 2BR0A 4FYWB 4B3MJ 5KAKA 5CYQB 3OLAA 4KYZA 5M2UA 5E3CA 3SBMA 2PE8A 3OFHA 2RVJA 3D7SB 4EGLA 5DDPC 3QJLA 3ENAA 1R3NA 1NDCA 4FKXA 1XNQJ 1N34J 4RW4A 2HHWA 4O3NA 2NSBA 2X51A 5KT6A 5A2QY 1VHIA 1D0EA 2DR8A 3ETOA 4J9UE 2W8KA 4K59A 1WELA 3G8SA 4I2QB 1T3OA 4YEAA 5KFFA 3H2LA 3MURP 2GJIA 1N54B 2DXDA 3D1OA 2JLFA 3AJ1A 3SSQA 2MGZA 2CDRB 4RW6B 2YQ0A 2DT9A 5C42B 3TANA 2DKOB 1T9XA 3VHQA 2G2OA 1TVRA 4BHQA 4IUFA 1Q5YA 2CG4A 1K44A 2KJVA 4UQTA 3MUMP 2HHVA 1NH8A 1K1QA 2RKIB 1WG1A 5DLGA 5CZVA 4YOEA 3OXGA 3R2CJ 2XMWA 2FIUA 4HI1A 3JQKA 4N77A 2HHTA 2WBMA 2QMUB 3QAUA 2CFXA 4O4GB 3FGVA 1TELA 4QW9A 3TA1A 5GAEU 3UN2A 3JYTA 4WZMA 2OPRA 3VVTA 1KS2A 3D6MB 1KBRA 3AT1B 2DHAA 3M2UA 4KKOB 3G96A 1YJRA 2CNNB 4OQJA 2HZAA 5MLCV 3NOCA 1WOSA 2DHXA 1WDDA 1IKWB 2GIQA 2QLFB 1UZDA 4I6AA 3RU0A 3UI3A 1VOMA 1Y3KA 2XGPA 2GVDA 4BWMA 1FWLA 4CYUB 4PCQA 1PBAA 2YKAA 3QT8A 4IH5A 1TL7A 3TAMA 2XG8A 3BO2A 2A10A 3W64A 3PHTA 2BM1A 2JZ5A 2H4WB 3GLJA 3KG0A 2PO4A 2HVEA 1HKAA 3MR7A 2QE5A 3RW6A 1S5ZA 1Q53A 4E8UA 2BKNA 1CEZA 1XBWA 4IDKA 2N4CA 3ULHA 2J9EA 3MCNA 4L74A 3IM9A 2ZKTA 3VALA 4E2FB 4LBIA 2W7OA 3OPKA 1ZPWX 5B0AA 5EN1A 1TL3B 2ZVSA 3QATA 4QJVA 1KTVA 3MD1A 2DHGA 4X4OA 4NZ7A 2CQHA 3W9HA 2ATLA 1KLMA 3T5LA 1EETA 5FDLA 4TY8B 4NCBA 1HR0J 4QQBA 3U02A 4CI0B 2COLA 1UL3A 4KSEB 1CBKA 3KDOA 3NGDA 4ZVEA 4D3GA 2NUHA 4NRUA 3J80U 4LF5J 5KTQA 1TZ0A 3P6YC 2MQQA 2ZH9A 1GX5A 1QM9A 3CNQP 3T9NA 4ERDA 2KJWA 4C11B 1DTTB 4GKJF 1UEUA 3W3SA 5GADI 1H2VZ 4NMLA 3SQGA 3LO3A 4CM2A 3T1YJ 4DL3A 3MM7B 1F6TA 1U1PA 2EEYA 1HNIB 3BDPA 2HFSA 2CRLA 4PQUB 4LF2A 1V9OA 1HBUA 4JI6J 1S9FA 4LF1A 5HI7A 3W65A 5JUMA 1LW0B 3D3CJ 3KHGA 4OHXA 4F3MA 2UP1A 5EWEA 1U6ZA 5RUBA 4C8OA 4JI5J 3OTEA 1Y3JA 4CO4A 2PN6A 2XSJA 4KAIA 3VQSA 5J1EB 4A8XA 3D67A 4ECQA 3CJ5A 1R0CB 2B4VA 1IBLF 3L7UA 3CJQA 4FYDA 4LSLB 3PEHA 1TUVA 1WC6A 2YNGA 3KUHA 4F7VA 2KRRA 1LWCB 3AJDA 5H1SV 3CCVS 4R5PA 1UJ5A 4EMDA 2QGFB 1J5OA 2HHHF 4YS2A 2LP4A 3TW0A 1UKUA 2Q1LA 1VQ7S 2IIHA 1GMWA 1U6FA 5IV3A 3OHBA 5KFZA 3F0NA 2XYHB 4ZHRA 4OZLA 3ZTSA 5KFJA 3MZIA 2O66A 1VQ6S 3I0RA 4DL6A 1N36J 2AV5A 2R42A 1SUQB 1TL4A 4PXCA 2VJVA 2RU9A 4O44B 2YWHA 1SJ1A 4PG8A 4USTA 4AL5A 5EHHA 4ZVGA 1BY9A 3EDRB 2C3UA 3GSIA 1IUJA 4LSZB 2LYVA 3MPYA 2J0XA 3C8YA 1Q8KA 3IS9B 1KSPA 4B9TA 1RT5B 2OTJS 1IN0A 5IXUA 2AHOB 1S49A 9RUBA 3KLFB 1CJVB 4J5OA 1KRPA 3WC0A 2C2EA 3CCRS 3PXGa 3C19A 3JSYA 2R9LA 4DBQA 4ELTA 4MKYA 5K5MA 1S7HA 2UUTA 2JFDA 4RPFA 5LMNJ 4ZN1A 1R8CA 1YK9A 2IBOA 4JV5J 3NNHA 3B4DA 3CDWA 3MPUB 2HAFA 1N33J 2V6AA 1FX2A 3KG1A 4ER8A 3NL0A 4X84A 4ECSA 3HSJA 1S0VA 2VJUA 4IOBA 2CNLB 4MKVA 3SDEB 2UVVA 3H5SA 4Y65A 4DPXA 4CLZA 2JJ4D 5F9NA 2MZSA 3NXZA 2NR0A 2XZWA 4K50A 4V19X 4HI2A 5F8MA 1ZPVA 2MLXA 5A0YA 1L3VA 2IAJB 4ZOSA 5C25A 4IH7A 3B54A 5LMUF 1CVJA 1HHSA 1KVIA 2QMWA 1RAEB 4YHHJ 4C98A 4UUWA 3TJ9A 2ZBIA 3ZZTA 2FLNA 4F0HA 4WBFA 2V8HA 1X0PA 3GIKA 4ES1A 2UUBF 4LF8F 1LWFA 8ATCB 1V3SA 4RNFA 1Q1KA 4RR5A 1UZHA 1ZS6A 2QN6B 5CZXA 3QRRA 1HQUA 2B51A 4DN9A 2FJVA 4WP3A 1T7PA 3PJ9A 3FCHA 3HI9A 3CMES 4IG3B 4I67A 4X66J 4ECRA 3GIIA 1GXTA 4BLGA 2CQ3A 2IJRA 3R1LA 4F02A 1HMVA 3TJAA 3MMAB 2OEMA 4QYRA 2L9WA 3H8YA 1IBKF 2O5DA 2AJ0A 3R5JB 3G82A 2LDIA 1RSCA 1YITS 1TV6B 5H9EJ 4N41A 5HROB 3M8YA 2HNZB 2PMZD 4B3OB 3TARA 1CQNA 2AGPA 1FRIA 4QU6A 2ZDOA 3LUYA 3M6UA 2QRRA 3AFGA 3D5MA 4O0IA 3NGSA 2CQGA 2K1RA 1S9EA 5D6GA 3PW0A 2CQIA 1VRUB 1NMEB 1VQ9S 4HT7A 1HI0P 2K2PA 2ZHBA 4JI0J 4NLWA 2MKKA 3OTCA 3PVXA 3QPIA 2QFJA 2GJFA 3TZXA 1PCAA 3ZTQA 1FXDA 3FRYA 2V2QA 4ZLPA 2ZKUA 3N28A 1YJVA 4UY8T 5KT2A 4NXNF 3KFWX 4C8YA 3FEYB 1DTQB 2ASYA 1LOUA 2GS8A 4LRAA 1URRA 3KLIA 1MW7A 2Y9HA 4KV8A 1B7YB 2AYGA 1R43A 1R6VA 2W9BB 2HWHA 4PPZA 3PYFA 2R7VA 1U7LA 4Y2AA 4HKQA 5D3GA 2DHSA 2JLGA 4DL0C 4HL9A 4X4TA 3TZYA 4CT8A 2A2CA 4EK2A 3HMJG 1IXKA 2JLEA 1NKBA 3DOKA 3JXOA 1YG0A 4K5SA 1Q7YT 2UXBF 4P52A 1HBNA 3IMQJ 4F25A 4FF1A 3EGVA 3KUEA 1QAYA 3QO9A 4FS1A 4OV6A 3W2VA 2JDJA 4Z37A 2ZNZA 2ZD1A 3ICLA 2RQKA 5F8NA 2KRBA 2KG0A 2WB1D 2KYZA 4NLVA 2XYPB 1DLOB 4PQAA 3TEGA 3W5YA 4USUA 2ZEJA 3DM2B 3Q8PB 1XR6A 3HT0A 3OL6A 3SZ2A 4Y2MA 3IFEA 4IQXA 5L1KA 2P2CB 1NHKL 5HSPA 4C2MA 4BC7A 1ZM4A 4Y6IA 2OO4A 4TY9A 4K4WA 4C9DA 5L1IA 1F5CA 4HHUA 3UVJB 2U1AA 2NS1B 4NMXA 4P2MA 1CLFA 1ULRA 2CYYA 4PWWA 3T3FA 3N5FA 2ZDPA 3H59A 1TKXA 4F4XA 3HHEA 4B17A 1D8YA 2ZH1A 3UE2A 2RRNA 2GHWA 3V4IA 2CJ9A 2J8SA 1AUSL 2NLWA 3KG4A 3Q8QB 4K4VA 1RISA 4I0WA 1BMQB 3T5HA 1EQ0A 5KFMA 2MZ1A 1NK0A 2B5JB 1RWOB 4WFZA 1NZAA 3BYPA 2GZOA 4Q7AA 4FNHA 4RW7A 1Q86T 5DRKA 4ZVSB 2CKWA 2XWYA 4QU7A 2GQ2A 2DCUB 4NA1A 2DB1A 1N4LA 3DLKA 5KG7A 2FJEB 3IBCB 1CQMA 3K59A 4Z7CA 1NH7A 4DR6J 1TMJA 4ED8A 1GT8A 4NYZA 1RAOA 2LEBA 3LPYA 3GE9A 1R7IA 2VQFF 4B9SA 3DI6B 2RS8A 2VIHA 5CHCB 1R89A 4AQYJ 4OJ3A 3KDNA 2M7SA 2OPQA 4OZ3A 4CP5A 3OJUA 3ZZYA 1VRTB 3R2DJ 5KFVA 1FT8A 1Y5IB 2OI2A 2H9ZA 5KT3A 2FJXA 3MM5B 4FYXB 1HW9A 1P8GA 3ITHA 4CLWA 2OJ3A 4R25A 3DOMA 1ZTWA 2PA3A 4L76A 2E5IA 1N6QA 1JLQB 4N76A 2ZHAA 4X4QA 3MFHA 2AWZA 4FDFA 1F9EB 5LL6d 2Q3PA 1KOHA 2CZVC 3D0HE 2BE9B 1MWQA 4C8KA 1ACMB 2YKQA 5HO4A 5IWAF 3BQ1A 1SKUB 2OSQA 1OPIA 2AEFA 1AUDA 1IKXA 1UFKA 2YX1A 3RRKA 5HMYA 2VPWB 4ITSA 3HVRA 4DL2A 1FI4A 2K3KA 1KQFB 4PXEA 3AD8C 4JI3J 2GV1A 5K20B 1N5TA 4P2FA 2MSSA 4PPDA 5KFOA 3LOUA 3O3LA 4HH1A 5BXIA 1V6HA 1U48A 4U9RA 3LWLA 3OBIA 4J9KA 3G6XA 2PDAA 4I64A 4M5IA 2XLIA 2C2ZB 3T19A 3LP0A 1WJ9A 5KG2A 1GTHA 4ECTA 3KHLA 1ROFA 2EXUA 1WF1A 2YVSA 4K4SA 1MMDA 4KE5A 3D54A 2OMLA 3IWNC 2OHDA 4TU9A 2ZOFA 3KLEB 4W92B 3HULA 5CAAA 4AL7A 5T14A 2FVPA 1N0VC 1CJKB 2MKIA 1WEXA 3RB3A 3M8WA 5IT9Y 2IYGA 2ZH6A 4LIRA 2XWXA 3UCUP 1UCNA 3KK3B 2HQGA 1NHVA 3MM8A 1KLNA 1J2VA 2AJ4A 3ZNJ1 2VQEJ 2WVDA 4CO3A 4KO0B 3GZ7A 2BM0A 5CYQA 4HH0A 5MAOA 1UW9A 3BF4A 2I6WA 2HQIA 3PDNA 1NZ8A 2BJ7A 1I51B 3EZUA 4ZK7M 4WZQA 1X8DA 2C3PA 5DZ6A 4K0KJ 1FNMA 1WHXA 4ENOA 1UJ4A 5ETRA 3NMAA 2Z56B 5F41A 2R8IA 1HNVB 2OH2A 2MDAA 2WONB 2Z30B 4I2QA 4X2BA 1WC4A 1S0NA 4R8UB 2YWGA 3KHHA 2DH8A 3AD9C 4OJHA 4ECZA 2CQ2A 3D28A 4J9PA 4KT0C 5C42A 4DUZF 2QA1A 4J9RA 1APSA 2HFZA 3L7PA 2ALYB 3CVKA 4B9LA 2VD3A 1ZA1B 4NE9C 4A8QA 4RU2A 4Y28C 2RIJA 3M6WA 3OT9A 3DDNA 3W2WB 4BC9A 3PG9A 5JMNA 1RAFB 1HNWJ 4UY85 3Q83A 1VQNS 2AX1A 1AFJA 3N5BA 4O4GA 1PIEA 2JEGA 2UXDJ 2RQMA 4LF4J 2E9TA 3SEOA 4H4OA 2VA2A 1S79A 5DJBA 1N36F 4DR3J 3I87A 2BDPA 1TFWA 3DNCA 2HS4A 5D78A 3GWCA 4KKOA 2QLJB 1WOPA 4QIGA 1EIYB 2CPXA 3OSNA 1QAXA 1IKWA 3IO1A 3R6LB 1X5OA 2IM0A 1HWUA 4DDFA 2J0QD 2V8DA 2B6AB 4XIUA 1RWWB 3CJ3A 2AT1B 3C6UA 4LF7J 2HZVA 1IJFB 4CYUA 1YRXA 1HWKA 1YSJA 2HQ3A 4KQZA 2B9YA 4O0NA 5ETSA 2XMMA 1CS4A 1V5VA 4B02A 3H98A 1TKZB 2E66A 2XCPA 3HJVA 4RUCA 2JSXA 4O23A 2DO4A 4JV5F 2CPJA 3QIDA 4KTQA 2B9WA 4LBHA 1N33F 2Z8QA 1MWZA 4ED5A 3MEEB 5G4DA 5A76A 2JL9A 3TA2A 1SL2A 1YJTA 4RW9B 3W5ZA 5FLXY 4U96A 1UVNA 2R7XA 3CT9A 1O5JA 3BH6B 4QR2A 2YX7A 4TY8A 3RR8A 4ZLLA 4DR1J 2V63A 3DHXA 1RWNB 4IG0B 1LW2A 2HYIB 3IA0A 2OFHX 2DGWA 3G2XA 3I82A 4PYAA 1HD0A 4UT4A 2DIVA 3HSDA 2EC2A 3OW2R 4J9NA 4NLQA 4J9SA 2E5LJ 2FVCA 4C11A 3QLHB 1T0TV 3NWGA 1U1KA 2L08A 2BX6A 2APOA 2MQPA 4PXBA 5ETPA 1PYTA 2CQ4A 2QTWA 3MM7A 5E2QA 1MWYA 4X4NA 2IYIA 1RXOB 4UOCA 3T6BA 1HNIA 1SIZA 3OXFA 2XS7A 1LW0A 2YY3A 4JI7J 3DGPA 5DO2A 4ZVHA 2IMOA 4DV5J 2ZZMA 4USMA 4HACB 5AE1A 2VKZG 4UOGA 1F60B 3M8PB 4WK3A 1T05B 5J1EA 4DFJA 4UF4A 4F36A 1WD6A 3M8QB 3UCZP 1ZZNA 4IFVB 4OFZA 4I6WA 5J2QB 2IVYA 1XN9A 2FY1A 4DFKA 3TZWA 3TA0A 3WIUA 1HNXF 5EGYA 2ASLA 3ISZA 1YLXA 2O01C 4LSLA 3I9V9 1U1NA 2R3VA 2VDIA 4RUAA 1PO6A 1LWCA 1SH3A 1XTZA 4OX7A 1WHYA 3KLHA 2RS2A 5KG4A 2R7RA 3CB4A 5AXMA 2Q6BA 4A8OA 4DLGA 3M2RB 3AQPA 2Z4PA 9ATCB 4YUDA 1WWHA 3FCWA 4ZVQB 3ZTRA 4ZPDA 3EE3A 1RKJA 3NAHA 2KXHA 2CPHA 2HHPA 2NREA 4DCPB 4ELUA 1RAIB 2WZ1A 2L48A 1T9VA 4FBUA 3FEXB 3Q8SB 1S59A 5BYQA 4NI2B 4AE5A 1R31A 2P9EA 2ZNYA 4C4WA 1HBOB 4O44A 3BN4A 1FHTA 5CCLA 1Q8LA 2LXUA 3BKFA 4P72A 1QDUB 2YKNB 2F9JA 2H5JB 1WKJA 2V2KA 1TVRB 4YB1P 3CJ2A 2ZJRQ 4K4XA 4K4UA 3Q8UA 2YKMB 4EBCA 3KLFA 1CJVA 4C97A 1U09A 5LM7E 2FHMA 1IQTA 2CVIA 2WRMA 1UP1A 3GTYX 4J9QA 3BEGB 3OUYB 1ZTTA 3TAQA 3CJRA 1RT2B 2OPSB 3K0JA 4OV1A 3EZOA 1I1GA 1VRQC 3ZC4A 3SCKE 3KTQA 2AKWB 1FRJA 2QIFA 3CO9A 4ZP7A 1RHJB 3SCIE 4WP9A 3BKUA 4H4MB 1WKKA 2CG8A 3ZTOA 1NSAA 1TAUA 2OPRB 2IC3B 3SDEA 1XMOF 2LMIA 3EXCX 3MCMA 5SZTA 3UDCA 2IRUA 2B3TB 2WVBA 3VQTA 3JB9k 1CC7A 3M8ZA 4QPTA 2W9CA 5AJ3F 4I4BA 5EDWA 2A6OA 4B3SJ 4OYZA 4AD6A 3MI7X 2R7OA 4ID8A 1WHVA 3K5PA 1S48A 2RMLA 2NPIA 1MMNA 2DNLA 3KK2B 3AXKA 2VZ9A 1G7CB 3BGRB 2KH9A 1VJWA 2J9CA 3OFGA 1JK9B 3I5CA 1PJ7A 1N5VA 3TAMB 2YNFA 3VAGA 3GV5B 3PNIA 2IVFB 3BGUA 3O1LA 3U7JA 2CIMA 3UDLA 4LIWA 4H54A 2B56A 5KFUA 3UCGA 1IWAA 1TK0A 4Q2MA 4LQ3A 4DF4A 4NLTA 3TYTA 3KJNB 1RT6B 3NBPB 2GCFA 5EWFA 5FIIA 2AJFE 4DPUA 3JAMY 3UW1A 1VHFA 3W8GA 4XDCA 5DLFA 1HNZJ 4IG3A 5L1JA 2W4DA 2DR5A 1RQ0A 4ES2A 4ZVPB 1T3NA 4NZ6A 2XGQA 5AE2A 3NG8A 3MMAA 5HBMB 1VQMS 3VAJA 4LR8A 1ZAVA 4YR3A 1S97A 4GKKJ 4DR6F 1OQ6A 4X4RA 5GMEA 1TV6A 1BGXT 2AGQA 5BJRA 2QLXA 1YDLA 1JJCB 3VWSA 2AMCB 3I0SB 4DL5A 2HNZA 3RB0A 4B3OA 3SYZA 5ETOA 3E8OA 2ZJPQ 4UZBA 1G3OA 3TUZC 2N4DA 3UQSA 3B6BA 1FKOB 2P5VA 1VRUA 3D66A 3R5GA 4DXLA 4B3RF 2WTFA 5KG1A 4ANEA 3J81Y 1YJ7A 4OYOA 2E9ZA 1SV5B 2KT5A 1RWKB 4LF9J 2QLBB 4GO7X 4DS5A 4U67Q 4UW2A 4NLSA 4DJBA 2E29A 3VF0B 2E1MC 2MHNA 3TVZA 1OIAA 1AZSB 4NLYA 3BBCA 3H5YA 3HD2A 1BWVA 3DYAB 1NKCA 4OI2A 5L8RC 1X4GA 1DTQA 3KNGA 2RT3A 4OHVA 2XI3A 2XTJP 3FUYA 2C3YA 1BQMB 2W9BA 2FD2A 1FJEB 1AT1B 4USVA 1N52B 2LQ8A 5KFTA 4IFYB 1YWXA 2YX4A 3GCWP 4G1IA 2MEWA 5F3TA 3CTRA 1DY3A 1TU0B 1JJ4A 2IM3A 4CO5A 1FJ7A 4FXDA 2QJ3A 4Q8EA 2YTCA 2NYHA 3R5AA 3HHNB 2Y0SD 4ECYA 4A8KA 1JKHB 1CSJA 4JUZA 2BQRA 1DLOA 3NS6A 4LQ9A 2G0JA 3QBCA 2N82B 3DM2A 1VBXA 1T95A 4BWJA 1U0SA 1BQNB 3O8WA 3T41A 2J5AA 4DMZA 4YR0A 2OEJA 3VAMA 1FEHA 5HQMA 3HZGA 3FKBA 4ZCLA 2H3EB 4P10A 5L39A 3P49B 4FPIA 3QGIA 3GR0A 5EWGA 1MN9A 4J9OA 3MMCB 5DDQC 5DDOC 5KG0A 6FD1A 4ZDNA 2AF6A 2WVFA 1RBAA 4OZ1A 4CH0S 5B0DA 2DXFA 4FXWA 4KFBA 3QFWA 1CC8A 2W9AA 2ZC3A 3L95X 1NB7A 3BJYA 3HPOA 2CADA 4QIEA 3UN5A 3PIPQ 4DOZA 1V3RA 4C0BA 3BV8A 4RWXA 2FHJD 3MEGB 2VV5A 5J2MB 1NBEB 3T5KA 1LNQA 5DQIA 2RQ4A 2EFGA 4QWBA 4Q45A 2D1CA 3M6VA 3RW7A 2D3UA 2ILYA 2GHVC 4LVOP 3WX4A 1E6YB 2JC0A 2X1BA 2RSQA 3DRYA 2HHQA 3TVYA 4RUBA 1HNWF 4CLYA 2FLPA 2HRTA 2R2SA 1R0AB 1NPRA 4USJC 4ED6A 3CD6S 3W9IA 4F50A 5DGAA 1T11A 2LCWA 1S77D 1XJWB 3I4PA 1VRTA 3ILOA 1CJTB 2WAQD 4A48A 4ECWA 3UFCX 4DR3F 2C3OA 1LWFB 3MM5A 3PRDA 1RA6A 2FZKB 1DBDA 5KFQA 5KOXA 2ERRA 1RLDA 4WU2A 1ZYQA 1S57A 3HVTB 1D3WA 1FE0A 3FVYA 2H5EA 4NA3A 2XULA 2EG1A 1JLQA 1FNXH 4LJMA 2HVZA 2ATCB 5HQLA 1Q8BA 2I1RA 3NGTA 4A46A 4HDGA 3BREA 2ADBA 3NCPA 2KFYA 3A12A 2EI5A 4DV4F 3CDAA 3ZZOA 4MT1A 1M5HA 3SSSA 3P4UB 3FSXA 4ZIWA 4MK7A 5DETA 1P6TA 1TTHB 1IR1A 2HRUA 2BUNA 3OTDA 5K14A 2MKHA 2B8PA 2OSRA 1YGYA 3H2UB 2B4UA 4TXSA 1RT1B 4JI8J 1RAAB 2K1RB 4DX5A 2I8EA 2JVRA 3AB2B 1Y11A 4G1QB 2J7WA 3HLUA 2CPZA 4DR1F 2EKNA 3KLEA 1C4AA 3M30A 2DYAA 1KVJA 3K5OA 1RT4A 3DXBA 2C2NA 2FVQA 1CJKA 1FTCA 2C1EB 2XZDB 2DNOA 2CWKA 5AXLA 2JH3A 4I2PB 1NPPA 2ZE2B 3UN3A 1KHWA 2BJ8A 3OSPA 2E5LF 1I94F 2I2YA 5E33A 1U1LA 3NS7B 4JOUA 3KK1B 5A8RB 1IR2A 1C1BB 1Q4RA 3KUGA 3AA8A 1U45A 2CQ0A 2A3JA 3MEDB 4WFNQ 1HHTP 3ELHA 5I3UB 4YMEA 3E2EA 5KFKA 4HDHA 2YPYA 1UPMB 3DOKB 2XY5A 4ZPWR 4DR5F 2ZH5A 1R8BA 5HVGA 1HNVA 2C2KB 4B08A 2DR6A 2WONA 2CNOB 2LU1A 3AY0A 3EGZA 3BGFA 4R8UA 3HX9A 3QO9B 2RDIA 3ISNC 4FZVA 3MM9B 2AJ2A 3BPSP 2UV8G 1DFDA 1RGVA 3CPWR 1QJHA 3MXHP 5E3RA 4TYAA 5GMDA 3ET6B 2YH0A 4LR9A 1P27B 2ZH7A 3IR6B 2BQ3A 2DNQA 1RU1A 5F8IA 3RYLA 5HL7Q 1GMWD 8RUCA 1N32J 2Y1JA 2P6TA 3RBXA 5CYMB 1WNEA 1UVIA 4NLXA 3I56S 3PCOB 2EK6A 1B0PA 3ILJA 1OYEA 2GA7A 4JI1J 5A2QU 4MIWA 1Q7LB 3A13A 4MIBA 4WYLA 3CXCR 3CW2C 2HURA 3Q23A 2F4VJ 1UWAA 1Y5LB 1PC5A 1ZH5A 1NSPA 2B6AA 1GH8A 1K0VA 5F9LA 2CPEA 3THTA 1FD2A 2YKPA 5JJBA 3HCXA 1SC1B 4XTTA 3NNAA 3L09A 1TK8A 2W4CA 4MAKA 5D4OA 1UWBB 2H5IB 1X60A 2HFUA 2WHOA 3CC2S 2KU7A 2DR9A 2KVIA 3H7HB 3EZ5A 3RAQA 4OYWA 2LA4A 2O1PA 4ZCIA 2HHXA 2GIFA 2ZUGA 1F9HA 1TKZA 3IAM9 3OVBA 3US5A 3MCSA 4KHPJ 1H72C 3JSRA 3ILLA 5DM7Q 4QCLA 2E5GA 2WVEA 5KFYA 2UVRA 3CJTA 5A8KA 1M0SA 1OSDA 1X4HA 4DUYJ 1C4CA 5B7WA 3HVWA 4WKYA 2KFZA 2OPQB 2XMUA 2JVOA 4FNIA 1QAJA 4DV0J 4I6YA 3BDEA 2B43A 1RABB 4Q44A 3CIMA 4B3SF 3DOMB 4F2SA 3M8RA 2V2ZA 2B9EA 3SFGA 2XHCA 1LKZA 1ZOTA 3TUJC 4IG0A 1CJUB 3W61A 1U1OA 3B4MA 2XMJA 5K9FA 3CD0A 1OPZA 1T9YA 1DHMA 1U8SA 2Z57B 3OV7A 1G2EA 5GVQA 2SXLA 2AJ1A 2UVUA 1G1XA 2BJDA 3ENWA 3QLHA 2HBQB 4A4JA 1MNEA 3PHEA 2DH7A 2MY7A 1WACA 2EK1A 5C24B 2Z2MA 1XMQF 3ISND 5CCMA 3T1HJ 2CJBA 1VQPS 2POKA 2YWFA 2VDHA 3AA9A 2B7BB 5F8HA 4MKAA 1F3FA 1YZ6A 1RJJA 3MAAA 4LMZA 1NAQA 1H98A 1S4EA 1HNZF 2OUGA 1S1XA 3OD2A 3CCQS 2OLWA 4LFCF 1WEYA 3M8PA 1T05A 2NCKL 1LV5A 4B9MA 5HAOA 2VH7A 4IFVA 1M5SA 5J2QA 1SQFA 3AXMA 5B09A 5GAEI 1JLBB 3PO4A 3HT3A 2RILA 4TKTA 5A6PA 4USKA 4GVBB 3DOLB 3KJQB 1JIHA 3NY0A 4ZVOB 3MAHA 1LXJA 5I4MA 2WVCA 3MM8B 4EO8A 1BC6A 1NRKA 3LGNA 2MLYA 2NXJA 4O3PA 2GAGC 3H20A 4N8NA 4XPEA 1VJQA 1F5AA 4G65A 2CDQA 3LAMA 3M2RA 3VAHA 4GMKA 2CPYA 4CO1A 4LVNP 2HK3A 5ETMA 2V94A 4FYVB 5FJ4A 3MAQA 4J90A 1KR4A 1S99A 3IR7B 4NI2A 3I4HX 4DV1J 1I3OB 5T41A 4RBUA 4LF6F 1HBOA 1PBUA 2AYBA 1FXRA 4L72B 4AUKA 4WJBA 4Y3CA 3ZFVA 4QWCA 3JS9A 1SC6A 3TVKA 2IFXA 2YKNA 2V8VA 2J9DE 4WFAQ 3IWLA 5KFXA 2CVEA 1Y00A 1YJWS 1YJNS 2UUAJ 2FHJA 2YKMA 3EVOA 4P73A 4RNOA 2XY7A 4P7TA 1R0BG 3GJRB 5CXTA 4BBYA 2F40A 5KG3A 4EZ9A 5GAHI 3FJ2A 4N5SA 2UXCF 1IR0A 2BYCA 3OUYA 1KHVA 4CO2A 1VK3A 3W62A 1FJCA 1RT2A 2OPSA 2CAJA 3EJMA 4WFYA 3BYRA 4H4MA 3TO8A 3BBFA 2JOQA 1EJ7L 4H4OB 3QSYB 3G4SS 4F4KA 2IC3A 1VISA 3V4MA 5L38A 1UTAA 3PJWA 5IQQA 2W25A 4XAKA 2YNIA 2X1FA 3QZ7A 3SQOP 3UO0A 1UW4A 2GNKA 2NYIA 3SV3A 1JMTA 4YY3F 4QWAA 3KK2A 5DQHA 3BGRA 4DR7J 3C6UB 1D1UA 1Q95G 4GO5X 4OL8A 4IO1A 2ZZTA 4QR0A 4ILRA 2QYCA 3R7SB 4G3IA 4ZJLA 3FBFA 4RKUC 1FESA 3GPAA 2DNRA 1CS4B 5EUHA 4CZCA 3CULA 1XWLA 1XQIA 2FTRA 3SMZA 3IM8A 1S7IA 2BVZA 2DVIA 1RT6A 1P1TA 2HEKA 3NBPA 4DSEA 2VUGA 1HI8A 4DSLA 3NGKA 2O67A 1RT7A 3GV7B 1OO0B 3NOGA 1WDTA 1MN7A 2HFOA 4ZVRB 3L3CA 3BN7A 4AFFA 2QZ8A 1NU4A 1KTQA 3A3OB 1NDPA 4E0DA 3G86A 3KOAA 1FDBA 1SIWB 5HBMA 4F04B 4ZVFA 5LXYA 1VFJA 3M1VA 2JEFA 3F73A 3RZAA 1LW2B 5D8HB 3N01A 1TAQA 3I0SA 5D15A 4DV3F 7AT1B 3D68A 1NPKA 4O4RA 4CRJA 2VKRA 3F56A 1X4DA 3HD1A 1IJEB 4U8YA 3X1LB 1RTDA 2EFPA 1FKOA 4CNZA 1FJGJ 3MUTP 3OVAA 5B0EA 1NJWA 5SUHA 5ETTA 3PZPA 4DFMA 3PR5B 2JEIA 1KNZA 1SV5A 2QG9B 3C66A 5E0OA 1REVB 1SCJB 3BR9A 4M94A 1KONA 1B0TA 2EBEA 4EFAC 1FTRA 4OI1A 4XPCA 1AZSA 3DGPB 1D9DA 4GRSA 2HVHA 2ZM6F 3RGIA 1FRKA 3GV8B 3RBZA 2HW3A 3L4BC 4ZS6A 4JYAF 3DYAA 1JX4A 4MMOA 4AT1B 2PGCA 4XDDA 2HVDA 1B7FA 1VQ5S 5AT1B 3AODA 1YIJS 1S9GB 1BQMA 3M6XA 1X9SA 2IRXA 4F4AA 3KXDA 3IGNA 1XERA 4USIA 2IA6A 3HKZD 4IFYA 2Z2LA 2RHQB 2FGCA 4ZKAA 2EBGA 3MM6B 5DS7A 2F8MA 2HMIB 4JI8F 3ZTPA 1FKPB 1NO8A 2AW0A 3KLHB 2QT7A 2ZUAA 2CPIA 1RWMB 3ZNUA 5ADZA 1FRLA 2D3O1 1A9NB 5E5NA 2AP6A 5IFMA 2M8HA 4HEA9 3D3BJ 4LFBF 3OXLA 3NCQA 3HFZB 4ANCA 1FKAF 1JKHA 1NJIT 4NOHA 4O3OA 1N5YB 1Q8IA 1FFSB 4LFAF 1RI7A 4PG7A 3CJ4A 4A47A 2CZ9A 2V68A 3LGMA 5AE3A 1BQNA 5AXNA 3MOJB 5KT4A 3HZEA 3GSDA 4JV1A 1FRHA 2W4PA 2FJAB 4I7FB 2WOMB 2QFIA 3PM9A 4Z7YA 2R2TA 4PZVA 1HLWA 4LREA 1DRZA 1N5QA 3MMCA 1JLGB 5ETQA 2PFDA 4WXWA 4NL5A 3LPEA 4JI2F 2NXUA 1BE4A 3KKFA 3CCTA 1C0UB 3RRGA 2J76E 3M9NB 3CJKB 3T9ZA 3EVWA 1S1TB 3PW4A 2DO0A 1UFWA 2DNNA 2ASJA 3CJ0A 4IR1A 2HK2A 1WF2A 3JQMA 1FK9A 2VFSA 4DPOA 4YB5A 1U2FA 3MF5A 2ZWOA 3OJSA 3MEGA 2D74B 3FFIB 3QQCD 3NCRA 1J27A 4X4PA 2PEHA 5J2MA 3IRWP 5DG9A 1S0OA 2W24A 4EUVA 4C3KA 3BSNA 2XMAA 2D3OR 3HHKA 1T9UA 1SVDA 3QMQA 5KG6A 2W9CB 1E6YA 1U1MA 2E5JA 1N32F 3GU0A 4ED1A 4G6VB 2FUG9 2YBVA 4TNOA 4X4VA 1RTIB 2R8HA 1R0AA 4DF8A 4FBTA 1Y10A 2KL8A 5D0GA 3WBZA 2N3OA 4EZ6A 2VFTA 1HQEA 2Y3YA 1FE4A 1IBLJ 3A8JA 2KZZA 3CUNA 2YNFB 1SL1A 5CH7B 2VG7A 2DCLA 2JEJA 4DSKA 2C2RA 1CJTA 5ETVA 1WHWA 1FFGB 4DU7A 3W7BA 1NB2A 2KYXA 3GFYA 4M5LA 1RTJB 2BKOA 2LVWA 1S1UB 2HPUA 3HVTA 4R0JA 3KNAA 1DZ5A 2KTQA 2HZCA 3MCOA 4U7CA 1YBUA 3DU6A 2BJEA 4DN0A 5CD4A 3GP9A 1FVSA 1LK7A 4NASA 4OYMA 3P8BB 5L46A 1RWVB 3H42A 2P9CA 4DQRA 3HFKA 4WK1A 1YJ9S 2AD9A 2MTLA 1S6QB 4UOFA 4BS2A 5AXKA 4PEOA 2GC8A 1RUSA 4KGZB 2G4BA 2DRDA 4C48A 3H25A 1YKWA 3CD5A 1SJQA 2RB7A 4ZITA 4B9NA 4K4TA 4DUYF 2LQ9A 3V6HA 4UOHA 2MKCA 1RT1A 5GAGU 3QNWB 1L3SA 4KH1B 3PEJA 1WEZA 1YI2S 2WK4A 3QWUA 4G1QA 2NSCA 1FX4A 2H51B 3VCDA 4K4ZA 4QOTA 1TL1B 1UPPA 1BHNA 1KFDA 1H7XA 4NPOA 2IDEA 3FMBA 1KD1T 2AIRB 2OELA 1FCAA 5L1LA 4I2PA 2ZE2A 5DG7A 1YVFA 2J6UA 1XK8A 4ZPTR 3EICA 2PIIA 5IOLA 1FXLA 4OX9J 3GJQB 4ZPBA 1YZ7A 2HGMA 3KK1A 5A8RA 4M5KA 1C1BA 2GFFA 1QVGR 1SKRA 3T1HF 3MEDA 3DU5A 3R7NB 2HGLA 2R4FA 3DLEB 2YNHB 2YQ1A 5I3UA 1RHQB 1IKVB 2VFRA 3EGNA 2LEAA 1JNRB 3A1YG 1R8PA 2VPXB 5LMUJ 2DGUA 2R2RA 1HFEL 1PKUA 1NJYA 1X4EA 2M0GB 3DHWC 2V4JB 5D4LA 4ZN3A 2QMXA 3I31A 2W2MP 4OZNA 4I69A 4DG1B 3UD5A 1AB8A 2X1AA 1HQ2A 4URGA 3MM9A 2UUBJ 4LF8J 2HQDA 2F7VA 2H1YA 3Q2TC 1S1VB 1QAIA 3BQ0A 2OD6A 4O3SA 3E3XA 4M8LA 3C15B 2G0IA 1O51A 3PV8A 3ET6A 4M5NA 3BB5A 4WCEQ 3AH6A 4U7UD 5F8JA 5IT9U 1SJRA 3VAFA 2DJWA 1L5UA 4QIFA 2DGOA 3IGVA 2BJ3A 4C0OC 3GONA 4B3MF 3DLBA 2HS3A 2IJNA 5CYMA 1O6XA 1MROB 3D4JA 1F3VA 5ETKA 3HDSA 4OZ2A 3W63A 4CLFA 3MGJA 3DLJA 3TX8A 1IBKJ 4NYOA 1XNQF 1S76D 1N34F 3NEKA 8AT1B 3CCMS 1YRTA 4KC5A 1GTEA 3QJPA 4OIXA 5B0CA 4OZ5A 4DPWA 4Z2XA 4KFBB 3QGHA 3J7YU 1PJ6A 2GGPB 5CD4H 1WG4A 1SQEA 1YRUA 2ZH3A 3TI0A 5IC6B 3WQPA 1RAHB 3Q86A 4L6V3 4A8YA 3LTOA 2A6MA 4DR4J 1R8AA 1NK5A 3CCWA 1H0HB 2CQDA 2BRLA 1FDNA 1ITPA 3RB4A 2XCAA 1NK6A 3T1AA 3PIOQ 2CJQA 2PMWA 1X5PA 4Q5VA 1FF2A 1UWBA 4QIWD 1IBCB 4JV0A 3MR5A 3LGHA 2ZITA 3HXMA 2PEBA 2XS2A 1N8RT 3KLVA 5ITHA 3OR1B 1S12A 5KT5A 1SJFA 3M32B 1KKHA 3V6KA 4MTPA 2AZ3A 4Y00A 1M5PC 2DXEA 3CCES 3VZIA 2HIYA 2KHDA 2Y1IA 1DAXA 1X7VA 1HIYA 4C3LA 1RB0A 3M2VB 1VBYA 4OJGA 3NRBA 1LFPA 3N6LA 5LJ3Y 1VCTA 2ZH4A 2ZJQQ 2BANA 2R7SA 4USWA 5B0FA 2VU5A 3HFVA 3JTNA 3TX0A 3N79A 2BXJA 4WPAA 4M5MA 2Y1RI 4JBCA 1F9FA 1HI1A 3P5BP 4WE1B 1CJUA 1JLCB 4IRCA 2LQJA 4Q2LA 3Q24A 4DR7F 3BSCA 1UEVA 3LH2S 3UD3P 4CLPA 1HWJA 3R5DA 3LANA 2D9PA 3UR3C 4PWUA 5BYRA 3A8EA 4FN5A 3W8PA 3H5XA 4AXIA 2W2PP 1JLAA 1RWUA 3NLCA 2Z2ZA 1FRXA 1KP6A 3U1NA 2KHCA 5C24A 1X0FA 3FNNA 4RNHA 3EXYA 5T7LB 3BS9A 2XMVA 6FDRA 3IRXB 1YJUA 4C8NA 1WG5A 1NDLA 5K14B 2ZFHA 3S7RA 1NK4A 1IKYA 1X4FA 2BE2B 3P45B 2Q79A 2YPZA 5JXSA 2QL7B 3DRXA 4ECVA 1LWEA 4DHVA 3VGVA 1WTBA 2V4QA 1JLEB 2KDOA 5HVHA 5FLXU 4DX8H 4UUXA 1HR0F 2GO9A 3GYGA 5H9FJ 4W90B 2V50A 3M30B 3GB0A 1WOOA 1RT4B 3PTWA 2MQ8A 1JLBA 4B9VA 1UVKA 4LF5F 4DFPA 2M5YA 4GVBA 3DOLA 3JTPA 3DDKA 2QO3A 4KY3A 2B7CB 4EI2A 3S01A 4L3KA 3M9OB 4NCGB 5KFNA 4P71A 3I96A 2MKYA 1VGYA 3UDVA 1LEOA 1GXLA 4DX6A 1WORA 2FZCB 1WI8A 2VG5B 4TU7A 1RDRA 3GYNA 4JI4J 1HBMB 1FJGF 2XY6A 2YWKA 2A1BA 3QT7A 3CGIA 3PFOA 3UNYA 2VC0A 1T03B 1PAUB 1ZAWA 3T1YF 3V5RA 3GG0A 2W7AA 5LT5A 4M5GA 3NMRA 4FVMA 1UJ6A 2NPFA
chains in the Genus database with same CATH topology
1C4AA 4PG5A 1HMVA 3R1LA 4F02A 3M30A 3ZZUA 3G9CA 3MMAB 4JI6F 1KVJA 1GX6A 3K5OA 2LA6A 1RT4A 3DXBA 1KQKA 1Q82T 2DD8S 1GQEA 3MDFA 4QYRA 2L9WA 3H8YA 2FVQA 1RP5A 1IBKF 2O5DA 2AJ0A 1VQKS 2LDIA 4ICLB 1MU2B 1FTCA 2MZJA 4JI5F 2E7XA 1YITS 4OLOA 1L3TA 1TV6B 5H9EJ 1X9WA 2DNOA 1N56A 4N41A 5HROB 5AXLA 2JH3A 4I2PB 1HPZB 2ZE2B 4ID5B 2DRAA 3UR0A 1HL6A 2HNZB 1KHWA 3D1QA 2PMZD 4B3OB 3CCZA 1KOOA 3TARA 4IDKB 1WTFA 1CQNA 2XNRA 2ZOMA 4OLPA 4XK8C 2CQBA 2AGPA 4ZP9A 2VPZB 3OSPA 1FRIA 2E5LF 4QU6A 2ZDOA 3LUYA 2N7CA 2MZQA 3M6UA 3R1HA 1I94F 2I2YA 2QRRA 1TR0A 5E33A 5F8LA 3K57A 2DK2A 1U1LA 3D5MA 2FVRA 4HTJA 4O0IA 4JOUA 2LLZA 2KT2A 2CQGA 2K1RA 3KK1B 1S9EA 5A8RB 5D6GA 1LFWA 1C1BB 1Q4RA 3PW0A 3AA8A 1U45A 2CQIA 2CQ0A 1VRUB 2A3JA 3DLGA 3DFEA 3MEDB 1PGZA 4WFNQ 5KFWA 1FA0A 1HHTP 4UQGA 2KXFA 2PA8D 3KYLA 5I3UB 4YMEA 2U2FA 2QLWA 1VQ9S 4HT7A 1HI0P 3E2EA 2K2PA 5KFKA 4HDHA 2M4MA 2HVIA 2ZHBA 1KLMB 1EETB 5FDLB 3DOKB 2XY5A 2IHR1 1C0TB 2JRSA 4NLWA 2MKKA 4ZPWR 3FSYA 4DR5F 2FLLA 3OTCA 2KI2A 1H7WA 3PVXA 3QPIA 2ZH5A 1R8BA 2QFJA 3V6DB 2D41A 1HNVA 5HMZA 4B08A 2WONA 5DGBA 1FXDA 1S6PB 1SI9A 3FRYA 3SXLA 2LU1A 3AY0A 5D4PA 4P7VA 3EGZA 4KPYA 3BGFA 4ZLPA 5HROA 2ZKUA 4R8UA 3HX9A 4USHA 1TL5A 3N28A 1GXUA 3QO9B 4OHWA 2JC1A 2BABA 2OKQA 2HWIA 2RDIA 3ISNC 4FZVA 3MM9B 3OTBA 3EPIA 1YJVA 4UY8T 2PI4A 2UV8G 5KT2A 4NXNF 3KFWX 4C8YA 3FEYB 3T6JA 1DTQB 2ASYA 3RBDA 1LOUA 1DFDA 1URRA 3KLIA 1MW7A 2FVSA 4KJIA 4TYBA 4NLDA 4KV8A 3C6TB 2AYGA 1RGVA 1R43A 1B64A 2L9NA 2W9BB 2HWHA 4MFBB 3CPWR 4PPZA 4QBUA 1M1KT 2XO7A 4CCHA 1QJHA 3MXHP 5E3RA 2BOPA 2R7VA 1U7LA 4Y2AA 4TYAA 4HKQA 2RDJA 2HNYB 5D3GA 2YH0A 3BSOA 1NHUA 2DHSA 2JLGA 1P27B 3RBEA 2MJUA 4DL0C 4HL9A 1VC0A 4X4TA 3SQGB 2ZH7A 2M9KA 1QY7A 3IR6B 3FDSA 4CT8A 1VQOS 4ELVA 2BQ3A 2A2CA 3HMJG 4ZP8A 1T94A 4EYIB 1IXKA 2DNQA 2ZBCA 2JLEA 5F8IA 2VBXA 1NKBA 3DOKA 3RYLA 5HL7Q 2Q66A 1C0TA 1H3DA 3I6PA 4Y34A 2CZ4A 1YG0A 4YR2A 4K5SA 2Y1JA 2P6TA 3CC7S 1Q7YT 1NEEA 4MYUA 5CYMB 5KFDA 7FD1A 1HBUB 2KM8B 2D7SA 1WNEA 2UXBF 5GAHU 3CCSS 1HBNA 2HIQA 5LSLA 4FF1A 4F25A 1UVIA 4EEYA 3SCJE 4NLXA 3I56S 2RE1A 1QAYA 2RRBA 1HW8A 3QO9A 2V0NA 2EK6A 4FS1A 5KFEA 3W2VA 1RK8A 2JDJA 2QSWA 2VPYB 3LP2A 3J7Z5 2L41A 5HN0A 1B0PA 4C3MA 4Z37A 2ZNZA 4IR9A 4TN2A 3OL7A 2XSJB 2ZD1A 3VTIA 4TQRA 2YKOA 3ICLA 2KZMA 2RQKA 1BD6A 5F8NA 3OR2A 5G0RB 4FF3A 1OQ3A 5L9NA 2GA7A 2KRBA 3K7RA 3C6TA 1D9FA 2JFKA 3FQKA 2KG0A 2WB1D 4MIWA 2KYZA 4NYPA 5LMNF 4NLVA 1DLOB 2G9OA 3BQ2A 4PQAA 1Q7LB 2HNYA 2ZH8A 1PSDA 4KR0B 4MIBA 1FVQA 4DV6F 1YQHA 4WYLA 3DM2B 3Q8PB 5LXRA 1XR6A 3OL6A 1NJXA 5KFBA 3SZ2A 3CXCR 1HARA 4Y2MA 5A8KB 3IFEA 2J8AA 3Q23A 4IQXA 3L7OA 5L1KA 4ZPCA 1MMLA 3KMQA 3G6VA 4ETZA 3H4DA 4QR1A 1X4CA 1Y5LB 1PC5A 4C2MA 1ZH5A 3KLGA 2ZHOA 2B6AA 4BC7A 1GH8A 2YNGB 1K0VA 1ZM4A 4Y6IA 2XNQA 5F9LA 2OO4A 2CPEA 4MYTA 4CO0A 2FJDB 2EC0A 3THTA 1FD2A 2YKPA 3T5JA 1S6UA 4OZ0A 5JJBA 2G13A 4R5PB 4TY9A 4K4WA 3NNAA 4C9DA 2ZOGA 3L09A 5L1IA 1TK8A 2W4CA 4MAKA 1F5CA 1J5OB 3THVA 5D4OA 3M4XA 1UWBB 2J6SA 4Q0BB 3G71S 2DISA 2U1AA 3KMSA 2NS1B 2GQCA 2WHOA 4NA2A 3CC2S 2KU7A 2DR9A 1CLFA 2IBKA 2KVIA 3CMAS 4NLUA 3EZ5A 2R7QA 3RAQA 1ULRA 4TQSA 2XI2A 2LA4A 2O1PA 2CYYA 4ZCIA 4JV2A 2HHXA 3HP6A 2FDNA 2ZUGA 2LXIA 4RU9A 3T3FA 1M5KC 3N5FA 1UA0A 1AFIA 2ZDPA 1TKZA 4ZHRB 1KC8T 3H59A 3IAM9 1TKXA 4F4XA 3HHEA 4B17A 3OHAA 3OVBA 3US5A 3MCSA 2XLKA 5HP1B 3P5TL 1D8YA 2ZH1A 3UE2A 2PT0A 5BR8F 2RRNA 3GG1A 2GHWA 3JSRA 3V4IA 2CJ9A 5DM7Q 1HWLA 2MPUA 1UVMA 4YFUA 4QCLA 2E5GA 4YHHF 2NLWA 3I0RB 5KFYA 4DS4A 2UVRA 3QWPA 3KG4A 3TRGA 3Q8QB 5A8KA 1M0SA 4K4VA 1OSDA 1RISA 1X4HA 4I0WA 2D9OA 1C4CA 5B7WA 1JLFB 4WTYA 3HVWA 4WKYA 3T5HA 4NLRA 2KFZA 2OPQB 2XMUA 4KGKA 2EWHA 3N0VA 3PW2A 2WBRA 2JVOA 3MPWA 5KFMA 2G1DA 4NZ0A 3HHLB 4FNIA 1QAJA 5C5JA 2MZ1A 1NK0A 2DNPA 2B5JB 4WFZA 3PJXA 4MKBA 3TP2A 4TU8A 1NZAA 4I6YA 4DEZA 5K8PA 3BDEA 4Q7AA 2XMKA 4FNHA 4RW7A 1Q86T 2B43A 2DGQA 1X4BA 2I38A 2J0SD 1REVA 3IR5B 2A18A 4Q44A 5DRKA 3QAEA 3CIMA 2CKWA 3H2VE 1ZAXA 2KG1A 2XWYA 4QU7A 3LWMA 2GQ2A 2DCUB 4B3SF 4X4UA 1BWEA 4F2SA 2IJFA 3M8RA 4C8MA 3O2IA 4RWWA 3ENVA 3E51A 4NA1A 2DB1A 3SFGA 1FD8A 1LKZA 3DLKA 4QIVA 5KG7A 1N4LA 1ZOTA 2FJEB 4IG0A 3TUJC 1U1OA 3B4MA 1CQMA 2V9KA 3K59A 1R6YA 3TUIC 5M2PA 4OJ1A 3N4WA 1S1XB 4RBVA 2XMJA 4X66F 2CJKA 1NH7A 5K9FA 3CD0A 4ED8A 1OPZA 2BBEA 2DGVA 1GT8A 2MQOA 3M8SA 4NYZA 1QSLA 4LSNB 2LEBA 3LPYA 5L9XA 3GE9A 1DHMA 1U8SA 1R7IA 3OV7A 3ENQA 2VQFF 1G2EA 4HT5A 1UETA 5B0GA 5GVQA 4B9SA 3DI6B 2RS8A 2SXLA 1KQGB 2KM8C 5CHCB 3KJVB 1S9GA 2AJ1A 2Z0GA 2UVUA 1G1XA 1K1SA 2BJDA 2B9XA 1R89A 4OJ3A 1IQZA 3ENWA 5KFHA 3QLHA 2M7SA 2OPQA 3DMJB 2VG6A 4A4JA 3R27A 1MNEA 3PHEA 2DH7A 3POTB 3OJUA 2MY7A 5B0BA 3ZZYA 1WACA 3IAS9 1VRTB 2EK1A 5C24B 4NCAA 3HHLA 1SH2A 2Z2MA 1XMQF 5KFVA 1FT8A 1Y5IB 2B5JA 2J7UA 3ISND 5CCMA 5GADU 2XEXA 3OFEA 2CJBA 1RYRA 1VIOA 3MM6A 2H9ZA 5KT3A 5IM0A 5DM6Q